WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Myodes glareolus LIPI00000000.1 (LIPI01) 52 4 1 21 4 17 5 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Myodes glareolus V2 trgv LIPI01009864.1 41352 RQTSPNLEERIMSITRPTGSSIIITCDVRRAYSYIHWYRFQEGRTPQHLLFYNFISSTTVVDSGLSSEKYHAYEGTDKTYKFVLRNVEESDAGLYYCASWA
Myodes glareolus V3 trgv LIPI01009864.1 50212 GLGKVEQPEISVSRATDETAQISCKVSINSFKSVAIHWYRQKPNQGLQFLLYVMATPTHILLDGTKKMEASKNSSASTSTLTIYSLKEEDEAIYYCSYG
Myodes glareolus V4 trgv LIPI01009864.1 59017 TGGSIPSSHLMSYITKRKGETAFLECQFKNILKHDIYTHWYRQKPGQPPKRMLYISSRGNVVYEEGFSEERYEAKQWQNDLSSNLRIYQVTEEDTGTYYCACWV
Myodes glareolus V5 trgv LIPI01009864.1 61582 GDSWISQDQLSFTRRPNKTVHISCKLSGVPLQNTIVHWYQLREGEPIKRIFYGSAKTQKQDKLNSRLETDEKSDGTFYLIINNVIRADEATYYCACWD
Myodes glareolus V6 trgv LIPI01009864.1 86114 GLGQLEQPEISVTKAIGESAQIACKVSPDLGDTDIHWYRQKENQQFDYLIHVRQSYNQRPLDGINKKIEVSKDSQTSTSTLKVNFLKKEDEAFYYCAVWT
Myodes glareolus V7 ighv LIPI01011345.1 2139 IHSQEQLQQSGAELVKPGTSVKMSCKASGFSFTSYYMHWIKQRPGHNMEWIGWIGAGSGSTYYNQKFQGKATLNVDQSSSTAYMELSSLTSEDSAVYYCVRQ
Myodes glareolus V9 igkv LIPI01023697.1 4104 SRCDIQMTQSLSQIVSLGDTVTIRCQASQSIDNVLNWYQQTSGKSPKLLIYGATRMEDGVPLRFRGSGFGRVFTLTISSVEPEDNGTYYCQQFYDY
Myodes glareolus V10 igkv LIPI01025316.1 196008 VQCDIHMTQSPVSLSAFIGDTVTITCRASQDISRYLGWYQQKPGKSPKFLIYYASNLLSDVPKRFSGSGSGTEYSLTIISLEPEDYGIYYCQQCFSYP
Myodes glareolus V11 igkv LIPI01025316.1 199787 VTGETMTQFPVSLSFSQGETATLTCRSIQSVGSYLSWYQQKPMQVPKLLIYGASNKASDVPARFSGSGSGTDFTLTISNLEPEDAASYYCQSMSGWS
Myodes glareolus V12 igkv LIPI01025316.1 209613 SKGDIVLTQSPATLSVIPGERVILTCKASQGISSNLHWYQKKTNEAPKLLIKYASQSISGIPSRFSGSGSGTDFTLSINNLEPEDIAVYYCQHDYSWH
Myodes glareolus V13 igkv LIPI01029199.1 561 VRCDIQMTQSPSTLSASLGESVTITCHANQNINSWLSWHQQKLGNAPNLLIYKTSNLHTGIPSRFSGSGSGTHYALTISNLQPEDTATYYCQQDQSVP
Myodes glareolus V14 trav LIPI01045355.1 153484 GNRAQSVVQPDAHLTVSEGASLELKCSYSYGATPYLFWYVQYPGQSLQLLLKYFSGNTLVKGINGFQAEFGKSNSSFNLRKNPAHWSDSAKYFCALS
