WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Manis javanica JSZB00000000.1 (JSZB01) 62 7 3 9 18 17 2 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Manis javanica V20 trav JSZB01012102.1 75235 VGVQMKVAQSPEVLNLQQGGNSSLKCNFSISITSMQWFQQNPGGRLISLFYMASGMRQKGRLKSTVNIKERYSHLYITDSQPEDSATYICAAG
Manis javanica V0 ighv JSZB01002634.1 38433 VQCEVQLVEAGDGLVQTGGLLRLTCEASGFIFDNYGMNWIHQAPEKGLQWVSTISGSGGGKYYTDSVKGPFTIFRDNAKNTVHLQIHHLTDEDSALYYCAR
Manis javanica V1 trdv JSZB01003480.1 8822 SSMADRVTQAQATITAQEGEAVTLPCTYETSSNVYYLYWYKQPASGEMVLLITQHSSYSNAKQGGYSVNFQKAKKSISLTISSLQPEDSAKYFCALLE
Manis javanica V2 trdv JSZB01003480.1 40883 SSTAASVTQVQATITVQEGEAVTLPCTYETSWSTYILYWYKQPASGEMVLLITQYYSYSNAKKGRYSVNFQKAEKSISLTISSLQLEDSVKYFCALVE
Manis javanica V3 trbv JSZB01008523.1 107345 VRAQTIHQWPRSRVQPVGSPLSLECTVRGASNPYLYWYRQAGGGALQLLFYSVGAGQVDSEAPQHLEASRPQDGTFVLNSTKLLLSDSGFYLCAWS
Manis javanica V4 trbv JSZB01010923.1 3126 GLMDAVVTQMPRHHIIRAGSKMSLQCSQDMDHFTMFWYRQDPGQGLRLIHYSTDVNSTAKGDITEGYSVSRDDKAHFPLTVESASTSQTSTYLCASS
Manis javanica V5 trbv JSZB01010923.1 22396 AVDAGVTQSPGYLIKGRLGKATLKCSPISGHNSVLWYQQARGQGPQLLVEYYERMQRAKGNFTDRFSGQQLSDYSSELDLRDLEPGDSASYLCASSW
Manis javanica V6 trbv JSZB01010923.1 26969 HVDAGVTQSPRYKVTGTGDRVVLRCHQTENYDYMYWYRQDLGHWLRLIHYSYGINNTEKGEVPDGYDVSRLNTEDFLLTLESPTRSQTSVYFCACSD
Manis javanica V7 trbv JSZB01010923.1 34471 SKDATVSQTPRHRVTKTGQAVTLRCEPIPGHTTLFWYRQTSMQGPQSLIYFTNQVPIDKTGMPKDRFSAEMPSGSLSNLKIQPAEPGDSAMYLCASSV
Manis javanica V8 trbv JSZB01010923.1 66781 TLPFTGTVDGGISQTPKYLCSKEGQDVTLRCEQNFNYDSMYWYRQDPGQGLRLVYYSMVENDVQKGDLHKGYNASRKKKESFSLIVTSTQKDQTALYLCASSV
Manis javanica V9 trbv JSZB01010923.1 77724 SGFGALVSQHPSRALRKSGASVKMECRLVDLEASTMFWYHQSPKQGLILVATSNQASDVIYEQGFTEDKFPISHPNVTFSSLMVTSVQRADSSFYFCGAS
Manis javanica V10 trbv JSZB01010923.1 85931 SMDTEVTQNPRHLLKGQGQTAKMDCVPIKGHSYVYWYHQKLGEELQFLVYLQNKDIVDKTEVFDQQYSAQCPTDQPCSLEVNSTEPGHSAVYFCASS
Manis javanica V11 trbv JSZB01010923.1 89840 FIDARVTQTPRHLVKSKGQKARMDCIPPKEHTVVYWYQQIQKKEFKFLINFQNEQIIDQIELVKKRFSAKCPSNSPCSLEIRSSEPEDSALYFCASS
Manis javanica V12 trbv JSZB01010923.1 100663 FMDADVSQTPRYCVTGRGKKVILECSQTMGHESMYWYRQDAGMELQLIHYSYGVNITEKGERSSGSTVSRPRKDHFVLTLQSASPSQTSRYLCASSE
Manis javanica V13 trbv JSZB01010923.1 105524 LEDAAVTQFPRHVISGAGKKLTLNCLQNMNHISMYWYRQDSGFGLQLIYYSTGRNTFEKGDIPDGYGVSRNETESFSLTLGSASTNQTAVYFCASSE
