WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Mus spretus LVXV00000000.1 (LVXV01) 236 81 2 75 48 20 4 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Mus spretus V71 trav LVXV01017122.1 67214 ESHGEKVEQHQSTLSVQEGDSAVINCTYTDTASSYFPWYKQEAGKGLHFVIDIRSNVDRKQSQRLIVLLDKKAKRFSLHITATQPEDSAIYFCAA
Mus spretus V72 trav LVXV01017132.1 31723 GVSGDKVKQSPSALSLQEGTNSALRCNFSIAATTVQWFLQNPRGSLMNLFYLVPGTKENGRLKSTFNSKESYSTLHIRDAQLEDSGTYFCAAE
Mus spretus V3 trbv LVXV01006772.1 54807 PVDPKIIQKPKYLVAVTGSEKILICEQYLGHNAMYWYRQSAKKSLEFMFSYRYQKLMDNQTASSRFQPQSSKENHLDLQIIALKPDDSATYFCASSQ
Mus spretus V4 trbv LVXV01006772.1 56235 HTGPKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSL
Mus spretus V5 trbv LVXV01006772.1 65902 PLETAVFQTPNYHVTQVGNEVSFNCKQTLGHDTMYWYKQDAKKLLKIMFSYNNKQLIVNETVPRRFSPQSSDKAHLNLRIKSVELEDSAVYLCASS
Mus spretus V6 trbv LVXV01006772.1 70055 LMNTKITQSPRYLIMGRANKSLECEQHLGHNAMYWYKQSAEKPPELMFLYSVKQLIRNETVPSRFIPECPDSSKLLLHVSAMDPEDSAVYFCASSQ
Mus spretus V7 trbv LVXV01006772.1 97736 GDGGITQTPRYWITQTSRKIILNCSQDMNHYRMFWYRQDAGQGLKLIHYSVGTDRTTKGDVPDGYSAFRNEIQSFPLTLESTSSNQTSMYFCASSEQ
Mus spretus V8 trbv LVXV01006772.1 119681 SANSGVVQSPRHIIKEKGGRSVLTCIPISGHSNVVWYQQTLGKELKFLIQHYEKEEREKGFLPSRFSVQQFDDYHSEMNMSALELEDSAVYFCASS
Mus spretus V9 trbv LVXV01006772.1 122080 HMEAAVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQKGDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSD
Mus spretus V10 trbv LVXV01006772.1 125002 SANSGVVQSPRHIIKEKGGRSILKCIPISGHLSVFWYQQTQGQELKFFIQHYDKMERDKGNLPSRFSVQQFDDYHSEMNMSALELEDSAVYFCASS
Mus spretus V11 trbv LVXV01006772.1 127458 HMEAAVTQSPRSKVTVTGGRVTLSCDQTNNHNNMYWYRQDMGHGLRLIHYSYGADSTEKGDIPDGYKASRPSQKEFSLILELATPSQTSMYFCASSD
Mus spretus V12 trbv LVXV01006772.1 138709 HMEAAVTQSPRNKVTVTGGKVTLSCHQTNNHDSMYWYRQDMGHGLRLIHYSYGADSIEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASSD
Mus spretus V13 trbv LVXV01006772.1 144385 LSEAGVTQSPRYAVLQEGQAVSFWCDPISGHDTLYWYQQPRDQGPQLLVYFQNEAVIDNSQLPADRFSAVRPKGTNSTLKIQSAKQGDTATYLCASSL
Mus spretus V14 trbv LVXV01006772.1 150152 HTDAGVTQTPRHEVAEKGQTIILKCEPVSGHNDLFWYRQTKIQGLELLSYFRSKSLMEDGGAFKDRFKAEMLNSSFSTLKIQPTEPQDSAVYLCASSL
Mus spretus V15 trbv LVXV01006772.1 161270 PTNAGVIQTPRHKVTGKGQETTLWCEPISGHSAVFWYRQTIVQGLEFLTYFYNQVPIDESGMPKERFSAQILNQSHSTLKIQSTQPQDSAVYLCASSL
Mus spretus V16 trbv LVXV01006772.1 176570 FVDTTVKQNPRYKLARVGKPVNLICSQTMNHDTMYWYQKKPNQAPKLLLYYYDENLNREADTPENFQSSRPNNSFCSLDIGSAGLEHSAMYLCASSR
Mus spretus V18 trbv LVXV01006772.1 214867 SMDSGVVQNPRHLVKGKEQKAKMDCTPINGHIYVYWYYKKPGEELKFLVYFQNEDIIDKTDMIGKNISAKCPAKKPCTIEIQSSKLIDSAVYFCASSQ
Mus spretus V19 trbv LVXV01006772.1 229416 SFDAAVTQTPRYLIKMKGQKAEMKCIPEKGHTAVFWYQQKQSKELKFLIYFQNQQPLDQIDMIKERFSAMCPSSSLCSLGIKTCKAEDSALYLCSSSQ
Mus spretus V20 trbv LVXV01006772.1 231449 SFVAGVTQTPRYLVKEKGQKAHMSCSPEKGHTAFYWYQQNQKQELTFLISFRNEEIMEQTDLVKKRFSAKCSSNSRCILEILSSEEDNSALYLCASSL
Mus spretus V21 trbv LVXV01006772.1 243848 ILNSKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSL
Mus spretus V22 trbv LVXV01006774.1 3802 LVNMKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLKLIYISFDVDSNSEGDIPKGYRVSRKKREHFSLILDSAETNQTSVYFCASSL
Mus spretus V23 trbv LVXV01006774.1 12926 SVFSVLLYQKPNRDICQSGTSLKIQCVADSQVVLMFWYQQFQGQSLMLMATANEGSEATYESGFTKDKFAISRPNLTFSTLTVNNAKPGDSSIYFCSSG
Mus spretus V24 igkv LVXV01006984.1 39208 TNGDVVMTQTPLSLSVTIGQPVSISCKSSQSLLYSDGKTYLNWLQQRPGQSPKLLMYQVSKLDPGIPDSFSGSGSETDFTLKISRVEAEDLGVYYCSQGTYI
Mus spretus V25 igkv LVXV01006984.1 86866 ARCEIQMTQSPSSMSASLGDRISITCQATQDIVKILNWYQQKPGKPPSFLIYYATELAEGVPSRFSGSGSGSDYSLTISNLESEDFADYYCLQFYEFP
Mus spretus V26 igkv LVXV01006991.1 20178 IRCDIKMTQSPSSMYASLGERVTITCKASQDIKSYLSWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDYSLTISSLESDDTATYYCLQHGESP
Mus spretus V27 igkv LVXV01006993.1 6595 ARCDVQMIQSPSSLSASMGDIVTMTCQASQGTSINLNWFQQKPGKAPKLLIYGASNLEDGVPSRFSGSRYGTDFTLTISSLEDEDMATYFCLQHSYLP
Mus spretus V28 igkv LVXV01007002.1 8202 ARCDIQMIQSPSSMFASLGDRVGLSCRASQGIRGNLDWYQQKPGGTIKLLIYSTSNLNSGVPSRFSGSGSGSDYSLTISSLESEDFADYYCLQRNAYP
Mus spretus V29 igkv LVXV01007002.1 65955 SSSDAVMTQTPLSLPVSLGDQASISCRSSQCLENSNGNTYLNWYLQKPGQSPQLLIYRVSNRFSGVLDRFSGSGSGTDFTLKISRVEAEDLGVYFCLQV
Mus spretus V30 igkv LVXV01007002.1 86019 SRAETTVTQSPASLSLAIGEKVTIRCITSTDIDDDMNWYQQKPGEPPKLLISEGNTLRPGVPSRFSSSGYGTDFVFTIENMLSEDVADYYCLQSDNMP
Mus spretus V31 igkv LVXV01007030.1 19 VSGDIVITQDELSNPVTSGESVSISCRSSKSLLYKDGKTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQLVEYP
Mus spretus V32 igkv LVXV01007040.1 48845 TRCDIRMTQTPASLSGSLGESVTITCQASQDIGKSLLWYQQKTDTPKILIYTASNLADGISSRFSGSGSGTQFFLKISSLKSEDTATYYCCQGYWLF
Mus spretus V33 igkv LVXV01007040.1 81656 AQCDVQITQSPSYLAASPGETITINCRASKSISKYLAWYQEKPGKTNKLLIYSGSTWQSGIPSRFSGSGSGTDFTLTISSLEPEDFAMYYCQQHNEYP
Mus spretus V34 igkv LVXV01007040.1 91739 VRCDIQVNQSPSSLSASLGDTITITCRASQDISIWLSWYQQKPGNIPKLLIYKASNLHTGVPSRFSGSGSGTDFTLTISSLQPEDIATYYCLQSQSYP
Mus spretus V35 igkv LVXV01007042.1 25576 MSCNIQVIQSPFLSASVGERVTISCKTHQHINSSIAWYQQKVRKAPKLLIRDASFSLIDTPSRFTGNGFGTDFTLSISSMQPQDGATYFCQQHFNY
Mus spretus V36 igkv LVXV01007044.1 45461 SSSDVVLTQTPLSLPVNIGDQASISCKSTKSLLNSDGFTYLDWYLQKPGQSPQLLIYLVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQSNYLP
Mus spretus V37 igkv LVXV01007044.1 88540 GKCDIQMTQSPASQSASLGESVTFTCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFASYYCQQLYSTP
Mus spretus V39 igkv LVXV01007051.1 199777 IMSRGQIVLTQSPATMSASPGEKVTMTCSASSSVSYMQWYQQKPGSSPKLWIYRTSNLASGVPARFSGSGSGTSYSFTISSMEAEDAASYYCQQWSSN
Mus spretus V40 igkv LVXV01007052.1 30292 ENVLTQSPALMSASLGEKVTMSCRASSSVSYMNWYQQKSGASPKLWIYSTSNLASEVPARFSGSGSGTSYSLTISSVVAEDAATYYCQQWSGY
Mus spretus V41 igkv LVXV01007052.1 84267 IMSRGENVLTQSPAIMAASLGQKVTMTCSASSSVNSSYLHWYQQKSGASPKPLIHRTSNLASGVPARFSGSGSGTSYSLTISSVEAEDDATYYCQQWSGYP
Mus spretus V42 igkv LVXV01007054.1 37004 KMSRGENVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGSPPKLWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDVATYYCFQGNGY
Mus spretus V43 igkv LVXV01007054.1 167949 IMSRGQIVLTQSPAIMSASLGEKVTITCSASSSVSYMHWFQQKSGTSPKLLIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAANYYCHQWSSY
Mus spretus V44 igkv LVXV01007054.1 173877 IMSRGQIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGSSPKPWIYDTSNLASGVPARFSGSGSGTSYSLSISNVEAEDAATYYCQQYSGYP
Mus spretus V45 igkv LVXV01007054.1 232579 ARCDIQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYAATNLADGVPSRFSGSGSGTQYSLKINSLQSEDFGSYYCQHHYYSTP
Mus spretus V46 igkv LVXV01007059.1 201907 VDGDIVMTQSQKFMSTSVGERVSISCKASQNVGNIIAWYQQKPGQSPKPLIYLASNRHTGVPDRFTGSGSGTDFTLTISSVQAEDLADYFCQQHY
Mus spretus V47 igkv LVXV01007063.1 197023 STGDIVLTQSPASLAVSLGQRATISCRASKSVSTSSYSYMHWYQQKPGQPPKLLIKYASNLESGVPARFSGSGSGTDFILNIHPVEEEDAATYYCQHSRELP
Mus spretus V48 igkv LVXV01007063.1 266501 STGDIVLTQSPASLAVSLGQRATISCRASESVDSYGNSFMHWYQQKPGQPPKLLIYLASNLESGVPARFSGSGSRTDFTLTINPVEADDVATYYCQQNNEDP
Mus spretus V49 igkv LVXV01010160.1 19060 SSSDVLLTQTPLFLPVSLGDQASISCSSSQSLVHSNGNSYLEWHLQKSGQSLQLLIYEVSKRHSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCFQG
Mus spretus V51 ighv LVXV01016623.1 69548 VHSEVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGIVHTNNGGTSYNQKFKGKATLTVDTSSSTAYMELNSLTSEDSAVYYCA
Mus spretus V53 trav LVXV01016961.1 22822 AAGQGVEQPANLMFVEGTFAQVNCTYSTSGFNGLSWYQQREGQAPVFLSYVVLDGLKDSGHFSTFLSRSNGYSYLLLTELQIKDSASYLCAVR
Mus spretus V54 trav LVXV01016963.1 70780 SWSLAKTTQPPSMEAYEGQEVNVSCSHTNIATSEYIDWYRQVPHQGPQFIIQGYKDYVVNEVASLFISADRKLSTLSLPWVSLRDAAVYYCIVT
Mus spretus V55 trav LVXV01016963.1 81573 VSRGEQVEQRPPHLSVREGDSAIIICTYTDSATAYFSWYKQEPGAGLQLLMSVFSNVDRKEEKGLTVLLNKKDKRLSLNLTASHPGDSAVYFCAAS
Mus spretus V56 trav LVXV01016963.1 116995 KSQGEQVEQLPSFQIVQEGASVLINCSYTDSASVYFPWYKQEPGKRLQFIIDIRSNMERKQTQRLTLLFDKKTKHLSLHITATQPGDSAIYFCSAS
Mus spretus V57 trav LVXV01016963.1 126594 RTHGDSVTQMQGQVTLSEDDFLFINCTYSTTWYPTLFWYVQYPGEGPQLLLKVTTANNKGISRGFEATYDKGTTSFHLQKASVQESDSAVYYCVLG
Mus spretus V58 trav LVXV01016963.1 143092 VNSQQKVQQSPESLIVPEGGMASLNCTFSDRNSQYFWWYRQHSGEGPKSLMSIFSNGDKKEGRFTAHLNKASLHVSLHIRDSQPSDSALYLCAVS
Mus spretus V59 trav LVXV01016963.1 150963 RTHGNSVTQMQGQVTLSEEEFLFINCTYSTTGYPTLFWYFQYPGEGPQLLLKVTTANNKGSSRGFEATYDKGTTSFHLQKASVQESDSAVYYCVLG
Mus spretus V60 trav LVXV01016963.1 164392 VNSQQKVQQSPESLIVPEGGMASLNCTSSDRNVDYFWWYRQHSGKSPKLLMSIFSNGEKEEGRFIVHLNKASLHTSLHIRDSHPSDSALYLCAA
Mus spretus V61 trav LVXV01016963.1 211871 RTHGDSVTQMQGQVTLSENDFLFINCTYSTTGYPTLFWYVQYSGEGPQLLLQVTTANNKGSSRGFEATYDKGTTSFHLQKTSVQESDSAVYYCAMR
Mus spretus V62 trav LVXV01016963.1 232383 VNSQQKVQQSPESLIVPEGAMTSLNCTFSDSASQYFAWYRQHSGKAPKTLMSIFSNGEKEEGRIKILLNKASLHFSLHIRDSQPSDSALYLCAV
Mus spretus V63 trav LVXV01016963.1 238780 IRKTHGDSVTQKQGQVTLSEDDFLFINCTYSTTTYPTLFWYVQYPGQGPQLLLKVTTANNKGIIRGFEATYDKGTTSFHLQKASVQESDSAVYFCALV
Mus spretus V64 trav LVXV01017122.1 7473 VRSQQKVQQSPESLSVPEGGMASLNCTSSDRNFQYFWWYRQHSGEGPKALMSIFSDGDKKEGRFTAHLNKASLHVSLHIRDSQPSDSALYFCAAS