Myodes glareolus V16 igkv LIPI01102988.1 2173 ARCDIQLTQSPASLSASLGESVTITCQPSESIGWDLAWYQQKQRKPPKLLIKAGDELADGVPSRFSGSRSDQQYSLKISSLEPEDGAMYYCQQYNSFP
Myodes glareolus V17 igkv LIPI01148461.1 483 SWEQVVLTQSPTSMTASQGEKVTISCISSVSIGNLHWYQQKPEASPKLLIYGVSNLASRVPACFSGSRSGISYSLTITSIEAEDAATYYCQQTNSY
Myodes glareolus V18 trbv LIPI01148632.1 585 HTKAGVSQFPAHTIIKKGQNVSFRCYPISGHTRLFWYQQKSGQGPEFLTYFQNEVAPDKSGLPGDRFSAERPDGSYSVLKIQPAKREDSAVYLCASSL
Myodes glareolus V19 igkv LIPI01162793.1 2049 CRCDAKITQSPSSLSASLRERVTITCKASQSISNNLSWFQQKPGKSPKLLIYWATKLANGVPSRFSGSGYGTDFTLTINNLEPEDTATYYCLKTHEVS
Myodes glareolus V20 ighv LIPI01193202.1 673 DNYQVQLQQSGAELVWPGASVKLCCKASDCTFISYYISWMKQSPGQGLEWTGHIYSGSGGTDYNQKFQGKTTLTADTTSSTVCMELIRLTSEDSEVYYCA
Myodes glareolus V22 igkv LIPI01006613.1 4779 SKSDVLMTQTPTSLAVRLGDQVSISCRASQSLIYSDGTTYLYWCLQKPGQSPMPLIYRVSKRYSGVPDRFTGSGSGTDFTLKISRVEHEDLGIYYCMQY
Myodes glareolus V23 igkv LIPI01008244.1 735810 ARCDIQVTQSLSSLSVSLEDRITITCKTSQGVSNLMAWYQQKPGEVPKLLIYYASTLQSGVPTRFSGSGSGTDFSFTISRLEPEDIATYYCQLGYGL
Myodes glareolus V24 igkv LIPI01010349.1 112251 VCADIMMTQSPSSLTVSVGEKVAISCRSSQSLLNIGTQKNYLNWYQQKPGQSPKLLIYYAYTRDTGVPDRFIGSGSATDFTLTINSVQAEDLAVYYCQQDFLY
Myodes glareolus V25 igkv LIPI01010349.1 59072 ACADIVVTQSPSTLVVSAGEKVIISCRSSQNLLYSTIQKNLLNWYQQKPGQSPKLLIYWASTRYTGVPDRFIGSGSGTDFTLTISNVQVEDVAEYYCQQGYSDP
Myodes glareolus V26 igkv LIPI01010349.1 41321 STGEIVLTQSPDILAVSLGQSVTISCKSSKSVNKFGINLMHWYQKKPGEPLKLLIYNDGIRPSGIPARFSGYEASLDFTLAINTVEADDAATYYCQQGINLP
Myodes glareolus V27 igkv LIPI01012542.1 10880 STGDIVLTQSPGLLTVSLGQKATIYCKSSESVSFFRFGNLMHWYQQKPGQPPKLLIYSTSNLETGVPARFSGSGSGTDFTLTINPVEADDAATYYCQQSKKDP
Myodes glareolus V28 igkv LIPI01013419.1 1311 FAEDIVLTQSPASLALSLGQRATISCKASQSVTVGGVIHHMYWYQQKPGQSPKLLISIASSLEPGVPPRFSGSGSGTDFTLSINPVEADDAATYYCQQRYDLP
Myodes glareolus V29 ighv LIPI01013635.1 89287 ALSQVQLKESGPGLVQPSQTLSLSCTVSGFSLTSYGLSWIRKPPGKGLEWMGAIWYDGITEYKSSLQSRIAITRDTSKSQVFLKLNTLKTEDTAMYYCAK