Manis javanica V14 trbv JSZB01010923.1 111916 PAEAEVTQTPRHLIAKTQKRLTINCSQNMNHEAMYWYRQDPGLGLRLIYFSRSVELFETGDVPDGYSVTRKEKGKFPLTLEWSSTNQTAVYLCASSL
Manis javanica V15 trbv JSZB01010923.1 124191 LTDAEVTQTPRYLVKRKGEKVFIECLQDMDHERMTWYRQDPALGLQQLYFSYGTGSTEKGDDVPEGYSVSREKKEAFSLTMESAGTNQTAVYLCASSE
Manis javanica V16 trbv JSZB01010923.1 129607 SVFGVLLSQKPSRAICQRGTSTGIQCQVDSQVSLMFWYCQRPGQGLMLMATANQGSEATYESGFAKDKFPISRPNLTFSVLTVSNVSLEDSSLYFCSSD
Manis javanica V17 trav JSZB01012102.1 31775 VSSVMTVEQTPQSLHVQEGKSTNFTCNFPSSNFYALHWYRREPAKSPKTLFVITVNGDEKEDGRVRVTLNTKDGYSYLYIKGSQPEDSATYLCAL
Manis javanica V18 trav JSZB01012102.1 39215 VNGQQIKQIPQFLALQEGEDFSTYCNSSTTVNGFQWYEQKPGGRPVLLMIVVKVGEVKKEKRLTFRFGETRKDSSLHITAAQIADVGTYFCAE
Manis javanica V19 trav JSZB01012102.1 52130 IMTNAKTTQINFQDHAEGEDVNLHCNHSTIGGNEYVHWYWQNSNQSPQYIIHGLRDTVIKSMASLTITAHRKSSTLTLRRVTLRDAAVYYCILRDASWGR
Manis javanica V21 trdv JSZB01012102.1 93101 SSMAAKVIQAQDTITAQEGEAVTLPCTYETNWRTYSYTLYWYKQPSSGEKVLLISQNHDESNAKQGRYSVNFQKAKNSISLTISSLQLEDSGRYICALQLLNEF
Manis javanica V22 trdv JSZB01012102.1 108037 SSMAYRVTQPQATITAQEGEAVTLPCTYETSWSTYILYWYKQPASGEMVLLITQYSSYSNAKEGPYSVNFQKAKKSISFTISSLKLEDSVKYFCALVE
Manis javanica V23 trav JSZB01012530.1 39160 ISGKNEVEQSPPYLTAQEGDCITMSCSHRVGMTTLNWLQQKPGGGIVSLFVLSLEMKKTGRLRATVNTKDHHSSLHITAVQPRDSAMYFCAV
Manis javanica V24 trav JSZB01012530.1 95157 SSNTKGIYQSTNAVHKQEGGSVALDCTVTVSFTYFVIYWYRQLSSGEITYIIQLYSEYRSFRTGRYSVVFQKPSKVLKLTISALTHGDSAIYFCAVRD
Manis javanica V25 trav JSZB01015714.1 3063 VSGVEVEQSPPAQSLQEGATSMLQCNFSTSVNSVQWFHQNPGGHLVHLFYIPSGTKQDGRLNSTTVSRERRSSLYISSSQTTDSGIYFCAVG
Manis javanica V26 trgv JSZB01015966.1 7186 GLGQTKPKQLEISVTRARDKSAHIRCKVTIEAFGEEMIHWYRQKPDQSIEYLIYVSGTFNSGSLGGKNNKLEASKNLAAFTSTLKVNFLEKEDEAVYYCAFWT
Manis javanica V27 trgv JSZB01015966.1 11099 IGGDILITQLRTSITKKKGNTAFLECQIKTDTLKKNVYVHWYRQKPDQPIKRILYISSNENVVHEQGFSEERYEARKPQDDLPASLRIHQVKEADAGLYYCACW
Manis javanica V28 trdv JSZB01016477.1 34947 VSLDIILEPDAKILTVVLGETATFRCSLTGGHSDSYRASWYKKSERNNSLTLVYIIKNNSSTNARSHFKGDIDSLNSQYIFVIQNTTTEDAGTYYCGSD
Manis javanica V29 trdv JSZB01016477.1 59053 VTSAFVLVPQDEAVTVPVGESVTLRCTMEGAAITSYYMNWYRKTQVNTLTFIFRDGGTYGPGFQHRFRGNVDKSNNQVLLEILKASEVDEGSYYCASE
Manis javanica V30 igkv JSZB01017649.1 23117 LQPRTQTSSPGRPQGHRPVHLCYTSCSLSKNYLAWYQQKPGQAPKLLIYLASTRASGVPDRFSGSGSGTDFTFTISSAQAEDLATYYCQQHYSSP