Mus spretus V65 trav LVXV01017122.1 23600 VNSQLAEENPWALSIHEGESVTVNCSYKTSITALQWYRQNSGEGPAQLILIRTNEREKRNGRLRVTLDTSSQSSSLSITAAQCEDTAVYFCATD
Mus spretus V66 trav LVXV01017122.1 28772 AQTQTVSQSDAHVTVFEGDSVELRCNYSYGGTIYLSWYIQHHGRGLQFLLKYYSGNPVVRGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAV
Mus spretus V67 trav LVXV01017122.1 31591 ESNGDSVTQTEGPVTLSEGTSLTVNCSYETKQYPTLFWYVQYPGEGPQLLFKVPKANEKGSNRGFEATYDKETTSFHLQKASVQESDSAVYYCALS
Mus spretus V68 trav LVXV01017122.1 57779 RTHGDSVTQTEGQVTVSESKSLIINCTYSATSIGYPNLFWYVRYPGEGLQLLLKVITAGQKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALS
Mus spretus V69 trav LVXV01017122.1 60311 VAGKTQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVHEKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVG
Mus spretus V70 trav LVXV01017122.1 61227 VAGKTQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVHEKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVG
Mus spretus V73 trav LVXV01017132.1 52873 DAQAQSVTQPDARVTVSEGASLQLRCKYSYSGTPYLFWYVQYPQQGLQLLLKYYPGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDLAVYFCAV
Mus spretus V74 trav LVXV01017132.1 53709 DAQAQSVTQPDARVTVSEGASLQLRCKYSYSGTPYLFWYVQYPQQGLQLLLKYYPGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDLAVYFCAV
Mus spretus V75 trav LVXV01017132.1 65618 WSNGDGDSVTQTEGLVTLTEGLPVKLNCTYQTIYSNPFLFWYVHYLNESPRLLLNSFTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALS
Mus spretus V76 trav LVXV01017132.1 67083 RSHGDGDSVTQIEGLVTLTEGLPVKLNCTYQTIYSNPFLFWYVHYLNESPRLLLKSSTDNKRTEHQGFYATLHKSSSSFHLQKSSAQLSDSALYFCALS
Mus spretus V77 trav LVXV01017132.1 84541 WSNGDGDSVTQTEGLVTLTEGLPVKLNCTYQTIYSNPFLFWYVHYLNESPRLLLNSFTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALS
Mus spretus V78 trav LVXV01017133.1 55446 VSRGEQVEQRPPHLSVQEGDSAVITCTYTDPNSYYFFWYKQEPGASLQLLMKVFSSTEINEGQGFTVLLNKKDKQLSLNLTAAHPGDSAVYFCAVS
Mus spretus V79 trav LVXV01017133.1 70570 GVRGDQVEQSPSALSLHEGTSSALRCNFTTTMRSVQWFRQNSRGSLINLFYLASGTKENGRLKSAFDSKELYSTLHIRDAQLEDSGTYFCAAE
Mus spretus V80 trav LVXV01017133.1 96394 MAQGDSVTQTEGQVALSEEDFLTIHCNYSASGYPPLFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYDKGTTSFHLRKASVQESDSAVYYCALS
Mus spretus V81 trav LVXV01017133.1 101410 MSQGEQVEQLPSILRVQEGSSASINCTYENSASNYFPWYKQAPGENPKLIIDIRSNMERKQTQGLIVLLDKNAKRFSLHITDTQPGDSAMYFCAAS
Mus spretus V82 trav LVXV01017133.1 108358 VSSQEKVQQSPESLIVPEGAMAFLNCTFSDSASQSIWWYQQHPGKSPKALISIFSNGNKKEGRLTVYLNRASLHVSLHIKDSQPSDSAVYLCAV
Mus spretus V83 trav LVXV01017133.1 132029 AKSQWGEENLQALSIQEGEDVTVNCSYKTYTAAVHWYRQDSGKGPALIILIRSDEREKRTGRLRATLDTSSQSSSLSITAAQCEDTAVYFCATD
Mus spretus V84 trav LVXV01017141.1 30592 RSNGDSVTQTEGLITLTEGLPVKLNCTYQTTYSTIAFFWYVQYLNEAPRLLLRSSTDNKRTEHQGFHATLHKSSSSFHLQTSSAQLSDSALYFCALT
Mus spretus V85 trdv LVXV01017182.1 383332 KDVLCITLTQSSTDQTVASGTEVTLLCTYDADSPNPDLFWYRKRPDRSFQFILYRDDTSSHDADFVQGRFSVKHSKANRTFHLVISPVSLEDSATYYCASG
Mus spretus V88 ighv LVXV01021272.1 32697 VNSEVQLQQSGAELVRPGASVKLSCTASGFNIKDEYMHWVKQRPEQGLEWIGRIDPEDGDTEYAPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCT
Mus spretus V89 ighv LVXV01021272.1 57213 IQCEVKLVESGGGLVQPGGSLRLSCAASGFTFSDFYMEWVRQAPGKGLEWIGASRNKANDYTAEYSASVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARD
Mus spretus V90 ighv LVXV01021272.1 79064 INSEVQLQQSGAELVKPGASVKLSCTASGFNIKDTYINWVKQRPEQGLEWIGRIDPENGNTKYNPKFQGKATITADTSSNTAYMQLSSLTSEDTAIYYCA
Mus spretus V91 ighv LVXV01021272.1 89486 INSEVQLQQSGAELVKPGASVKLSCTASGFNIKDTYINWVKQRPEQGLEWIGRIDPENGNTKYNPKFQGKATITADTSSNTAYMQLSSLTSEDTAIYYCA
Mus spretus V92 ighv LVXV01021337.1 4497 ILSDVQLQESGPGLVKPSQTVSLTCTVTGYSITNGNHWWNWIRQVSGNKLEWMGYISSSGSTDSNPSLKSQISITRDTSKNQLFLQLNSVTIEDIATYYCAR
Mus spretus V93 ighv LVXV01021337.1 16663 IQCEVKLMESGGGLVQPGASLRLSCEASGFTFTDYYMSWVRQPPGKSPEWLALIRNKANGYTTEYSASVKGRFTISRDNSQNILYLQMNTLRAEASATYYCAKD
Mus spretus V94 ighv LVXV01021337.1 69623 VNSEVQLQQSGAELVRPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGWIDPENGDTEYASKFQGKATITADTSSNTAYLQLSSLTSEDTAIYYCS
Mus spretus V95 ighv LVXV01021337.1 92791 VLSQIQLKESGPAVIKPSQSLSLTCTVSGFSITSSGFCWHWIRQAPGKGLEWMGSICYEGSVYYSPSFKSRSTISRDTSLNKFFIQVSSVTDEDTAMYYCSRE
Mus spretus V97 ighv LVXV01021337.1 134357 VLSQIQLKESGPAVIKPSQSLSLTCTVSGFSITSSSYCWHWIRQPPGKGLEWMGRICYEGSIYYSPSIKSRSTISRDTSLNKFFIQLSSVTNEDTAMYYCSRE
Mus spretus V98 ighv LVXV01021339.1 9507 ILSDVQLQESGPGLVKPSQTVSLTCTVTGISITTGNYRWSWIRQFPGNKLEWIGYIYYSGTITYNPSLTSRTTITRDTSKNQFFLEMNSLTAEDTATYYCAR