Myodes glareolus V31 trbv LIPI01017398.1 716 PLETTVFQNPQYLVTQVGNKASLKCDQDLGHDAMYWYKQDSKQSLKIMFIYNSKQLILNESVPSRFSPQSPDKAHLNLQVRLVEPDDSAVYFCASSY
Myodes glareolus V32 trbv LIPI01019891.1 37522 VGAQIIHQQPAVSVQPVGSSLSVECTVQGQSSPNLYWYWQDKGGTLQQLFYSISVGDVVSVAARNLSASRPQDGQFTLSSEKLLLSHSGFYFCAWS
Myodes glareolus V33 igkv LIPI01021377.1 1682 ACADIVMTQSPSSLAASAGEKVTISCKSSQSLSSGGTNYLAWYQQKPEQAPKLLIYYASTRYTGVPDRFTGSGSGTDFTLTISSVQAEDLADYFCQQHY
Myodes glareolus V34 trav LIPI01031395.1 6177 GVRGVEVEQSPSALKLYEGTSSPLLCNFSTTIMSLQWFQQSPSGSFINLFYQAPGTKENGRLKSTFDSKERYSTLHIRDAQLGDSGTYFCAAE
Myodes glareolus V35 trav LIPI01031430.1 9041 EQVEQRPSTLRFQEGARAVINCTYEDSESSYFPWYKQEPGKHPKLIIAILSNMEKKQDQRLNISHNKKAKHFSLHITDNQPGDSAMYFCAARTQCSP
Myodes glareolus V36 trbv LIPI01039190.1 53233 QVSAGIIQTPKSMLVKTGQHVSMKCTQDMKHDSMFWYRQDPGLGLRLIYDSYDVGITDKGDVPEGYNVSRSNTKDFFLILESASPSQTSVYFCASSY
Myodes glareolus V37 trbv LIPI01039190.1 49951 LTNAGVSQSPLHRIIKRGQDVALECDPVSGHRGLYWYRQNLGQGPVFMVSFQDELLSDKSGMPNDRFSAGRPAGSSSTLKIQSTDQEDSGIYLCASSL
Myodes glareolus V38 trbv LIPI01039190.1 45333 LTDAGITQTPRYWIVLTGRKMTLECSQNMNHYSMFWYRQNAGEGLKLIYYSGSVGSTTKGDVPEGYSVSRNKSEHFPLTLGSARPSQTSTYFCASS
Myodes glareolus V39 igkv LIPI01054168.1 7233 IVMTQSPSSMSVSAGEKVTISCKSSQSGGNNYLSWYQQNPGQVPKLLIYDASTRHTGVPDRFTGSGSRTDFIFTINSVQSEDLADYYCMKHYNVP
Myodes glareolus V40 igkv LIPI01061217.1 52604 AYGNLVMTQSPKSLSTSVEDRVSLSCKSCQNMDISVAWHQQKPGQVSKLLIYSTSTWYPGVPDLFTGSECETDFTLTIGSGQAQVLADYYCVQGNSNS
Myodes glareolus V41 igkv LIPI01069417.1 613 SREETTVTQSPAFLSMATGEKVTITCRTSTDIDDDMNWYQQKPGQAPRLLISEGNTLNSGVPSRFMSSGYGTDFTLKIDGIQSDDAANYFCQQSDNLP
Myodes glareolus V42 trbv LIPI01086092.1 171819 LSEAGVTQSPRYVIIQERQEVSFWCDPISGHTTLYWYQQPRDQGLQFLTYFQNEAIMDDSQLPKDRFSAVRPNGVNSTLKIQSAKLGDSATYLCASSL
Myodes glareolus V43 trbv LIPI01086092.1 165025 HTDAGVTQSPRHEVAEKGQTVTLTCEPVSGHNDLFWYRQTKTQGLELLRYFRSKSLMEDEKTGKDRFTAEMLNSSASTLKIQPTEPQDSAVYLCASSL
Myodes glareolus V44 trbv LIPI01086092.1 151381 PINAGVTQTPRHKVTKMGQEVTLRCEPISGHSGVFWYRQTTVRGLEFLISFLNQAPIGESGMPKERFSAQMPNATLSTLKVETTQPQDSAVYLCASSL
Myodes glareolus V45 trbv LIPI01086092.1 138850 CVDAMVMQNPRYKVARVGKPVNLSCSQNLNHDVMYWYQQKPNQAPKLLLYYYDTTLNREADTSENFQSNRPNTSFCSLDIHSAGLGDSSLYLCASSR
Myodes glareolus V46 trbv LIPI01086092.1 125125 TTHGAITQKPKFLIGLQGQELTMECQQTFNHDTMYWYRQDPGKGLRQIYYSITEKDIQKGELSEGYSVSREKKPFFPLTVTSAQKNQMAVYLCASSI
Myodes glareolus V48 trbv LIPI01086092.1 105015 SMGTEVIQNPRYLVKGKEQKAKMDCTRIKGHSYVFWYYKKLGEELKFLAYFQNADILDKIDTIGKNISAKCPTDLPCTIEIQSSQLTDSAVYFCASSQ
Myodes glareolus V49 trbv LIPI01086092.1 82783 FGDAAVTQTPRHLVKMKGQKATMKCSPEKGHNAVYWYQQKQDKELKFLIYFQNKQPLDQIDMVKERFSVEFLSDTECRLEIKSSEAGDSALYLCASSQ
Myodes glareolus V50 trbv LIPI01086092.1 80753 SFDAKVTQIPRHLVKEKGQKANMVCYPEKGHTAFYWYQQSQKELKLLINFRNEEIIEQTDLVKKRFSAKCPSNSPCSLEIQSSEAGDAGLYFCASSQ
Myodes glareolus V52 trbv LIPI01086092.1 38333 ALVDMDVTQTPRYLVKRTGEEVLLDCEQYMSHERMFWYRQDPGLGLQLIHFSYDVDSNSEGDIPEGYRVSRKKRERFSLILESAKTSQTSVYFCASSL
Myodes glareolus V53 trbv LIPI01086092.1 30348 SVFSVLVSQKPQRDICQSGTSLKIQCVLDSQVTGMFWYRQIPGQSLVLMAAANQGSEATYEKEFDKDKFPISRPNLTFSTLTVSNARPEDSSFYFCSAG
Myodes glareolus V55 trav LIPI01099383.1 3363 RTHGESVTQTESQVTLSEEDFLTIQCTYSASGYPALYWFMQYPGEGPQLLFRASKDKEKKSNKGFEATYDKVSTSFHLQKASVQESDSAVYYCALT
Myodes glareolus V56 ighv LIPI01117319.1 448 VQSQDQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHMHWVRQPPGKGLEWIGAIWYNGGTDYNSALKSRVTITRDTSKSQVFLKLNSLQTEDTAMYYCAR
Myodes glareolus V57 igkv LIPI01137842.1 319 SRCDIQLIQSPSILSASLGDKVTITCRASENIDIYLHWFQQKPGEVPKLLIYRATNLQSGVPSRFSGSGQGTYFTIMISSLKSDVATYYCLQSHIP
Myodes glareolus V58 iglv LIPI01195976.1 960 SCAQVVLTQPSSVSGSLGSTVTITCKHSSGNIGSYYVHWYQQYFGSPPTNVIYKDNKRPSGIPGRFSGSIDSSSNSASLTITDLQIEDEADYYCQSTGSSY
Myodes glareolus V59 trbv LIPI01349716.1 443 HTGPSVLQFPSHQVTREGQMVILSCDPVSSHLYFYWYKLILGQKIEFLVSFYNGKPMEKSKLFEEDRFSVERQEDSYFTLKIQPTTPEDSAVYFCASSL
Myodes glareolus V60 igkv LIPI01361104.1 1178 ARCEILMTQSPASLPVSLKDSITIICRASQDIYIHLAWYQQKPGKSPKLLIYAENSLADDVPSRFSGSGSGTQYSLKIRGLQAEDIATYYCLQYKYPP