Manis javanica V31 ighv JSZB01019841.1 9862 VHSQAQLVQSEAELKKPGTSVKVSCKASGYTLTSYYMTWVRQVPGQGLEWMGYIDPSSGGTKYAQKFQGRVTLTSNTSTSTAFMELSSLRPEDTAEYYCG
Manis javanica V32 igkv JSZB01020860.1 18230 ACGDIVMTQSPASLAVSPGQRVTINCRASQSVSSYVAWYQQKPGQAPKLLIYSASTRASGVPDRFSGSGSGTDFTFTISSTQAEDLATYYCYQHYNYP
Manis javanica V33 igkv JSZB01027491.1 16467 SSGDIVMTQSPHSAPVSPGESASISCKSSQSLLHSNGNTYLNWYLQKPGQSPQFLIYGASNRVSGVSDRISGSGSGTDFTLRISRVEADDAGVYYCQQAMQNP
Manis javanica V35 ighv JSZB01043364.1 161 VHSQAQLVQSGAELKKPGTSVKISCKVSGYTFTDYYMHWVRQVPGQGLEWMGRIDPSSGGTSYAQKFQDRVTLTRDTSTSTLFLELRSLRPEDTAVYYCAR
Manis javanica V36 igkv JSZB01054268.1 8365 ACGDIVMTQSPASLAVSPGQRVTINCRASQSVSSYVAWYQQKPGQAPKLLIYSASTRASGVPDRFSGSGSGTDFTFTISSAQADDVATYYCQQRNSYP
Manis javanica V37 igkv JSZB01062175.1 8804 ACGDIVMTQSPASLAMSPGQRVTINCRASQSVSSYVAWYQQKPGQAPKLLIYSASTRASGVPDRFSGSGSGTDFTFTISSAQAEDLATYYCQQYYSYY
Manis javanica V38 ighv JSZB01065129.1 296 VQSEVQLVESGGGLVQPGGSLRLTCAVSGFNIRTANMHWIRQASGKGLQWVSSISSGGSTYYTDSVKGRFAISRDNAKNTVRLQMNRLTDEDTALYYCAA
Manis javanica V39 ighv JSZB01069929.1 660 VQCEVQLVESGGGLVQPGGSLRLTCAVSGFNIGIADICWIRQASGEGLQWVSSISSGGSTHYTDSVKGRFAISRDNAKNTVYLQMDSLTDKDTALYYCAA
Manis javanica V40 igkv JSZB01079819.1 3670 SSGDIVLTQTPSSPPISPGEPASISCRSSESLVHNDGNSYLSWYLQKPGQSPQLLIYRASNRVSGVSDRFSGSGSGTDFTLRISRVEADDAGVYYCQQARKT
Manis javanica V41 trav JSZB01002963.1 79023 MSRGEEVEQHPSFQTVQEGDSFAINCTYTDSASTYFYWYKQEPRKGLQLLMHILSNVEQKKEERLTVLLDKKDKHLSLHITATHSGDSATYFCAVR
Manis javanica V42 trav JSZB01002963.1 60046 VARAQQVTQPEVHVSVPEGGPLELRCNYSYSGTPYLFWYVQYPSKGLKLLLRYFSGAILVQGIKGFEAEFKRSESSFNLRKSSAGWSDLAQYFCALG
Manis javanica V43 trav JSZB01002963.1 54334 RSNGNSVNQAKGQVTFLERDSMTMNCTYSATGYPTLFWYVQYPRAGPQLLLKATKANEKGRNKGFEATYNKEASSFHLEKASVQELDSAVYYCALS
Manis javanica V44 trav JSZB01002963.1 47746 VTRAQQVTQPEVHVSVREGAPLELRCNYSYGGTPYLFWYAQYPSQGLQLLLRYFSGDIVVQSIKGFEAEFKKSESSFNLRKSSAHWSDSAQYFCALG
Manis javanica V45 trav JSZB01002963.1 41424 VSRGETLKQHPSTLRVQEGKSSVINCTYSDSSSSYFPWYKQVPGKGPELIIDIHSNKDTKKDQRLTVLLNKAAKHLSLHIEDTQPGDAAVYFCAES
Manis javanica V46 trav JSZB01002963.1 23067 ASSINQVEQSPPSLIILEGENGTLQCNYTMSPFNNLRWYRQDAGRGPVSLIIMSNAESRKSKGRYTATLDTARKRSSLHIRAAQLSDRAVYICVVS
Manis javanica V47 trav JSZB01003423.1 73420 MRSQQKGVEQSPGSLRVPEGAIASLNCTYGDSASQYFPWYRRYSGKGPELLIYIFSSGDKKEGRFTVQLNKDSQYVSLLTRDSQLSDSATYLCAVS
Manis javanica V48 trav JSZB01003423.1 68664 GTRAQSVTQPNGHITVSERDRLELRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSGNNLVPGIKGFEAEFKKSETSFHLKKPSAHWSDSAQYFCSLS
Manis javanica V49 trav JSZB01003423.1 54509 VNSQQGEQNHWALSIQEGENATMNCSYKATITTLQWYRQDTGRGLSLLILIRSNERHKSHARLQVTLDPSSKSSSLSITVSQAADSAAYFCAMD
Manis javanica V50 trav JSZB01003423.1 49429 GTDGDSMMQTEGPVTLLEGKPLSLNCTYQTSYSATVFWYVQYRNKELELLLKSSSGNQGTGHTGFQASLVKSESSFHLQKPSVQTSDSAVYYCALE
Manis javanica V51 trav JSZB01003423.1 26682 SSMTQKVTQALSTISMVQKASVTLDCAYETSSYTYYLFWYKQTPSGEMIFLIGQESYNEQNAAEGRYSLDFQKPASSVSLTITALQLQDSAMYFCALRE
Manis javanica V52 iglv JSZB01005898.1 83676 SVISSELIQPLEVSVAVGQTARISCQGDSFESDYAHWYQQKPGQAPVLLIYQESNLASGIPDRFSGSSSGDTATLTISGAQAEDEADYYCQVWDSSDT
Manis javanica V53 iglv JSZB01005898.1 78031 SVASYELIQPPSVSVDPGQTALITCSGDLLSQRYAHWYQQKPGQVPRLVIYKDSERPSGVPDRFSGASSGNTATLTISGARAEDEADYYCQSADSSGN
Manis javanica V54 igkv JSZB01006810.1 42107 AYGDIVMTQSPASLAVSPGQRVTINCRASQSVSSYVAWYQQKPGQAPKLLIYDASNRPSGVPDRFSGSGSGTDFTFTISSAQAEDMATYYCQQRNSYP
Manis javanica V55 trbv JSZB01007437.1 28415 LLDTAVFQTPKYLITQVGSKKFLTCEQKLSHNTMYWFKQDSKQPLKTMFIYNNKDLILNDTVPSRFSPESLDRAHLNLHVSSLEAGDSAMYLCASSQ
Manis javanica V56 trbv JSZB01007437.1 26109 SMDTGMTQTPKYLVMGMRNNKSLECEQHMGHNAMYWYKQSAQKPPELMFVYNYVKLIENNTVPSRFWPECPDSSRLKLHLDALEPEDSATYLCASSK
Manis javanica V57 trbv JSZB01007437.1 19515 LVDSGVIQTPRHLIKARGQQVTLRCSPMPGHLSVSWYQQVLGQGLRFLFEYYNKQQREKGNLSDRFSAQQFQDSSSELSVSSLELTDSALYLCASSM
Manis javanica V58 ighv JSZB01012069.1 13280 VHSQVQLVQSGAELKKPGTSVKISCKASGYTFTSYYMSWVRQAPGQGLEWMGGIYPSSGGTNYAQKFQGRVTMTRDTSMSTAFMELSSLRAEDTAVYYCAR
Manis javanica V59 ighv JSZB01012069.1 5575 VRCEVQLVESGGGLMQPGGSLRLTCVATGFTFRNYYMSWVRQAPGKGLQWVAGISGNGNSKYYTDSVKGRFAISRDNAKNTVDLQIDRLTDEDSGRYFCAK
Manis javanica V60 igkv JSZB01021207.1 6780 ACGDIVMTQSPASLAVSPGQRVTINCRASQSVSSYVAWYQQKPGQAPKLLIYSASTRASGVPDRFSGSGSGTDFTFTISSAQAEDLASYYCQQDYSSP
Manis javanica V61 iglv JSZB01032806.1 5642 ADSQTVVTQEPALSVSPGGTVTLTCGLDSGSVSTSNYPGWFQQTPGRAPRTLIYNTNSRPSGVPGRFSGSISGSKAALTITGAQPEDNTEYFCALYMGGSI
Manis javanica V62 igkv JSZB01034497.1 7761 SSGDIVMTQSPHSVPVSPGESASISCKSSQSLLHSNGYTYLNWYMQKPGQSPQLLIYGVSNRASGVPDRISGSGSGTDFTLKISRVEADDTGVYYCQQDIQNP