Mus spretus V99 ighv LVXV01021341.1 640 IQAQIQLVQSGPELKKPGETVRISCKASGYTFTTAGMQWVQKMPGKGLKWIGWINTHSGVPKYAEDFKGRFAFSLETSASTAYLQISNLKNEDTATYFCA
Mus spretus V100 ighv LVXV01021341.1 14031 ILSDVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYWNWIRQFPGNKLEWMGYISYDGSNNYNPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYYCAR
Mus spretus V101 ighv LVXV01021343.1 865 VHSQAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSYNQKFKGKVTLTADKSSSTAYMQISSLTSEDSAVYFCA
Mus spretus V102 ighv LVXV01021343.1 4487 AYSQIQLQQSGAELASPGASVTLSCKASGYTFTDHIMNWVKKRPGQGLEWIGRIYPVSGETNYNQKFMGKATFSVDRSSSTVYMVLNSLTSEDPAVYYCG
Mus spretus V103 ighv LVXV01021343.1 29710 VHSQVQLQQSGAELMKPGSSVKLSCKATGYTFTDYWIEWVKQRPGHGLEWIGEILPGSVSTNYNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCA
Mus spretus V104 ighv LVXV01021343.1 49483 GIQSQVHLQQSGSELRSPGSSVKLSCKDFDSEVFPIAYMSWVRKKPGHGFEWIGSILPSIGRTIYGEKFEDKATLDADTMSNTAYLELNSLTSEDSAIYYCA
Mus spretus V106 ighv LVXV01021343.1 81865 VHSQVQLQQSGAELAKPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGYINPSSGYTKYNQKFKDKATLTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus spretus V107 ighv LVXV01021343.1 88095 VHCEVQLVESGGRLVQPKGSLKLSCAASGFTFNTYAMYWIRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVR
Mus spretus V108 ighv LVXV01021343.1 114314 VHSQVQLQQSGAELAKPGTSVKMSCKASGYTFTSYWMNWVKQRPGQGLEWIGAINPSNGYTEYNQKFKDKAILTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus spretus V109 ighv LVXV01021343.1 121470 VHCEVQLVESGGGLVQPKGTLKLSCAASGFSFNTYAMNWVRQAPGKSLEWVARTMSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVR
Mus spretus V110 ighv LVXV01021343.1 131475 VYSQVQLQQSGAELARPGASVKMSCKASGYTFTSYWMQWVKQRPGQGLEWIGAIYPGDGDTRYTQKFKGRATLTADKSSSTAYMQLSSLTSEDSAVYYCA
Mus spretus V111 ighv LVXV01021343.1 139814 VLSQVTLKESGPGILQPSQTLSLACTFSGISLSTSGMGLSWLRKPSGKALEWLASIWNNDNYYNPSLKSRLTISKETSNNQVFLKLTSVDTADSATYYCAWR
Mus spretus V112 ighv LVXV01021343.1 147740 VQCEVKLDESGGGLVQPGRSMKLSCVASGFTFTNSWMNWFRQSPEKGLEWVAQIRSKPYNYETYYSDSVKGRFTISRDDYKSSVYLQMNNLRADDTGIYYCT
Mus spretus V113 ighv LVXV01021343.1 165531 VQSEVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMDWVRQSPEKGLEWVAEFRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCT
Mus spretus V114 ighv LVXV01021343.1 186440 VQSEVKLEESGGGLVQPGGSMKLSCAASGFTFSDYRMDWVHHSPENGLEWVAEIRNKASNYATYYAESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCT
Mus spretus V115 ighv LVXV01021343.1 218787 VQSEVKLEESGGGLVQPGGSMKLSCAASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCT
Mus spretus V116 ighv LVXV01021343.1 242051 SLSQMQLQESGPGLVKPSQSLFLTCSITGFPITSGYYWIWIRQSPGKPLEWMGYITHSGETFYNPSLQSPISITRETSKNQFFLQLNSVTTEDTATYYCAGD
Mus spretus V117 ighv LVXV01021343.1 282203 ILSEVQLQESGPGLVKPSQSLSLTCSVTGYSITSDYWNWIRKFPGNKLEYMGYISYSGSTYYNPSLKSRISITRDTSKNQYYLQLNSVTSEDTATYYCAR
Mus spretus V118 ighv LVXV01021345.1 14279 VHSEVQLQQSGPELVKPGASVKISCKASDYSFTGYIMNWVKQSHGKSLEWIGEINPYNGGTSYNQKFKGKATLTVDTSSSTAYMELHSLTSEDSLVYYCA
Mus spretus V119 ighv LVXV01021345.1 33826 VQSQVQLQQSGAELVRPGASVTLSCKASGYTFTDYEMHWVKQTPVHGLEWIGAIDPETGGTAYNQKFKGKATLTADKSSSTAYMELRSLTSEDSAVYYCT
Mus spretus V120 ighv LVXV01021345.1 79548 VHSQVQLQQSGPELVKPGASVKMSCKASGYTFTDYVMHWVKQRPGQGLEWIGYFFPYNDDTKYNEKFKGKATLTADKSSSTAYMELSSLTSEDSAVYYCA
Mus spretus V121 ighv LVXV01021346.1 3976 VHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGEIDPSDSYTYYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus spretus V122 ighv LVXV01021346.1 61042 VHSEVKLQQSGPELVKPGASVKISCKASGYSFTGYYMHWVKQSSEKSLEWIGEINPSTGGTSYNQKFKGKATLTVDKSSSTAYMQLKSLTSEDSAVYYCA
Mus spretus V123 ighv LVXV01021346.1 70912 VHSEVQLQQSGPELVKPGASVKISCKASGYSFTGYYMNWVKQSPEKILEWIGEINPSTGGTTYNQKFKAKATLTVDKSSSTAYMQLKSLTSEDSAVYYCA
Mus spretus V124 ighv LVXV01021347.1 178991 VHSQVQLQQSGAELVKPGASVKLSCKASDYTFTSYDINWVKQRPGQGLEWIGWIYPGNGNTKYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus spretus V125 ighv LVXV01024305.1 2999 VLSQVTLKESGPGMLQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLADIWWDDNKYYNPSLKSQLTIAKDTSSNQVFLKITSVDTADTATYYCARR
Mus spretus V126 ighv LVXV01024305.1 4306 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIHQPSGKGLEWLADIWWDDDKYYNPSLKSRLTISKDTSKNQVFLKIAIVDTADTATYYCA
Mus spretus V127 igkv LVXV01024786.1 2124 TNGDVLMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLYWLLQRPGESPKRLIYLVSKLDPGIPDRFSGSGSGTDFTLKISRVEAEDLGVYYCWQA
Mus spretus V128 igkv LVXV01025366.1 1271 SRGDIVLTQSPATLSVTPGDRVSVSCRASQSISNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSW
Mus spretus V129 ighv LVXV01026127.1 1292 VHSQVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMHWIKQRPGQGLEWIGTIHPYDSETHYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus spretus V130 ighv LVXV01026319.1 1983 VHSHVQLQQSGPELVRPGASVKLSCKASGYIFITYWMNWVKQRPGQGLEWIGQIFPASGSTNYNEMFEGKATLTVDTSSSTAYMQLSSLTSEDSAVYYCA
Mus spretus V131 ighv LVXV01026538.1 40845 VHSQVQLQQSGAELVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVINPGSGGTNYNEKFKGKATLTADKSSSTAYMQLSSLTSDDSAVYFCA
Mus spretus V132 ighv LVXV01026538.1 47566 VHSQVQLQQPGAELVKPGASVKMSCKASGYTFTSYWINWVKQRPGQGLEWIGDIYPGRGITNYNEKFKSKATLTLDTSSSTAYMQLSSLTSEDSAVYYCS
Mus spretus V133 ighv LVXV01026538.1 61130 VHSQDQLQQSGAELVRPGTSVKMSCKAAGYTFTNYWIGWVKQRPGHGLEWIGDIYPGGGYTNYNEKFKGKATLTADTSSSTAYMQLSSLTSEDSAMYYCA
Mus spretus V134 ighv LVXV01026746.1 14203 VFSEVQLQQSGPELVKPGASVKISCKASGYSFTGYFMNWVKQSHGKSLEWIGRINPYNGDTFYNQKFKGKATLTVDKSSSTAHMELLSLTSEDSAVYYCA
Mus spretus V135 ighv LVXV01027043.1 150 VHCQVQLQQSGAELVKPGASVKISCKASGYTFTDYYINWVKQRPGQGLEWIGKIGPGSGSTYYNEKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCA
Mus spretus V136 ighv LVXV01027581.1 15749 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWNDNKYYNTALKSRLTISKDTSNNQVFLKIASVDTADTATYYCARI
Mus spretus V137 ighv LVXV01027781.1 7002 VYCQVQLQQSGNDLVKPGASVKLSCKASGYTFTSYWINWTKQRPGQGLEWIGRIAPGSGSTYYNEMFKGKATLTVDTSSSTAYIQLSSLSSEDSAVYFCA
Mus spretus V138 ighv LVXV01027834.1 272 VHSQVQLQQPGAELVRPGASVKLSCKASGYTFTSYWMNWVKQRPGQGLEWIGMIDPSDSETHYNQMFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus spretus V139 igkv LVXV01027878.1 1085 TNGDVVMTQTPLSLSVTTGQPASISCKSSQSLLHSNGKTYLNWLLQRPGQSPKRLLYLVSKLDPGIPDSFSGSGSETDFTLKISRVEAEDLGVYYCLQA
Mus spretus V140 ighv LVXV01028521.1 25804 VHSEVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGYINPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCA
Mus spretus V141 ighv LVXV01028769.1 7567 VHSQVQLQQSDAELVKPGASVKISCKASGYTFTDHAIHWVKQKPEQGLEWIGYISPGNGDIKYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCK
Mus spretus V142 igkv LVXV01028918.1 177 ILSSGEIVLTQSPALMAASPGEKVTITCSVSSSISSSYLHWYQQKSGISPKPWIYGTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSS
Mus spretus V143 iglv LVXV01006040.1 1866 ASSQAVVTQESALTTSPGGTVILTCRLSTGAVTTNNYANWVQEKPDHLFTGLIGSTSNRAPGVPARFSGSLIGDKAALTITGAQTEDDAMYFCALWYSNH
Mus spretus V144 igkv LVXV01006788.1 19560 ATGDIVMTQAAPSVPANPGESVSISCRSSKSLLHNSGNTYLHWFLQRPGQSPQLLIYRMSNLASRVPDRFSGSGSGTDFTLRISRVEAEDVGVYYCMQGLEYP
Mus spretus V145 igkv LVXV01006966.1 21539 AIGDIVMTQAAPSVPVTTGESVSISCKSSKSLLHSNGITYLYWFLQRSGQSPQLLIYYMSNLASGVPDRFSGSGSGTDFTLRISRVEAEDVGVYYCMQYLEYP
Mus spretus V146 igkv LVXV01006966.1 4173 AIGDIVMTQAAPSVPVTPGESVSISCKSSKSLLHSNGITYLYWYLQRSGQSPQLLIYRISNLASGVPDRFSGSGSGTDFTLRISRVEAEDVGVYYCMQGLEYP
Mus spretus V147 igkv LVXV01006981.1 2411 SRVETTVTQSPASLSLATGEKVTIRCIASTDIDDDMNWYQQKSGEPPKLLISEGNTLHPGVPSRFSSSGYGTDFLFTIENMLSEDVADYYCLQSDNLP
Mus spretus V148 igkv LVXV01006984.1 192298 TNGDVMMTQTPLTLSVTIGQPASISCKSSQSLLDSNGNTYLHWLLQRPGQSPKILIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCLQG
Mus spretus V149 igkv LVXV01006984.1 161495 TTSDVVMTQTPLSLSVTIGKPASISCKSSQSLLYSDGKTYLNWLQQRPGQSPKLLMNQVSELDPAIPDRFSGRRSGTDFTLKISRVEAEDLGVYYCSQG
Mus spretus V150 igkv LVXV01006984.1 116857 ARCDIQMTQSPASISASLGERVSLNCRASQEISGYLNWLQQKPDGTIKRLIYATSNLDSGVPKRFSGSRSGSDYSLTISSLESEDFADYYCLQYASSP
Mus spretus V151 igkv LVXV01006986.1 2411 SRVETTVTQSPASLSLATGEKVTIRCIASTDIDDDMNWYQQKSGEPPKLLISEGNTLHPGVPSRFSSSGYGTDFLFTIENMLSEDVADYYCLQSDNLP
Mus spretus V152 igkv LVXV01007021.1 19413 IKCDIKMTQSPSSMYASLGERVTVTCKASQDINSYLSWYQQKPGKSPKTLIYLANRLVDGVPSRFSGSGSGQDYSLTISSLEYDDMGIYYCLQYDEFP
Mus spretus V153 igkv LVXV01007021.1 2703 SSSDVVMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQG
Mus spretus V154 igkv LVXV01007028.1 1923 STADIVMTQAVFSNPVTLGTSASISCRSSKSLLHSNGITYLYWYLQRPGQSPQLLVYRVSNLASGVPDRFSGSGSGTDFSLRISRVEAEDVGVYYCAPMLELP
Mus spretus V155 igkv LVXV01007044.1 257709 ILTNGEILLTQSPAIMAASPGEKVTVTCSASSGVSYMNWYQQKPGSSPKIWIYGISNLASGVPARFSGSGSGTSFSFTISSMEAEDAATYYCQQRSSY
Mus spretus V156 igkv LVXV01007044.1 222384 SNGEIVLTQSPTTMAASPGEKITITCSASSSISSNYLHWYQQKPGFPPKLLIYRTSNLASGVPARFSGSGSGTSYSLTIGTMEAEDVATYYCQQGSSI
Mus spretus V157 igkv LVXV01007044.1 209361 SKGEIVLTQSPGSITVSRGEKVTITCRASSSISSNYLHWYQQKPGSFPKLLIYRTSILASGVLDSFSGSGSESSYTLTISCMQDEVAAIYYCQQGSSS
Mus spretus V158 igkv LVXV01007044.1 190735 AQCDIQMTQSPSSLSASLGGKVTITCKASQDINKNIAWYQHKPGKGPRLLIRYTSILESGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDNL
Mus spretus V159 igkv LVXV01007044.1 159168 TRCDIQMTQTTSSLSASLGDRVTISCRASEDISNYLNWYQQKPDGTVKLLIYYASSLHSGVPSRFSGSGSGTDYSLTISNLEPEDIATYYCQQYSKLP
Mus spretus V160 igkv LVXV01007044.1 101794 TRCDIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGSTLP
Mus spretus V161 igkv LVXV01007046.1 38120 VLCDIQMTQSSSFLSASLGDHLTLNCRASKDINKYFAWVQQKPGKAPRMLIHFASTLLPGVPEKFSGSGSGTDFSLTIRNIESEDIAMYYCLQYSEHP
Mus spretus V162 igkv LVXV01007046.1 582 IVVRCDIQMTQSPASLSASVGETVTITCGASENIYGALNWYQRKQGKSPQLLIYGATNLADGMSSRFSGSGSGRQYSLKISSLHPDDVATYYCQNALSTP
Mus spretus V163 igkv LVXV01007048.1 13837 SRGEIVLTQSPAIIAASLGQKVTMTCSASSSVSYMHWYQQKSGSSPKLWIYGTSNLASGVPAHFSGSGSGTSYSLTISSVEAEDDATYYCQQWNY
Mus spretus V164 igkv LVXV01007051.1 160615 ILSRGQIVLTQPPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPKPWIYDTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQYSGYP
Mus spretus V165 igkv LVXV01007051.1 131950 IMSRGQIVLTQSPAIMSASLGEEITLTCSSSSSVSYMHWFQQKSGTSPKLLIYSTSNLASGVPARFSGSGSGTSYFLTISSVEAEDAANYYCHQWSSY
Mus spretus V166 igkv LVXV01007051.1 77910 IMSRGQIVLTQSPAIMSASPGERVTMTCSASSSVSSSYLHWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTINSMEAEDAATYYCQQWSSN
Mus spretus V167 igkv LVXV01007051.1 55918 IMSRGENVLTQSPAIMAASPGEKVTMTCSASSSVSSDNFHWYQQKSGTSPKLWIYRTSKLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQWSGY
Mus spretus V168 igkv LVXV01007051.1 5590 IICDIQMTQSSSSLSVSLGDRVTITCKASDHINNWLAWYQQKPGNAPRLLISGATSLETGVPSRFSGSGSGNDYTLSITSLQTEDVATYYCQQYWSTP
Mus spretus V169 igkv LVXV01007052.1 8280 SRGDILLTQSPAILSVTPGERVSFSCRASQSIGKSIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDVADYYCQQSNSWP
Mus spretus V170 igkv LVXV01007054.1 215078 VMSRGEIVLTQSPALMAASPGEKVTMTCSASSSVGSSYLHWYQQKSGASPKLWIYGTSNLASGVPARFSGSGSGTSYSLTISNVEAEDDATYYCQQGWDY
Mus spretus V171 igkv LVXV01007054.1 183366 AMSRGENVLTQSPAIMSASPGEKVTMTCRASSSVSSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQYSGY
Mus spretus V172 igkv LVXV01007055.1 86943 SRCDIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQN
Mus spretus V173 igkv LVXV01007055.1 61130 ARCDIQMTQSPASLSASVGETVTITCQASENIASDLAWYQQKQGKSPQLLVYDARNLADGVPSRFSGSGSGTHYSLNIHSLQSEDVARYYCQHYYGTP
Mus spretus V174 igkv LVXV01007055.1 32073 ARCDIQMTQSPASLSASVGETVTITCRASGNIYSNLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHYYGTP
Mus spretus V175 igkv LVXV01007057.1 45296 SAVTGETTQSPASLSFSLGETATLTCRSSESVGSYLAWYQQKAEQVPRLLIHSASTRAGGVPVRFSGTGSGTDFTLTISSLEPEDAAVYYCQPFKSWS
Mus spretus V176 igkv LVXV01007057.1 14519 STGDILLTQSPATLSVTPGETVSLSCRASQSIYKNLHWYQQKSHRSPRLLIKYASDSISGIPSRFTGSGSGTDYTLSINSVKPEDEGIYYCLQGY
Mus spretus V177 igkv LVXV01007057.1 672 AGCDIQMTQSPASLAASVGESVTITCRASENIYYSLAWYQQKQGKSPQLLIYNANSLEDGVPSRFSGSGSGTQYSMKINSMQPEDTATYFCKQAYDVP
Mus spretus V178 igkv LVXV01007059.1 141805 TCGDIVMTQSPSFLTVSAGEKVTMSCKSSQSLLNSGNQKNYLTWFQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDY
Mus spretus V179 igkv LVXV01007059.1 136789 ADGNIVMTQSPKSMSMSVGERVTLSCKASENVGTYVSWYQQKPEQSPKLLIYGASNRYPGVPDRFTGSGSATDFTLTISSLQAEDLADYHCGQGYSYL
Mus spretus V180 igkv LVXV01007059.1 107211 TCGDIVMSQSPSSLAVSAGEKVTMSCKSSQSLLYSSNQKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAIYYCQQYYSDR
Mus spretus V181 igkv LVXV01007059.1 74691 AHGSIVMTQSPKSLPVSAGDRVTMTCKASQSVSNDVAWYQQKPGQSPKLLIYYASNRYTGVPERFTGSGSGTDFTFTISGVQAEDLAVYFCQQHYTTP
Mus spretus V182 igkv LVXV01007059.1 57294 ACADIVMTQSPTFLAVTASKKVTISCTASESLYSHKVNYLAWYQKKPEQSHKLLIYGASIRFTGVPDRFTGSGSGTDFTLTISSVQTEDLTHYYCAQFYSYP
Mus spretus V183 igkv LVXV01007059.1 49193 TCGDILMTQSPSSLTVSAGKKVTMRCKSSQSLLASGNQKNYLAWHQQKPGRSPKMLIIWASTRVSGVPDRFIGSGSGKDFTLTINSVQAEDLAVYYCQQSY
Mus spretus V184 igkv LVXV01007059.1 22064 ISGDVVMTQTPLTLSATIGQSASISCRSSQSLLHSNGNTYLNWFVQRPGQSPELLIYGVFEWESGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCMQATYEP
Mus spretus V185 igkv LVXV01007063.1 87594 VDGDIVMTQSQKFMSTTVGDRVSITCKASQNVGTAVAWYQQKPGQSPKALIYWASTRYTGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFCQQYSSSP
Mus spretus V186 igkv LVXV01007063.1 72062 VDGDIVMTQSQKFMSTSVGDRVSVTCKASQNVGTAVAWYQKKPGQSPKALIYSASTRYTGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFCQQYSSSP
Mus spretus V187 igkv LVXV01007063.1 35197 VDGDIVMTQSQKFMSTSVGDRVSVTCKASQNVGTYVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLAVYYCQQYYSYP
Mus spretus V188 igkv LVXV01007063.1 15603 ACGEIVLTQSIPSLTVSAGERVTISCKSNQNLLWSGNQRYCLVWHQWKPGQTPTPSITWTSDRYSGVPDRFIGSGSVTDFTLTISSVQAEDVAVYFCQQH
Mus spretus V190 ighv LVXV01014267.1 2894261 VLSQVQMKESGPDLVQPSQTLSLTCTVSGFSLSSYGVHWFRKPPRKGLEWLGGIWSGGSIYYNPVLSSRLSVSRDISKSQVFFKMSSLQSEDTAVYHCAR
Mus spretus V192 trav LVXV01016976.1 944 VSSQQKVQQSPESLTVSEGAMASLNCTFSDGTSNNFRWYRQHSAKGLEVLVSIFSDGEKEEGRFTAHLNRANLHVSLHIREPQPSDSAVYLCAV
Mus spretus V193 trav LVXV01017026.1 364 AKSQWGEENLQALGIQEGEDVTMNCSYKTYITVVQWYRQKSGEGPAQLILIRSNEREKHSGRLRATLDTSSQSSSLSITAAQCEDTAVYFCATD
Mus spretus V194 trav LVXV01017030.1 403 TSMAQKVTQTQTSISVMEKTTVTMDCVYETGDSSYFLFWYKQTASGEIVFLIRQDSYKKENATEGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRE
Mus spretus V195 trav LVXV01017050.1 944 VSSQQKVQQSPESLTVSEGAMASLNCTFSDGTSNNFRWYRQHSAKGLEVLVSIFSDGEKEEGRFTAHLNRANLHVSLHIREPQPSDSAVYLCAV
Mus spretus V196 trav LVXV01017104.1 403 TSMAQKVTQTQTSISVMEKTTVTMDCVYETGDSSYFLFWYKQTASGEIVFLIRQDSYKKENATEGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRE
Mus spretus V197 trav LVXV01017126.1 944 VSSQQKVQQSPESLTVSEGAMASLNCTFSDGTSNNFRWYRQHSAKGLEVLVSIFSDGEKEEGRFTAHLNRANLHVSLHIREPQPSDSAVYLCAV
Mus spretus V198 trav LVXV01017133.1 24863 GVRGDRVEQSPSALSLHKGTSSALRCNFTTTTRSVQWFQQISRGSLINLFYLASGTKENGRLKSAFDSKERYSTLHIRDAQLEDSGTYFCAAE
Mus spretus V199 trdv LVXV01017133.1 20752 CNVAQRVTQVQSTGSSQWGEVTLHCSYETSKYFYHILWYRQLFSGEMVFLIYQPSFDTQNQRNGRYSVVFQKSFKSISLVISASQPEDSGKYFCALSEL
Mus spretus V200 trav LVXV01017141.1 81334 VKGQQVQQSPASLVLQEGENAELHCNFSTSLNSMQWFYQRPGGSLVNLFYNPSGTKQSGRLTSTTVIKERRSSLHISSSQITDSGTYLCAMEPQC
Mus spretus V201 trdv LVXV01017141.1 70656 SNVAQKVIQVWPTASRQEGEELTLDCSYETSQVLYHLFWYKHLLNGEMVFLIRQTSSSTAKERSGRYSVVFQKSLKSISLVISALQPDDSGKYFCALWEL
Mus spretus V202 trav LVXV01017141.1 41670 NAQAQSVTQPDARITVSEGASLQLRCKYSSSVTPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFYLRKASVHWSDSAVYFCALS
Mus spretus V203 trav LVXV01017141.1 35217 RSNGDSVTQTEGLVTLTEGLPVMLNCTYQTAYSDVAFFWYVQYLNEAPKLLLRSSTDNKRTEHQGFHATLHKSSSSFHLQTSSVQLSDSALYYCALS
Mus spretus V204 trav LVXV01017175.1 403 TSMAQKVTQTQTSISVMEKTTVTMDCVYETGDSSYFLFWYKQTASGEIVFLIRQDSYKKENATEGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRE
Mus spretus V205 trav LVXV01017182.1 782587 VSRGEQVEQRPPHLSVREGDSAVITCTYTDSATAYFYWYKQEAGAGLQLLMSVLSNVDRKEEQGLTVLLNKKDKRLSLNLTAAHPGDSAVYFCAVS
Mus spretus V206 trav LVXV01017182.1 741470 GNSAQSVDQPDAHVTLSEGASLELRCSYSYSAAPYLFWYVQYPGQSLQFLLKYITGDAVVKGTKGFEAEFRKSNSSFNLKKSPAHWSDSAKYFCALN
Mus spretus V207 trav LVXV01017182.1 712606 VATQQLEQSPQFLSIQEGQDFTAHCSSSTTFPQFYWYRQVPREGPVILVTLVKSGEVKEQKRVTAKFGEARKNSSLFITRAQPGDAGTYFCAG
Mus spretus V208 trav LVXV01017182.1 668457 VSGQANTVVQSPSILNVGEKETALINCSYTNAATNYFPWYKKEEQKVFTLLIDIRSNVNRKKEGRFEVILDRNVKLVSLHITAARTEDSALYLCAP
Mus spretus V209 trav LVXV01017182.1 655191 IAGDAKTTQPDSMESTEGETVHLPCSHATISGNEYIYWYRQVPLQGPEYVTHGLQQNTTNSMAFLAIASDRKSSTLILPHVSLRDAAVYHCILRV
Mus spretus V212 trdv LVXV01017182.1 594752 ASMAQTVSQHQQEKSVQVAESATLDCTYDTSDTNYLLFWYKQQGGQVTLVIRQEAYKQYNATENRFSVNFQKAAKSFSLEISDSQLGDAATYFCALRG
Mus spretus V213 trdv LVXV01017182.1 583943 ASMAQTVSQPQKKKSVQVAESATLDCTYDTSDTNYLLFWYKQQGGQVTLVILQEAYKQYNATLNRFSVNFQKAAKSFSLEISDSQLGDAATYFCALME
Mus spretus V214 trdv LVXV01017182.1 456476 TSLDVYLEPVAKTFTVVAGDPASFYCTVTGGDMKNYHMSWYKKNGNNALFLVYKLNSNSTDGVKGNFNGKINISKNQFILDIQKATMKDAGTYYCGSD
Mus spretus V215 trgv LVXV01018259.1 1627297 RQTSSNLEERIMSITKLEGFSAIMTCDTHRTGTYIHWYRFQKGRAPEHLLYYNFVSSTTVVDSRFNLEKYHVYEGPDKRYKFVLRNVEKSDSALYYCASWA
Mus spretus V216 trgv LVXV01018259.1 1619878 GHGKLEQPEISISRARDETAQISCKVFIESFRSVTIHWYRQKPNQGLEFLLYVLATPTHIFLDKEYKKMEASKNSSASTSTLTIYSLEEEDEAIYYCSYG
Mus spretus V217 trgv LVXV01018259.1 1614485 SEGSSLTSPLGSYVIKRKGNTAFLKCQIKTSVQKPDAYIHWYQEKPGQRLQRMLCSSSKENIVYEKDFSDERYEARTWQSDLSSVLTIHQVTEEDTGTYYCACWD
Mus spretus V218 trgv LVXV01018259.1 1612664 GDSWISQDQLSFTRRPNKTVHISCKLSGVHLPNTIVHWYQLKEGEPLRRIFYGSVKTYKQDKSHSRLEIDEKDDGTFYLIINNVVTSDEATYYCACWD
Mus spretus V219 ighv LVXV01021261.1 1509 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSSHFMAWVRQTPEKRLEWAANIYPDGGTAYYPNTVKGRFTISRDNARNTMYLQMSSLRSEDTAMYYCVRQ
Mus spretus V220 ighv LVXV01021267.1 93522 VLSQVQMKQSGPGLVQPSQSLSITCTVSGFSLTSYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSQVFFKMNSLQADDTAIYYCVR
Mus spretus V221 ighv LVXV01021267.1 69865 VLCEVKLVESGGGLVQPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVATISSSGGSTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCA
Mus spretus V222 ighv LVXV01021267.1 49495 VKCEVQLVESGGGLVQPGGSLKLSCAASGFTFSNYYMSWVRQTPEKRLEWVAYISSGGGSTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCA
Mus spretus V223 ighv LVXV01021269.1 595 VQCEVKLVESGGGLVQPGGSRKLSCAASGFTFSDYGMVWVRQAPGKGLEWVAYISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMSSLRSEDTAMYYCA
Mus spretus V224 ighv LVXV01021271.1 966 VLSQVQLKESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLGVIWAGGSTNYNSALMSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAR
Mus spretus V225 ighv LVXV01021272.1 16861 VNSEVQLQQSGAELVRPGASVKLSCTASGFNIKDDYMHWVKQRPEQGLEWIGRIDPENGNTIYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCA
Mus spretus V226 ighv LVXV01021273.1 10124 IQCEVKLVESGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKRLEWIAASRNKANDYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARD
Mus spretus V227 ighv LVXV01021316.1 7735 IQGEVQLVESGGSLGQPGGSTKLSCEEASGFTFSDHWMHWFRQAPGMRLEWIANTNHDESGKGYAESVKDRFSISRDNSENLLYLQMNSLRNEDTALYYCAR
Mus spretus V228 ighv LVXV01021345.1 104461 VYSEVQLQQSGAELARPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGAIYPGNSDTSYNQKFKGKAKLTAVTSASTAYMELSSLTNEDSAVYYCT
Mus spretus V229 ighv LVXV01021346.1 112529 VLSEVQLQQSGPELVKPGASVKMSCKASGYTFTDYYMHWVKQSHGKSLEWIGYIYPNNGGNGYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCA
Mus spretus V230 ighv LVXV01021346.1 110618 VLSEVQLQQSGPELVKPGASVKMSCKASGYTFTDYYMHWVKQSHGKSLEWIGYIYPNNGGNGYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCA
Mus spretus V231 iglv LVXV01021779.1 17534 FQPTLTQPDAFSVFPGQDAHLSCTINSQHATAGDIGVSWYQQQPGSAPHLLYYYAEEEHYRPADIPDRFSATVDAAHNACILTISPVLPEDDADYFCSI
Mus spretus V232 ighv LVXV01025272.1 7542 VHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGEINPSNGRTNYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus spretus V233 igkv LVXV01025797.1 15387 IMSRGQIVLTQSPAVMSASPGERVTMTCSASSSVNYMYWYQQKPGTSPKLWIYRTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQFTSSP
Mus spretus V234 ighv LVXV01025852.1 805 TLKEYGPGKLQPSQTFSLTCSFSGFSLSTYGMMVSWMCQPSGKDVEWLAHIWWNDDKGYNPSLRSRLTISKDTPNNQVFLKISSVVTADTITYYCA
Mus spretus V235 ighv LVXV01026319.1 25868 VHSQVQLQQPGSVLVRPGASVKLSCKASGYTFTSSWMHWAKQRPGQGLEWIGEIHPNSGNTNYNEKFKGKATLTVDTSSSTAYVDLSSLTSEDSAVYYCA
Mus spretus V236 ighv LVXV01026538.1 18169 VLSQVILKESGPGILQPSQTLSLTCSFSGFSLSTYGTAVNWIRQPSGKGLEWLAQIGSDDSKLYNPFLKSRITISKDTSNSQVFLKITSVDTEDSATYYCANR
Mus spretus V237 ighv LVXV01026538.1 10295 VHCQVQLQQSGPELVRPGTSVKISCKASGYTFLTYWMNWVKQRPGQGLEWIGQIFPASGSTYYNEMFKDKATFTVDTSSSTAYMQLSSLTSEDTAVYFCA
Mus spretus V238 ighv LVXV01026787.1 151022 VHSQVQLQQSGAELVKPGASVKLSCKASGYTFTEYTIHWVKQRSGQGLEWIGWFYPGSGSIKYNEKFKDKATLTADKSSRTVYMELSRLTSEDSAVYFCA
Mus spretus V239 ighv LVXV01026787.1 85907 VNSQVQLQQPGAEIVRPGASVKLSCKASGYTFTDYWMNWVKQRPGQGLEWIGVIDPSDSYTSYNQKFKGKATLTVDESSSTAYMQLSSLTSEDSAVYYCA
Mus spretus V240 ighv LVXV01026787.1 18647 VHSQVQLQQPGAELVRPGASVKMSCKASGYTFTSYLMDWVKQRPGQGFEWIGNINPNSGSTNYNEKFKGKAKLTVDKSSSTAYMQLSSLTSEDSAVYYCA
Mus spretus V241 ighv LVXV01027216.1 2093 VHSEFQLQQSGPELVKPGASVKISCKASGYSFTDYNMNWVKQSNGKSLEWIGVINPNYGTTSYNQKFKGKATLTVDQSSSTAYMQLNSLTSEDSAVYYCA
Mus spretus V242 ighv LVXV01027344.1 12852 VHSQVQLQQPGAELGKPGTSVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGNINPNSGSTNYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCT
Mus spretus V243 ighv LVXV01027834.1 25729 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTFGMGVIWICQPSGNGLEWLAHIYWDDDQHYNPSLKSWLTISKDTSNNQVFLKIASVDTADTATYYCARR
Mus spretus V244 ighv LVXV01028521.1 89847 VHSQVQLQQPGAELVRPGALVKLSCKASGYTFTRYWIQWVKQRPGQGLEWIGNISPNSGSTNYNEKFKGKATLTVDKSSSTAYMQLNSLTSEDSAAYYCA
Mus spretus V245 ighv LVXV01028521.1 75830 VHCQVQLKQSGAELVRPGTSVKMSCKASGYTFTSYYIHWVKQRPGQGLEWIGKIGPGSGSTYYNEMFKDKATLTVDTSSSTAYMQLSSLTSEDSAVYFCA
Mus spretus V246 ighv LVXV01028521.1 56616 VHCQIQLQQSGPELVKPGASVKISCKASGYTFTSYYIHWVKQRPGQGLEWIGWIYPGDGSTNYNEKFKGKTTLTADKSSSTAYMLLSSLTSEDSAVYFCA
Mus spretus V247 ighv LVXV01028521.1 47059 VLPQVTLKESGPGILQPSQTLSLTCSFSGFSLSTFGMGVGWIRQPSGKGLDWLVHILWNDNKYYNPALNSLLTISKDTSNNQVFLKIASVDTADTATYYCARI
Mus spretus V248 ighv LVXV01028521.1 38434 VLSQVTLKESGPGILQPSQTLSLTCSFSGFSLSTFDTGVGWIRQPSGKGLEWLANIWWNDDKYYNSALKSRLTISKDTSNNQVFLKIASVDTADTATYYCAQI
Mus spretus V249 ighv LVXV01029018.1 8458 VHCQVQLQQSGPELVKPGASVKISCKASGYSFTSYYIHWVKQRPGQGLEWIGWIYPGSGNTKYNEKFKGKATLTADTSSSTAYMQLSSLTSEDSAVYFCA
Mus spretus V250 ighv LVXV01029166.1 540 VHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCT