WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Cricetulus griseus AMDS00000000.1 (AMDS01) 357 165 33 44 78 26 5 6
Cricetulus griseus APMK00000000.1 (APMK01) 162 57 5 14 51 24 5 6
Cricetulus griseus AFTD00000000.1 (AFTD01) 286 126 23 55 54 25 0 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Cricetulus griseus V1 ighv AMDS01000680.1 14970 VHSHVQLQQSGAEVAKPGASVKLSCKASRYTFTSHYMSWVKQKPGQGLEWIGWIGGGSGDTDYNQRFQGKATLTRDKSSSTAYMELKSQTSDKAAVYYCTR
Cricetulus griseus V11 trgv AMDS01008903.1 12142 RQTSPNLEERIKSIVRPMGSSFIIPCDIHITNSYIHWYLFQKGKAPQHLLYYNLFISQTVVDFGLSSKKYHVYEGTDKIYKFGLRNVEESDSGLYYCASWA
Cricetulus griseus V12 trgv AMDS01008903.1 21440 GLGNLEQPAISISRTKDESVQISCKASINSFKSVAIHWYRQKPNQGLEFLLYVIATPTHILLDEKYKKMEASKNSSASTSTLTIYSLKEDDEAIYYCSYG
Cricetulus griseus V13 trgv AMDS01008904.1 5450 ASGSSPTSHLMPYITKKKGNTAFLECLIKTSVLNHNTYVHWYRQKPGQPPKRMLYISSKENTVYEEGFSKERYEAKKWHSDLSSILRIHQVTEEDTGIYYCAWWD
Cricetulus griseus V14 trgv AMDS01008904.1 7194 GDSWISQDQLSSTRNPNKTVHISCKLSGVPLQNTIVHWYQMKEGESLKRIFYGSAKNYKQDKPNSRLEAYENDGTFYLIINNVITADEATYYCACWD
Cricetulus griseus V15 trgv AMDS01008904.1 41126 GLGQLEQTELSVTRAMDESAQISCKVSLQDFGKVDIHWYRHKRNQQFEYLMFVRTNYNERTLEGKIKKIEATKDVQTSTSTLKVNFLKKGDEAIYYCAVWS
Cricetulus griseus V18 ighv AMDS01012548.1 220 VQCDEKLVESGGGLVKPEGSLKLSCVASGFTFSSYWMDWVRQAPGKGLEWVGEISTGGSTTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCTR
Cricetulus griseus V19 ighv AMDS01012548.1 4572 VHCQVQLQQSGAELEKPGASVKLSCKTSGYTFTEYTMHWVKQKPGQGLEWIGYVYPYNGDTKYNQKFQGKATLTADKSSSTAYMELSSLTSEDSAVYYCA
Cricetulus griseus V20 ighv AMDS01012548.1 21305 VTTQIQLVQSGAELKQPGQSVKISCKASGYTFTQYAMNWVKQAPGQDIKWMGWINTETGNPTYADDFTGRFVFSLDTSVSTAYLQISSLKNEDTVMYYCA
Cricetulus griseus V21 ighv AMDS01012548.1 26889 VHCEVQLVESGGGLVKPAGSLKLSCAASGFTFTDYWMNCVHQAPGKGLELVARIGTKSYNYATYYSNSVKGRFTISRDDSQSMVYLQMNNLRTEDTATYYCTT
Cricetulus griseus V22 ighv AMDS01012550.1 4060 YSEGVWPWAVTAFPDSQSETCSFSGFSLSTSNTAVGWIPQPSGKGLEWLANIWWDDDKYYNPSLKSRLTISKDTSNNRVTLKIASVDTADTAIYYCAQR
Cricetulus griseus V23 ighv AMDS01012556.1 198 VQCEVQLVESGGGLVKPGGSLKLSCVASGFTFNDHYMNWVHQAPGKGLEWVGYINKDGSYINYAPSVKGRFTISRDNAKNSLYLQMYSVKSEDTATYYCA
Cricetulus griseus V31 ighv AMDS01018237.1 1746 VQCEVQLVESGGGLVQPGKSLKLSCEASGFTFSDYSMDWVRQAPGKGLEWVAYITGGSSTIYYANAVKGRFTISRDNAKNLLFLQMNSVKSEDTATYYCAR
Cricetulus griseus V63 ighv AMDS01034004.1 3308 VHSQVQLQQSGPQLVKPGASVKVSCKASGYTFTDYAMHWVKQKPGQGLEWIGWIIPIIGNTNYGQKFQGKATLTADTSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V64 ighv AMDS01034009.1 1348 VQCEVQLVESGGGLVQPGSSLKLSCAASGFTFSGYYMHWVRQAPGKGLEWIGVIEHKYNNYATDYAESVKGRFTISRDDSKSSLYLQINSLISNDTVIYYCAA
Cricetulus griseus V65 ighv AMDS01034015.1 5000 VHSQIQLQQSGPQLVKPGSSVKLSCKTSGYTFTDYAMHWVKQKPGQSLEWIGITVPGIGITNYGQKFQGKATLTADTSSSTAYMELSSLTSEDTAVYFCAR
Cricetulus griseus V68 ighv AMDS01034650.1 3117 VHCEVQLVESGGGLVKPAGSLKLSCAASGFTFTDYAMSWVRQAPGKGLEWVARISTNPNNYATYYPDSVKGRFTISRDDSRSMAYLQMNNLRTEDTATYYCTA
Cricetulus griseus V69 ighv AMDS01034653.1 5693 VHCEVQLVESGGGLVKPSGSLKLSCSASGFTFTDYAMSWVRQAPGKGLEWVASINTKPNNYATYCSDSVKGRFTISRDDSQSMVYLQMNNLETEDTATYYCTA
Cricetulus griseus V70 ighv AMDS01034657.1 1328 VQCEVQLVESGAGLVKPGGSLKLSCVASGFTFSDFWMHWVRQAPGKGLEWFGEIMYDGSTTRYAPSVMGRFTISRDNAKNTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V71 ighv AMDS01034658.1 278 VQCEVQLVESGAGLVKPGGSLKLSCVASGFTFSDFWMHWVRQAPGKGLEWFGEIMYDGSTTRYAPSVMGRFTISRDNAKNTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V72 ighv AMDS01034658.1 5668 VHSQVQLQQSGAQLGASGKLSCRTSGYTFTDYATHWVKQRPGQGLEWIEWIYPGDGSTSYNQKFQGKAKLTADTSPSTAFMELSSLTSEDSAVYYCTN
Cricetulus griseus V73 ighv AMDS01034663.1 1586 VHCEVQLMESGGSLVKPGGSLKLSCAASGFTFSNYWMEWVRQAPGKGLEWVGEINGDSSTTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCA
Cricetulus griseus V85 ighv AMDS01038833.1 4508 VHSQIQQQQSVAEVVRPGASVKVSCKASGYTFSYDYMHWVKQKPGQGLEWIGGIFTGIGIANYGQKFQGKATLTADTSSSTAYMELSSLPSEDSAVYYCAR
Cricetulus griseus V90 ighv AMDS01041357.1 630 AAGGVWGWPGEAWGSLKISCAASGFTVSNYLMDWFHQAPGKGLEWVGYINKDGSTTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCPRE
Cricetulus griseus V91 ighv AMDS01041358.1 2717 VHSQVQLQQSGAELVRPGASVKLSCKTSGYTFTEYTMHWVKQRPGQGLEWIGWIYPGDGDTKYNQKFQGKATITADTSSSTAYMELSSLTSEDSAVYYCAKD
Cricetulus griseus V137 igkv AMDS01059923.1 323 SIGDIVLTQSPASMPVSVGKKATISCKSSNRVDEYGIDLVQWYQQKPGQPPKLLIYAASNLAPGVPARFSGSGSGTDFTLTIHPVETDDAATYYCQQSKELP
Cricetulus griseus V138 igkv AMDS01059927.1 4271 STGDIVLTQSPATLTRSLGQSATISCKASQSVSIGSINLMHWYQQKPGQPPRLLIYGASNIESGVPARFSGSGSGTDFTLTIHPVEADDAATYFCQQSRERP
Cricetulus griseus V151 trav AMDS01066119.1 12942 GVRGVEVEQSPSALSLHEGTNSTLTCKFSTTMNTVQWFRQNPRGSLINLFFLTPGTKENGRLTATFNSKERYSTLHIRDTQLEDSGTYLCAAD
Cricetulus griseus V152 trav AMDS01066120.1 5070 RSNGDSVAQTEGLVTVTEGSPVMMTCTYQTTYPNIVLFWYVQYLNKVPQLLLRTATDNKRTEHQGFHATLHKSSSSFHLEKSSVQLLDSALYYCALS
Cricetulus griseus V153 trav AMDS01066120.1 8251 VKGQQVKQSPVSLVLQEGERAELQCNFSTTANQMQWFHQSPGGHLISLFYNPSGTKQRGRLTSTTVTQERRSSLYISSSQTTDSGTYFCAIDAQCS
Cricetulus griseus V154 trav AMDS01066122.1 18138 GVRGVEVEQNPSALSLHEGTNSTLTCKFSTAVNAVQWFQQNPRGSLINLFYMVLGTKENGRLTATFDSKELYSTLHIRDAQLEDSGTYLCAVR
Cricetulus griseus V155 trav AMDS01066123.1 1018 LSQGEQVEQLPSILSVQDGDSAVINCTYTDSGSSYFPWYKQGPGEHPKLIIDIRSTMERKQDKRLIVLQFKKAKHFSLHITDTQPGDSAMYFCATD
Cricetulus griseus V156 trav AMDS01066123.1 7004 LSQGEQVEQLPSILSVQDGDSAVINCTYTDSGSSYFPWYKQGPGEHPKLIIDIRSTMERKQDKRLIVLQFKKAKHFSLHITDTQPGDSAMYFCATD
Cricetulus griseus V157 trav AMDS01066124.1 626 KSNGDSVAQTEGLVTVTEGSPVMLNCTYQTIYSGPVVFWYVQYLNKAPQLLLRSATENKRTEQQGFHATLHKRNSSFHLEKSSMQLSDSALYYCALS
Cricetulus griseus V158 trav AMDS01066124.1 8056 VKGQQVKQSPVSLVLQEGERAELQCNFSTTTKQVQWFHQNPRGHLISLFYNPSGTKQRGRLTSTTVTQERRSSLFISSSQTTDSGTYFCAIDAQCS
Cricetulus griseus V159 trdv AMDS01066125.1 1673 SILGQKVTQVQSTTSTREGEEVSLDCSYETSQKLYHLLWYKQLLSGEMIFLIRQISSWPQNEKSGRYSVIFQKSAKSIGLVISASQMEDSGTYFCALLEW
Cricetulus griseus V160 trav AMDS01066126.1 15237 LSQGEQVEQLPSNLRVQEGDSAIINCTYTDSTLSYFLWYKQGPGEHPKLIIDIRSTMERKQDQRLIVLQDKKAKHFSLHITDTQPGDSAMYFCAAS
Cricetulus griseus V161 trav AMDS01066127.1 4532 RTHADSVTQTGGKVTLSEEDFLTIHCNYSASGYPALLWYVQYPGEGPQLLFRASKANEKGSSRGFEATYDRESTSFHLQKASVQESDSAVYYCVVG
Cricetulus griseus V162 trav AMDS01066129.1 5402 VSSQQKVQQTPGSLSVPEGDTASLNCTFSDRASQSFWWYRQHPGKSPKALTSIFTDGKNEEGRFTARLNRASLHLSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V163 trav AMDS01066133.1 4918 DVQAQSVTQRDAHVTVIEGDSVELRCNYSYGGASYLFWYMQRHGHNIQFLLRYYSGDPVVHGLNGFEAEFRKSDSSFHLKKASVDLSDSAVYFCALS
Cricetulus griseus V164 trav AMDS01066133.1 12451 ESNGDSVTQTEGQVTLSEGTSVTVNCSYETQQYPALFWYVQYPGEGPQLLFRVSKANEKGSSRGFEATYDKESTSFHLQKASVQESDSAVYYCALS
Cricetulus griseus V165 trav AMDS01066133.1 20012 RTHGDSVTQTGGQMTISEGEFLTINCTYSITSVAYPALFWYVRHPGESLQLLLKVLTAGEKGSSRGFEATYDKGSKSFHLQKASVQESDSAEYYCAVG
Cricetulus griseus V166 trav AMDS01066133.1 22508 AAGKTQVEQSPQSLTVLQGENCTLQCSYTVSPANNLRWYRQDTARGLVPLAIITHRENSKSNGRYSATMNRDARHSTLHITASHLEDTASYICVVG
Cricetulus griseus V167 trav AMDS01066134.1 8168 VSSQQKVQQTPESFSVPEGAMASLNCTFSNSASDNFRWYRQHPGKGLELLVSIFSSGKREEGRFTAHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V168 trav AMDS01066135.1 2751 KINGDSVTQTEGLVTVTVESPVMLSCTYQTISSAPTVFWYVQFLNKAPQLILMSFTDNKRTEKEGFHATLHKSNSSFHLQKSSAQLSDSALYYCALS
Cricetulus griseus V169 trdv AMDS01066135.1 22037 SILGQKVTQVQSTASSQEGEEVNLDCSYETSQNLYHVLWYKQLLSGEMVFLIRQISFSTQSERSGRYSIIFQKSAKSVSLVISASQIEDSVTYFCALWEQ
Cricetulus griseus V170 trav AMDS01066136.1 9247 LSQGEQVEQLPSTLRVQEGDSAVINCTYTDSTSYYFLWYKQGPGEHPKLIIDIRSNEERKQDQRLIVLLDKKAKHFSLHITDTQPGDSAMYFCAAS
Cricetulus griseus V171 trav AMDS01066136.1 10982 RSKADSVTQTEGQVTITEGSPMMLSCTYQATYSGSFLFWYVQYLNKAPQMLLRSSTDKKTEHQGFHASLHKSNSSFHLEKSSVQLSDSALYYCALS
Cricetulus griseus V172 trav AMDS01066137.1 1279 FFAGDSRAQSVTQPQARITVTEEASLQLRCNYSSSMTPHLFWYVQYPQQGLQLLLKYYSGEPVVPGLRGFEAEFSKSDSSFHLKKASVHLSDSAVYFCALS
Cricetulus griseus V173 trav AMDS01066138.1 7235 GVRGVEVEQSPSALSLHEGTNSTLTCKFSTTMNTVQWFQQNPRGSLINLFYMAPGTKENGRLTATFNSKERYSTLHIRDAQLEDSGTYLCAAE
Cricetulus griseus V174 trav AMDS01066138.1 12012 LSRGEQVEQLPSTLRVQEGDSAVINCTYTDSASNYFPWYKQGPGEHPKLIIDIRSTMERKQDQRLTVLQDKKAKHFSLHITDTHPGDSAMYFCAAS
Cricetulus griseus V175 trav AMDS01066141.1 5443 LSQGEQVEQLPSTLRVQEGDSAVINCTYTDSASNYFLWYKQEPGEHPTLIIDLRSNVERKQDQRLIVLQNKKAKHFSLHITDTQPGDSAMYFCAAS
Cricetulus griseus V176 trav AMDS01066141.1 13579 RTHGDSVTQTEGKVTLSEEDILTIHCNYSASGYPTLYWYVQYPGEGPQLLFRATKANEKGNSRGFEATYNRESTSFHLQKTSVQESDSAVYYCAVG
Cricetulus griseus V177 trav AMDS01066141.1 21869 VSSQQKVQQTPESLSVSEGDTASLNCTFSDSASQYFWWYRQHPGKGPKALVSIFSNGEREEGRFTVHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V178 trav AMDS01066141.1 26492 VNSLQGEEKPWTLSIPEGENVTVNCSYKTSITTLQWYRQYSGKGPAMLILIRSNEKEKQSGRLRVTLNTSTQSSSLSIKASRPEDTAAYFCATE
Cricetulus griseus V179 trav AMDS01066141.1 37470 DIQAQSVTQHDAHVTVFEGDSVELRCNFSYIGVPYLFWYMQSPSHSLQFLLKYISGDPVVHGMNGFEAEFQKSKSSFHLKKASVHLSDSAVYFCALN
Cricetulus griseus V180 trav AMDS01066141.1 40875 ESNGDSVTQTEGQVTLSEGTSLTVNCSYETKQYPALFWYVQYPGEGPQLLFRASKANEKGSSRGFEATYDRESTSFHLQKASVQESDSAVYYCVVG
Cricetulus griseus V181 trav AMDS01066142.1 8339 RTHGDSVTQTGGQMTISEGEFLTINCTYSITSIAYPAHFWYVRYPGESLQLLLKVLTAGEKGSSRGFEATYDKASESFHLQKASVQESDSAEYYCALS
Cricetulus griseus V182 trav AMDS01066142.1 10845 AAGNSQVEQSPQSLAVLQGENCTLQCSYTVGPFNNLRWYRQDTGRGLVSLAVMTHRENRKSKGRYSATLNTDVKHSALHITASQLEDTASYICVVG
Cricetulus griseus V183 trav AMDS01066142.1 23637 VSSQQKVEQTPESFSVPEGAMVSLNCTSSDRNSDYFWWYRQYPGKGPKALMYVISNGEKEEGRFKAHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V184 trav AMDS01066142.1 31532 RSNGDSVTQTDGLVTATEGSPVKLNCTYQTTVPAPTVFWYIQSLNKAPHLLLKSFTDNKRTEHQGFHATLHKSNSSFHLQKSSVQLSDSALYYCALS
Cricetulus griseus V185 trdv AMDS01066146.1 4843 SILGQKVTQVQSTASSQEGEEVNLDCSYETSQSFYHLFWYKQLHSGEMVFLIRQISSVTQSEKSDRYSVIFQKSAKSISLVISASQIEDSVIYFCALWEL
Cricetulus griseus V186 trav AMDS01066146.1 13861 SFAGDSRAQSVTQPQARITVTEEASLQLRCNYSSSVPPSLFWYVQYPRQGLQLLLKYYSGEPVVRGLSGFEAEFSKSDSSFHLKKASVHLGDSAVYFCALG
Cricetulus griseus V187 trav AMDS01066146.1 21270 LSHGKQVEQLPSTLRVQEGDSTVINCTYTDSTSYYFPWYKQGPGEHPKLIIDIRSNEERKQDQRLIVLLDKKAKHFSLHITDTQPGDSAMYFCAAS
Cricetulus griseus V188 trav AMDS01066146.1 22950 KSNGDSVTQTEGLVTVTEGSPVMMTCTYKTTYSDISLFWYVKFLNKAPQLLLRTATDNKRTEHQGFHATLHKSNSSFHLHKSSVQLSDSALYYCALR
Cricetulus griseus V189 trav AMDS01066146.1 38866 SFAGDSRAQSVTQPQAHITITEEASLQLRCNYSSSVAPYLFWYVQYPRQGLQLLLKYYSGEPVVRGLRGFEAEFSKSDSSFHLKKASVHLSDSAVYFCALG
Cricetulus griseus V190 trav AMDS01066147.1 19511 LSQGEQVEQLPSTLRVQEGDSAVINCTYTDSTSYYFPWYKQGLGEHPKLIIDILSTMERKQDQRLIVLQNKKAKHFSLHITDTQPGDSAMYFCAAS
Cricetulus griseus V191 trav AMDS01066147.1 21395 RSSGDSVTQTGQVTVTEGSPVMMNCTYQTIDLTPTFFWYVQGLNKAPRLLLRSSTDNKQTEQQGFHATLHKSNSSFHLQKSSVQLSDSALYHCALT
Cricetulus griseus V192 trav AMDS01066148.1 2936 VKGQQVKQSPVSLVLQEGERAELQCNFSSTSYQVQWFHQSPGGHLISLFVNPSGTKQSGRLKSTTVTQERHSSLYISSSQTTDSGTYFCAMNAQCS
Cricetulus griseus V207 ighv AMDS01070735.1 908 VYSQVELQQSGPQLVKPGFSVKLSCKVSDITFMDYYVSWVKQRPGQGLEWVGGIDLENGDTDYNQKFQGKATITADTSSSTAYMELSSLTSEDSAVYYCA
Cricetulus griseus V241 trav AMDS01082990.1 15447 AAGQGTEQPAKLMSVEGTSIQVNCTYSTSGFYGLSWYKQHDGQAPVFLSYDVLDSLKDSEHFSIFLSRWDGHSYLLLTEHRASSELQVKDSASYLCAVR
Cricetulus griseus V253 ighv AMDS01086798.1 497 VLSQIQLQESGPGLVKPSQSLSLTCSVTGDSITTSVYDWTWIMQFPGRKLEWMGNIGYDGGTDYNPTLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V254 ighv AMDS01086803.1 606 AAGGVGGGGGLVQPGKSLKLSCAASGFTFSSYWMNWVRQAPGKGLEWVAQIRDKSNNYATHYVESVKGRFTISREDSQSSVSQQMNNLRAEDTAIYYCT
Cricetulus griseus V282 igkv AMDS01099989.1 1773 ICGDIVMTQSPSSVAVSAGERVSINCNSSQNLFGNKTKKNCLVWFQQKPGQSPKFLIYWASARHTGVPDCFIGSGSETDFTLTISSVQAEDLADYYCMQDHIYP
Cricetulus griseus V286 ighv AMDS01101592.1 603 APHLSPYSVSDLVKPSQSLSLTCSVTGESITTSYYYWTWIRQFPGKKLEWMGYIGYGGGTDYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V287 ighv AMDS01101600.1 540 VQCEVQLLESGGGLVHPGKSLKLSCAASGFTFSDHWIDWIRQVPGKALEWVAQIGTKGYNHVTYYGESVSGRFTISRDDSKSSVYLQMSSLRAEDTAIYYCA
Cricetulus griseus V288 ighv AMDS01101601.1 4274 VHSEVQLQQSVAELGKPGASVKLSCRASGYNFIAYYMHWMKQRPGQGLEWIGRIDPEYDNTDYNQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V289 ighv AMDS01101609.1 1236 AQCEVQLVESGGGIVQPGQSPKLSCAASGFTFSDYWMGWVRQAPGKGLECIAEINGDNGTTKYTLSLKDRFSISRDNAKNTLYLQMNSVKSEDTVTYYCVI
Cricetulus griseus V290 ighv AMDS01101618.1 4936 VLSQIQLQESGPGLVKSLTCSVTGFSITSGYEWSWIRQFPGKKLEWMGLTNRGGSTKYNPSLQSRISITIDTAKNQFFLQLNSVTTEDTATYYCA
Cricetulus griseus V291 ighv AMDS01101621.1 981 VHSKVQLQQSGAELVKSESSVKLSCKASGYAFTGYYVHWVKQRPGYGMEWIGYIGCGVGSTGYNQKFQGKTTLTVEKFSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V292 ighv AMDS01101624.1 906 VQCEVQLVESGGGGGLVQSGKSLKLSCAASGFTFSDYWMNWVRQAPGKGLEWIASIEQKTNNYATHYGESVSGRFTISRDDSKSSVYLQMNSLKADDTVIYYCT
Cricetulus griseus V293 ighv AMDS01101624.1 2476 VHSQVQLQQSGADLVKPGASVKLSCQTSGFNFINSYMHWVKQKPGHGLEWIGRIDPEKGDTKYNQKFQGKATLTAETSSSTTYMELSSLTSDYSAVYYCA
Cricetulus griseus V311 igkv AMDS01111055.1 3229 ACADIVMTQSPSSLAVSAGDKATISCKSSQSLLYSEDQKNNLAWYQQKVGQSPKLLIYLASTRYTGVPDRFIGSGSGTDFTLTISSVQEEDMGDYHCMQKYSKP
Cricetulus griseus V312 igkv AMDS01111068.1 7367 ICGDIMLTQSPSSVAVSEGEKVSINCKASQNLFGSNSKKNRLAWYQQKAGQSPKLLIYWGSTRHTGVPDRFVGTGSETDFTLTISSVQAEDMGDYYCLQDHTSP
Cricetulus griseus V331 ighv AMDS01118111.1 274 VQCEVQLVESVGSLAQPGKSLKLSCEASGFAFSDHYMHWVHQAPGKGLEWVSSISGTSLLIYYADTVKGRFTISRDNTKKTLNLQMNNLTSEDTAMYYCAR
Cricetulus griseus V334 igkv AMDS01118670.1 482 SNGHVVLTKYPASLVMFLGNRATISCKPSQNVTIRPIDFMSWYQQKPGQGHKLLIYGASKLASGVHTRFSGSGSGTDFSLTIHPVEADDVATYYCQQCLVVP
Cricetulus griseus V335 ighv AMDS01118706.1 156 VHCQVQLQQSGAELENPGSSVKLSCKASGYTFTDHYMSWVKQKPGQGLEWIGYIGAGGGDTYYNQRFQCKATLTRDKSSSTVYMELSSLTSDDSAVYFCAR
Cricetulus griseus V339 ighv AMDS01119811.1 2621 ADGGVGGRLGAAWKVSETLLCSLGFTFSDHWMNWVRQAPGKGLEWIASIEQKTNNYATHYGESVSGRFTISRDDSKSSVYLQMNSLRAEDSATYYCT
Cricetulus griseus V340 ighv AMDS01119813.1 2211 VHSQVQLKQSGPELVKPGASVKISCKTSGYTFTFGYMHWVEQKPGQGLEWIGIIDPDSGNTKYNQKFQGKATLTRDKSSSTVYMELNSLTSEDSAVYYCVR
Cricetulus griseus V341 ighv AMDS01119825.1 2581 ADGGVGGRLGAAWKVPETLLCSLGFTFSDYWMNWVRQAPGKGLEWIASIEQKTNNYATHYGESVSGRFTISRDDSKSRRDDSKSSVYLQMNKLRAEESAIYYCT
Cricetulus griseus V342 ighv AMDS01119826.1 1404 VHSQVQLQQSGPELVKPGASVKISCKTSGYTFTDGYMHWVEQKPGQGLEWIGRIDPDSGNTNYNQKFQGKATLTRDKSSSTVYMELSSLTSEDSAVYYCAR
Cricetulus griseus V343 ighv AMDS01119830.1 4281 VHCEGQLVESGGGLVKPAGSLKLYCAASGFTFSDAAIYWEGQAPGKGMEWVASIRSKSYNYATYYLDSVKGRITISRDDSQSMVYLQMNNLRTEDTATYYCTA
Cricetulus griseus V344 ighv AMDS01120563.1 2351 VQCEVKLVESGGGLVKPGGSLKLSCAASGFTFSDYWMTWFCQAPGKRLEWVGEINKDSSTTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCA
Cricetulus griseus V345 ighv AMDS01120565.1 1908 VHSQILLHQSSAELVKPGASVKLSCKASGYTFTSHYMSWVKQKPRQGLEWIGWIDPGNSGTGYNLNFQHKATLTVDTSSSTAYMELSSLTFEDSAVYYCA
Cricetulus griseus V346 trav AMDS01120642.1 8975 TWSLAKTTQPLSMDSYEGQEVNVSCSHTNIATNEYIYWYRQVPHQGPQFIVQGYKVHVSNEWASLFISADRKFSTLSLPWVSLRDTGVYYCIVA
Cricetulus griseus V347 trav AMDS01120643.1 462 VSRGEQLEQQPSLLSVQEGGGIFINCTYKATAPSFFSWYKQEPGAGLQLLIKILSNVDRKEEQGLIVLLNKKDKRLSLNITAAHPGDSATYFCAES
Cricetulus griseus V348 trav AMDS01120643.1 4016 GVKGMQVEQNPPSLSLQEGAGSALRCNFSLTMTNAQWFRQNPGGSLIRLFFMTPGTKENGRLKSIFDSKERYSTLHIRNAQLEDSGTYLCAAD
Cricetulus griseus V354 trdv AMDS01121111.1 23556 KDALCITLTQDSSDKTVTSGSQVTLFCTYDVNFYNLDLFWYRKRQDLSFQFILYRDDTRSHDAEFVQGRFSVKHSKVYRTFHLVINPVWLEDSGTYYCALG
Cricetulus griseus V356 igkv AMDS01121211.1 11914 SKGEIVLTQSPGYMTASNGEKVIITCRASSSISANYFHWYQQKPGASPKLLVYSTSYLAAGVHGSFIGSGSETTYSLTISCMQAEDAATYYCQQGSTS
Cricetulus griseus V357 igkv AMDS01121215.1 858 VKCDIQMTQSPDILSASLGESVTITCQSSQSIYSNLAWYQQKPGEHPKLLIYAASNLADGIPSRFSGSGSGTQYSLKISSLQPEDVANYYCQQGYSYP
Cricetulus griseus V364 igkv AMDS01122420.1 3927 ICADIVMTQSPTSLAVSAGEKVTISCKSSQSLYSSTYQVNYLAWYQQKPGQAPKLLIYYASTRHTGVPDRFTGGGSGTDFTLSISSVQAEDLGDYYCVKHYRS
Cricetulus griseus V372 igkv AMDS01124597.1 9179 ACADIVMTQTPSFLAVSAGERATISCKSSQSLLSSANQKNYLNWYQQKAGQSPKLLIYLASTRYTGVPDRFTGSGSGTDFTLTISNIQAEDMADYYCMQDYSAP
Cricetulus griseus V373 ighv AMDS01124637.1 3002 VLSQIQLQESGPGLVKPSQSLSLTCSVTFFSITTSDSYWRWIRQFPGKKLEWMGNIGYAGSTDYNPSLKSRISITRDTAKNLIFLQLNSVTTEDTATYYCAR
Cricetulus griseus V374 ighv AMDS01124641.1 3601 VLSQIQLQESGPGLVKPSQSLSLTCSVTGESITSYYWHWIRQFPGKKLEWMGYINYVGSTNYNPSLKSRISITRDTSKNQVFLQLNSVTTEDTATYYCAR
Cricetulus griseus V376 ighv AMDS01124851.1 3088 VLSQVTLKESGPGLLQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWNDNKYYNPSLKSRLTISKDTSNNQVTLMIASVDPEDTATYYCART
Cricetulus griseus V377 ighv AMDS01124857.1 1172 VQCDMQLVESGGGIIRPGGSLKLSCAASGFTFSDYYMSWFCQPPGKGLEWVAESRNKANSYTTQYNASVKGRFTISRDNSKSILYLQMDSLKPEDTATYYCVRD
Cricetulus griseus V378 ighv AMDS01124858.1 1193 VQCEVQLVESGGGLVKPVGSLKLSCAASGFTLSGYWMYWLRQALGKGLEWVGEINKDSSYTRYAPSMKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCSR
Cricetulus griseus V379 ighv AMDS01124859.1 1513 VHSQVQLQQSGAELVKPGSSVKLSCKTSGYTFTDYFMHWVKQRPGKGLEWIGRIDPEDGETRYNQKFQGKATLTADKSSSTAYMELRSLTSEDSAVYYCTIYS
Cricetulus griseus V380 ighv AMDS01124859.1 8065 VLSQIQLQESGPGLVQPSQLLSLTCSVTGDSITTSGYGWHWIMQFPGKKLEWMGNIVYSGSTGYNPSLKSRISITRDTAKNRFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V392 igkv AMDS01128535.1 11322 ARCDTQMTQSPASLSASLGDSVTITCQSSQDIYGNLAWFQQKPGKAPKLLIYTTSSLSHGVPPRFSGSGYGTQYSLKISSLQPEDIASYFCLQYSYVP
Cricetulus griseus V393 igkv AMDS01128544.1 4749 SISDAVMTQTPLSMPVSFGDSVSISCKSSQSLVHSNGNTYMNWLLQKPGQSPELLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVDPEDLGIYYCLQH
Cricetulus griseus V396 ighv AMDS01129133.1 3861 VLSQMQLQDSGPGLVKPSQTLSLTCSVTGFSITTIVYEWNWIRQFPGKKLGWMGYITSPGGTNYNPSLKSPISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V397 ighv AMDS01129134.1 1869 DHSQVKLQPSEAELVKPGTSVKLSCKTSGYTFIYEYIHWVKQKPGQSLEWIGITVPGIGITNYGQKFQGKATLTADTSSSTAYMELSSLTSEDEYSAVYYCT
Cricetulus griseus V401 ighv AMDS01130586.1 4763 VLSQVSLKESGPGVFPPSQDLTLTCSFSGFSLSTSGMGVGWVCHPSGKGLEGLAIIYWDDNKRYNPSLKSWLTISKDTSNNWVTLKITSVDTADTATYYCAR
Cricetulus griseus V402 ighv AMDS01130587.1 16 VHCEVQLVESGGGLVKPARSLKLSCAASGFTFSGAWMNWVRQAPGKGLEWVASIDPKSYNYATYYSDSVKDRFTISRDDSQNMVYLQMNNLRTEDTATYYCTR
Cricetulus griseus V403 ighv AMDS01130590.1 594 VHCEVQLVESGGGLVKPGASLKLSCAASGFTFSDYWMHWVRKTPGKGLEWVGEINYDGSTTNYAPSVKGRFTISRDNAKNTLYLKMNSVKSEDTATYHCVR
Cricetulus griseus V404 ighv AMDS01130590.1 6729 VLSQIQLQESGPGLVKPSQSLSLTCSITGFSITTSGYYWSWFRQFPGKNLEWMGNIGYAGGTNYNPSLKSRISITRDTAKNQFFLQPNSVTTEDTATYYCAR
Cricetulus griseus V406 ighv AMDS01131481.1 7173 VLSQVQLQESGPGLLKPSQSLSLTCTVTGYSISSGYWWHWICQRPGKRLEWMGRIYNNGNTYYNPSLKSRITMTVDTSKNQFSLTLSSVTTEDTAVYYCA
Cricetulus griseus V407 ighv AMDS01132324.1 290 VQCEVQLVESGGGLVQPGKSLKLSCEASGFTFSDYTMHWFRQAPGKRLEWVAYINSGSSDINYADAVKGRFTISRDNAKKTLFLQMNSVKSEDTATYYCAR
Cricetulus griseus V420 igkv AMDS01136876.1 11817 ICGDIMMTQSPSSAAVSEGERVSINCKASQNLFGSKTKKNRLVWYQQKAGQSPKLLIYWGSTRHTGVPDRFVGTGSETDFTLTISSVQAEDMGDYYCLQDHTSP
Cricetulus griseus V427 igkv AMDS01138989.1 8214 ICGDIVMTQSPSSVSVSAEERVSINCKASQNLFGSDTKKNHLAWFQQKPGQSPKQLISWASTRLTGVPDRFIGSGSQTDFTLTISSVQAEDMAHYYCMQ
Cricetulus griseus V428 igkv AMDS01138994.1 995 ACTDIMMTQSPFSLAMSAGEKATISCKSTQNPFNSNTKKYHLNWYQQKAGQSPKLLIYYASTQNTGVPDHFIGSGSGTDFTLTINNIQAEDLADYYCQQWYSYP
Cricetulus griseus V429 ighv AMDS01139531.1 176 VHCEVKLVEAGGGLGKPAGALKLSCAASGFTFSAAWMNWVRQAPGKGVEWVANINTKPNNYATYYSDSVKGRYTISRDDFQSMAYLQMNNLGTEDTATYYCTA
Cricetulus griseus V430 ighv AMDS01139534.1 4504 VQCEIQLQESGSKLVRPGSSVKVSCKVSGYNIIEYYMHWVKQKTGQGLEWMGSFNPRTGSTNYAQKFQGRVSMTSDTSSSTAYMEFSSLTSEDSAVYYCAR
Cricetulus griseus V431 ighv AMDS01139603.1 14 VLSQVQLQESGPGLLKPSQSLSLTCIVTGYSISSGYWWSWIRQHPGKGLEWMGKIDRDGDTYYNPSLKSRITMTVDTSKNQFSLRLNSVTTEDTAVYYCAR
Cricetulus griseus V433 ighv AMDS01140426.1 75 VHCEVQLVESGGGLVKPAGSLKLSCVSSGFTFSNYFMNWVRQAPGKGLEWVAQIDTKSYNYATYYADSVKGRFTISRDDSQSMAYLQMNNMRTEDTATYYCAS
Cricetulus griseus V435 igkv AMDS01140861.1 8683 SRGDVVMTQSPSSLSVSLGEQVSISCKSSQSLVHNNGNTYLEWYLQKPGQSPKLLVYKVSNRFSGVPDRFSGSGSGTDFTLKISRMEPEDFGVYFCFQGSHA
Cricetulus griseus V436 ighv AMDS01140882.1 1798 VLSQVQLKESGPGLVKPSETLSLTCTVSGISLTSCDVHWVRQPPGKGLEWMGVVWASGNTKYNSALQSRISISRDTSKSQVFLKLNSLQHEDTAMYYCA
Cricetulus griseus V437 ighv AMDS01141335.1 1916 VYSQVELQQSGPQLVKPGFSVKSCQVSDIIFMDYYVSWVKQRPGQGLEWVGGIDLENGDTDYNQKFQGKATITVDTSSSTAYMELSRLTSEDSAVYYCA
Cricetulus griseus V438 ighv AMDS01141337.1 10 VLSQVTLKESGPGLLQPSQDLSLTCSFSGFSLSTDGMGVGWICQPSGKGFEWLANIWWDDVKRYTPSLKSRLTISKDTSNNWVTLKIASVDTADTATYYCAQR
Cricetulus griseus V439 ighv AMDS01141338.1 1819 VHSQVHLQQSGPELVKPIASVMLSCNTTGYTFTDHVMHWVKQKPGQGLEWIGYFYPYTGNTGYAQNFKGKATLTADTSSITAYMELSSLTSEDSAVYYCTR
Cricetulus griseus V440 ighv AMDS01141391.1 4331 VYCEVQLVECGRGLVQPGKSLKLSCAASGFTFSDYWMGWVCQVPGKGLECIAEINGDSGTTKCAPSLKDRFTISRDNAKNTLYLLMNSVKSADIATYYCAI
Cricetulus griseus V445 trav AMDS01144336.1 1367 LSQGEQVEQLPSTLRVQEGDSAVINCTYTDSTSNYFLWYKQGHGEHPKLIIDIRSNVERKQDQRLIVLQNKKAKHFSLHITDTQPGDSVMYFCAAS
Cricetulus griseus V446 ighv AMDS01144571.1 6734 VHCEVQLVESGGGLVKPAGSLKLSCTASGFTFTDYAFHWVRQAPGKGLEWVARIRSKRNNYTKNYADSVTGRFTISRDNSQSMVYLQMNNLRTDDTATYYCTT
Cricetulus griseus V447 igkv AMDS01144691.1 810 ACADIVMTQSPPSLTVSAGEKATVSCKSSQSLFNSNTNKNHLNWYLQKPGQSPKLLIYLASTRHTGVPDRFKGSGSGTDFTLTISSVQDEDLGDYYCQQWYSSP
Cricetulus griseus V448 ighv AMDS01144738.1 153 VQCEVQLVESGGGLMRPGRSLQLSCSASGFTFSDYWMDWVREAPRKGLEWGSEINGDSSDTKYVPSLKDRFTISRDNAKSTLYLQMNNVNLEDTATYYCARP
Cricetulus griseus V449 ighv AMDS01145417.1 1552 VHSQVQLQQSGAALVKPGSSVKLSCKASGYTFTSNYMSWVKQKPGQGLEWIGNIFPAFDIIGYGQKFKATLTADTSSSTAYMELSSLTSEDSAVYYCER
Cricetulus griseus V453 ighv AMDS01147226.1 77 VQCEVHLVESGGSLVKPGGSLKLSCAASGFTFSNYWMGWVRQAPGKGLEFVGEIKYDGSYTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V454 ighv AMDS01147947.1 119 VHCEVQLVESGGGLVKPAGSLKLSCSTSGFTFTDYGMSWIRQAPGKGLEWVARIDSKSYIYATDYVDSVKGRFTISRDDTQSMAYLQMNNLRTEDKTTYYCTA
Cricetulus griseus V455 igkv AMDS01148723.1 4667 SRGDAVMTQTPPSLTASLGDQVSISCRSSQSLVLSDGNTYLHWYLQKPGQSPKLLTYRVSNRFSGVPDRFSSSGSGTDFTLKISKMEPEDFGVYYCFQE
Cricetulus griseus V456 ighv AMDS01148905.1 71 VLSQVQLQESGPGLLKPSQSLSLTCTVTGYSISSSYWWHWIRQHPGKGLEWMGDIYNNGNTYYNPSLKSRITMTVDTSKNQFSLRLNSVTTEDTAVYYCSR
Cricetulus griseus V457 ighv AMDS01150401.1 95 VHCDVQLVEYGGGLVKPVGSLKLSCAASGFTFSDYWMNWVCQAPGEGLEWVGDINKDGSTTNYAASVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCV
Cricetulus griseus V458 ighv AMDS01151176.1 4191 CVFKKKVQLVESGGGLVKPGGSLKLSCAASGFTFSSSGMHWFRQAPGKGLEWVGIIYYDSSTIKYAPSVKDRFTISRDNAKYTLYLQMNSVKSEDTATYYCA
Cricetulus griseus V463 ighv AMDS01155277.1 417 VHSQVKLQQSVAELVKPGASVKLSCKTSGYTFIYEYIHWVKQKPGQGLEWIGNFFPNTGYTDLNQKFKGKAKLTADKSSSTAFMELRSLTSEDSAVYYCTIYS
Cricetulus griseus V464 trav AMDS01155296.1 9142 LSKGEQVEQLPFTLRVQEGDSAVINCTYTDSTSYYFLWYKQEPGEHPKLIIDIRSNVERKQDQRLIVLQNKKAKHFSLHITDTHPGHSAMYFCAAS
Cricetulus griseus V466 igkv AMDS01159974.1 445 ACADIVMTQSPPSLTVSAGEKATISCKSSQSLFSSNTKKNYLNWYLQKPGQSPKLLIYLASTRHTGVPDRFIGSGSGTDFTLTISSVQDEDLADYYCQQWYSFP
Cricetulus griseus V467 ighv AMDS01160291.1 168 DLSQIQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYWIWIGQSRGKKLEWIGYITHSGDAVYNPSMRSPISITRETSKNQFFLQLNSVTTEDTATYYCAQ
Cricetulus griseus V471 igkv AMDS01187069.1 48 ARCDIQMTQSPSSLSASLGDTGTITCRASQEIYSLSWYQQKPGNPPKLLIYGINILEDGVPQRFSGSGSGTQFSLKISSLQAEDIAAYYCQQGSYYP
Cricetulus griseus V472 igkv AMDS01189908.1 61 SRGDAVMTQTPPSLTASLGDQVSISCRSSQSLVLSDGNTYLHWYLQKPGQSPKLLTYRVSNRFSGVPDRFSGSGSGTDFTLKISKMEPEDFGVYYCFQE
Cricetulus griseus V473 igkv AMDS01190427.1 63 ARSDIQMTQSPSMLSASLGETVTITCLASQNINGYLAWYQQKQQGRPNLLIYGATSLAVGVPPRFSGSGSGTQYSFKINSLQAEDAGIYFCHQGDSTP
Cricetulus griseus V474 igkv AMDS01191813.1 46 TRCDILMTQLPSQTVSLKDPVTITCQASQSIGSALAWYQQKPGKSPNLLIYYAKGLVDGVPSRFSGSGSGTDFTLTISSLEPEDIATYYCQQHNNN
Cricetulus griseus V475 igkv AMDS01194548.1 543 GKCDIQMTQSPSTLSASMGDSVTISCHASQNINSWLSWHQQKPGDAPKLLIYKTSSLHTGIPSRFRGSGSGTDYSLTIINVQPEDIATYYCQQDQSIP
Cricetulus griseus V476 igkv AMDS01194788.1 475 VTGNTVTQSPAFLSLSLGETTTLSCRSSENIGRYLAWYQQKPGQVPRLLIYDSSNRVSDVPARFSGSGSGTDFTLTISRLEPEDVAVYYCETYKSWS
Cricetulus griseus V478 igkv AMDS01195904.1 1304 TSCDIQLTQLPSSLSASPGDKVTITCKASQNINQYLHWYQQKPDEAPKLLIYSASNLQTGIPSRFSGSGSGTDFSLTINSLDSEDVGTYFCQQGY
Cricetulus griseus V480 ighv AMDS01197191.1 2403 VHSQVQLQQSGAELRKPGSLVKLSCKASGYTFTSNYMHWVKQKPGQGLEWIGRIDPADGETIYNQKFQGKATLTADTSSSTAYMELSTLTSEYSAVYYCAR
Cricetulus griseus V481 ighv AMDS01197196.1 1876 VQCEVKLVESGGGLVKTGGSLKLSCVASGFTFSGYWMDWVRQAPGKGLEWVGNIKYDGSTTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCA
Cricetulus griseus V482 ighv AMDS01197197.1 2095 VLSQVTLKESGPGLVQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLSDIWWDDDKRYNPNMKSQLTISKDTSNNQVFLKIASVDTADTATYYCARR
Cricetulus griseus V515 trbv AMDS01213342.1 289 AGAQTIRQWPASRVQPVGSPLSLECTIKGQSNPNLYWYWQATGGPLQQLFFSISVGNVESVVSRNLSASRPQDGQFTLSSEKVLLSHTGFYFCAWS
Cricetulus griseus V562 ighv AMDS01010280.1 8354 IHCQILLHQSSAELVKPGASVKLSCKASGYTFTSHYLSWVKQKPRQGLEWIGWIDPGNSGTGYNQNFQHKATLTVDTSSSTAYMELRGLTSEDSAVYYCAR
Cricetulus griseus V563 ighv AMDS01010280.1 4441 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITSVYYWSWIRQFPGKKLEWMGYIDNSGGTYYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCA
Cricetulus griseus V564 ighv AMDS01010280.1 1415 VQCEVKLVKSGGGLVQPGKSLKLSCAASGFTFSNAWMNWVLQAPGKGLEWVAEIRDKSNNYATSYRESVRGRFTISREDSQSSVSLQMNSLRAEDTAIYFCSA
Cricetulus griseus V565 ighv AMDS01010284.1 1424 VYCGVKLVESGGGLVKPAGSLKLSCVASGFTFSAAWMNWVRQAPGKALEWVAHIEPKSYNYATYYLDLVKGRFTISRDDSQSMVYLQMNNLRTEDTATYFCTR
Cricetulus griseus V566 ighv AMDS01010285.1 2302 AAGRVGGSLGEAWKVPETLLCSLWIHFSDYWTNWVCRAPGKGLEWVAQIRNKDYNYATYYGESVKGRFTNSRDDSKSSLYLQMNNLGAEDTAIYYCA
Cricetulus griseus V567 ighv AMDS01010286.1 10835 VHCEVQLVESGGGLVKPAGSLKLSCVASGFTFTDYAMFWVCQAPGKGLEWVASISTKSYNYATYYSDSVKGRFTISRDDSQSMAYLQMNNLRTEDTATYYCTR
Cricetulus griseus V568 ighv AMDS01010289.1 1075 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSISTSSYWWNWIRQFPGKKLEWMGYIHSGVTDYNPSLKSRISITRDTAKNQIFLQLNSVTTEDTATYYCAR
Cricetulus griseus V613 ighv AMDS01027489.1 1620 VQCEVQLVESGGGLAQPGSSLKLSCAASGFTFTNAWMSWVRQAPGKGLEWVAQIKNKGYNYATHYGNSVSGRFTISGDNSKSSVYLQMNNLRAEDTAIYFCAA
Cricetulus griseus V654 iglv AMDS01042299.1 13872 SFSQPVVTQSPSASASLGASVKLTCTLSSQHSTYYIEWYQQHPDKAPKYVMGLNSDGSHNKGDGIPDRFSGSSSGAHRYLSISNILPEDEADYICGSDYSGG
Cricetulus griseus V655 iglv AMDS01042301.1 1281 SFSQLVLTQSPSASASLGASIKLSCTLSSQHSTYNIGWLQQHPDKAPKYVMYLKSDGSHSKGDGIPDRFSGSSSGADRYLSISNIQSEDEADYYCVSADSDG
Cricetulus griseus V656 iglv AMDS01042305.1 6772 SFSQLVLTQSPSASASLGASIKISCTLSSQHSTYSIGWLQQQPDKAPKYVMYLSSDGSHNKGDGIPDRFSGSSSRAHRYLSISNIQSEDEADYYCVSADSNG
Cricetulus griseus V657 iglv AMDS01042306.1 6414 SFSQSVLTQSPSASASLGASVKLTCTLSSEHSSYTIYWYQQHPDKAPKYVMYLNNDGSHSKGDGIPDRFSGSSSGAHRYLSITDLQPEDEAIYHCGIYDGSGG
Cricetulus griseus V658 iglv AMDS01042309.1 9118 SFSQLVLTQSPSASASLGASVKLTCTLSSQHSTYRIEWYQQHPDKAPKYVMYLRSDGSHSKGDGIPDRFSGSSSGAHRYLSISNLQPEDEAIYYCGVSENSL
Cricetulus griseus V659 iglv AMDS01042317.1 11542 SMALYTLTQPPLVSVALGQTATITCSGDKLSDKSVHWYQQKTGQAPVMVIYRDSNRPSGIPDQFSGSNSGNMATLTISKAQAGDEADYYCQCWD
Cricetulus griseus V660 iglv AMDS01042324.1 1674 SFSQPVLTQSPSASASLGNTVKITCTLSSQHSTYTIGWFQQHPDKAPKYVMYVKSDGSHGKGDGIPDRFSGSSSGAHRYLSISNIQSEDEADYYCGSGDSSG
Cricetulus griseus V730 trav AMDS01076090.1 19353 VKGQKVEQSPVSLVLQEGERAELQCNFSTNLYQMQWFHQSPGGHLISLFSNPSGTKQRGRLTSTTVTQERHSSLYISSSQTTDSGTYFCAMDAQCS
Cricetulus griseus V731 trav AMDS01076091.1 56537 VSSQQKVQQTPESLSVPEGAVASLNCTFSDSASWNFWWYRQHPGKGMELLVSIMSNGEKEEGRFTAHLNKASLHLSLHIRDSQTSDSAVYLCAV
Cricetulus griseus V732 trav AMDS01076091.1 49632 VNSLQGEENPWTLSIQEGESVTMNCSYKTSIEALQWYRQDSGKGPAVIILIRSNEKKKQSGRVRVTLNTSTQSSSLSIIAARPEDTAAYFCATE
Cricetulus griseus V733 trav AMDS01076091.1 41362 DVQAQSVSQADAHVTIFEGDSVELRCNYSYGGASYLFWYMQRHGHSLQFLLKYISGDPVVQGMNGFEAEFRKSDSSFHLKKASVHLRDSAVYFCALS
Cricetulus griseus V734 trav AMDS01076091.1 32222 ESLGEQVEQQPSTLSVQEGDSAIINCTYTGSAFSYFSWNKQEAGESPQLIIDILENVDRKQSQRLTVLLNKKTKQLSLHISATQPGDTAMYFCAVR
Cricetulus griseus V735 trav AMDS01076091.1 24441 RTHGDSVTQTGGQMTISEDEFLTINCTYSITSTAYPALCWYVRYPGESLQLLLKVLTAGEKGSSRGFEATYDKGSKSFHLQKASVQESDSAEYYCAVG
Cricetulus griseus V736 trav AMDS01076091.1 15243 VNSQQKVQQNPESLIVQEGAMASLNCTSSDRSNSDYFWWYRVHPGKGPKALMSIFSNGKKEEGRFTAHLNKASLHLSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V737 trav AMDS01076091.1 8584 KINGDSVTQTEGLVTVTEGSPVMLSCAYQTTYSAPTVFWYVQDLNKAPQLLLKSLTDNKRTEHQGFHATLHKSNSSFHLQKSSVQLSDSALYYCALS
Cricetulus griseus V738 trav AMDS01076093.1 26015 SFAGDSRAQSVTQPQARITITEEASLQLRCNYSSSVVPYLFWYVQYPRQGLQLLLKYYSGEPVVHGLSGFEAEVSKSDSSFHLKKASVHLSDSAVYFCALS
Cricetulus griseus V739 trav AMDS01076093.1 18576 LSRGEQVEQLPSTLSVQEGDSAVINCTYTDSFSSYFPWYKQGHGEHPKLIIDIRSNEERKQDQRLIVLLDKKAKHFSLHITDTQPGDSAMYFCAAS
Cricetulus griseus V740 trav AMDS01076093.1 3464 LSRGEQVEQLPSTLSVQEGDSAVINCTYTDSASDYFPWYKQGAGEHPKLIIDIRSTMERKQDQRLIVLQDKKAKHFSLHITDTQPGDSAMYFCAAS
Cricetulus griseus V741 trav AMDS01076095.1 17671 VSSQQKVQQTPESLSVPEGAMASLNCTFSDRASQYIWWYRQHPGKSPKALMYVISNGEKEEGRFTAHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V742 trav AMDS01076095.1 12182 KINGDSVTQTEDLVTVSEGSPVMLSCTYQTTDSAPTVFWYIQYLSKAPQLLLKSFTDNKRTEHQGFHATLHKTNSSFHLQKSSVQLSDSALYYCALS
Cricetulus griseus V743 trav AMDS01076096.1 13888 ESQGEKVEQLPSILSVQEGASAAINCTYTDSAAVYFPWYKQEPGKHPQIIIDIRSNVERKQSQRLTLLLDKKDKQLSLYITDTQPGDSAIYFCAAD
Cricetulus griseus V744 trav AMDS01076096.1 7888 RTDGDSVTQKQGQVTLSEDDFLFINCTYSTTSYPTLFWYVQYPGGGPELLLKVTTANNKGSSRGFEATYDQGSTSFHLQKASVQESDSAVYYCALS
Cricetulus griseus V745 trav AMDS01076098.1 431 VSSQQNVEQTPESLSVPKGAMASLNCTFSDQNSLYFWWYRQYPGKGPKALISIFSNGEREEGRFTAHLNKASLHISLHIRDSQPSDSAVYLCAV
Cricetulus griseus V746 trav AMDS01076099.1 27670 RTDGDSVIQKQGQVTLSEDDFLFINCTYSTTLYPALFWYVQYPGGGPELLLKVTTANNKGSSRGFEATYDQGSTSFHLQKASVQESDSAVYYCALG
Cricetulus griseus V747 trav AMDS01076099.1 22357 VSSQQKVQQTPESLSVSEGAMASLNCTSSDQNFQYFWWYRQYPGKGPKALVSIFSDGKKEEGKFTVHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V748 trav AMDS01076099.1 14206 GVKGMQVEQNPSALSLQEGASSALKCNFSTTMRSVQWFRQNSLGSLISLFYLAPGTKDNGRLKSTFDSKERYSTLHIRDAQLEDSGTYLCAAE
Cricetulus griseus V749 trav AMDS01076099.1 729 GTDGDSVTQKQGQVTLSEDDFLLINCTYSATGYPTLFWYVQYPGKGLELLLKVTTANNKGSSRGFEATYDQGSTSFHLQKASVQESDSAVYYCALS
Cricetulus griseus V792 ighv AMDS01091472.1 1195 VHSQGHLQQSASELRAPGAAVQVTCKDSDPNDFPIACMNWVRQKPGHGLEWIGNILPSIGRTNYAQTFEDRATLTADTQLNTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V793 ighv AMDS01091484.1 1206 VHSQVQLQQSGPELVMPGASVKISCKTSGYTFTIGYMHWVEQKPGQGLEWIGRIDPDSGNTQYNQKFQGKATLTREKSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V794 ighv AMDS01091492.1 535 VLSQVTLKESGPGLLQPSQTLSLTCSFSGFSLSTSGMGVGWIQQPSGKGLEWLAYIWWNDDKYYNPSLKSQLTISKDTSNNPVTLRITSVDTEDTATYYCA
Cricetulus griseus V796 iglv AMDS01092680.1 15259 LCAQFVLTQPKSVSESLGRTVTISCKRSSGNIGDYYVNWYQQRFGSSPQTVIYEHNKRPSGVPDRFSGSIDRSSNSASLTITDLQSEDEADYFCSSYDNND
Cricetulus griseus V797 iglv AMDS01092680.1 1365 SCAQFDLTQPKSVSESLGRTVTISCKRSSGNIGSSYVHWYQQHFGSSPKTVIYEYNKRPSGIPDRFSGSTDSSSNSASLTITDLQIEDEADYFCQSYSSGF
Cricetulus griseus V798 iglv AMDS01092689.1 23277 SCAEVVFTQPQSVSGSLGQEISISCTRSSGSIGSNYVHWYQQHSSNKPRLLIYRYDQRPSSIPDRFSGSKDTSSNSGILTISRLQPEDEGDYYCLSSYDSY
Cricetulus griseus V799 iglv AMDS01092704.1 33558 TISQAAVIQESSLTTSPGGTVTFTCASRTGAVTTSNYANWVQEKSHQVHTGLIGGTTYRAPDVPARFSGSLIGDKAALTITGAQPEDEAIYYCALWYSDQ
Cricetulus griseus V800 iglv AMDS01092704.1 1966 AISQFAVIQESSLTTTPGGTVTLTCGSSTGAVTTNNYANWVQEKSQEVHTGLIGGTSNRVPGVHARFSGSLLGDKAALTITGAQPEDEAVYYCAL
Cricetulus griseus V801 iglv AMDS01092705.1 9213 GISQAIVIQASSLTTSPGGTVTLTCGSSTGAVTTNNYANWVQEKPNQVHTDMIAATSRRATGVPAQFSGSLLGDKAALTITGAQPEDEGIYYCALWNGDH
Cricetulus griseus V805 igkv AMDS01094462.1 2584 SSCDIQLTQSPSQTVSLKDTVSINCQVSQRLSRTLSWYQQKPGQSPKLLVYEASSWSPGVPSRSSGSESGTDFTLSTSSLEPEDIGTYYCQQYWSY
Cricetulus griseus V811 ighv AMDS01096736.1 456 VTTQIQLVQSGAELKQPGQSVKISCKASGYTFTQYAMNWVKQAPGQDIKWMGWINTETGNPTYADDFTGRFVFSLDTSVSTAYLQISSLKNEDTVMYYCA
Cricetulus griseus V812 ighv AMDS01096737.1 8747 VHCQVQLQQSGAELGKPGASVKLSCKASGYNFIAYYMYWMKQRPGQGLEWIGRIDPEYDNTNYNKKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V828 ighv AMDS01103111.1 11120 VQCEVKLVESGGGLVKPGGSLKLSCAASGFTFSSYWMSWVRQAPGKGLEWVGDISTSGSTTNYASSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V829 ighv AMDS01103111.1 7007 QLQQSGAEMRKPGASVKVSCKTSGYTFTEYTMHWVKQKPGQGLEWIGYVYPYNGNTKYNQKFQGKATLTADKSSSTAYMELSSLTSEDSAVYYCA
Cricetulus griseus V830 ighv AMDS01103113.1 738 VQCEEKLVESGGGLVKPGGSLKLSCAVSGFTFSNYRMNWVCQAPGKGLEWVAEISTSGSTTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCLE
Cricetulus griseus V831 ighv AMDS01103114.1 3682 VQCEVQLVESGGGLMRPGGSLQLSCAASGFTFSDYWMDWVRQAPGKGLEWVAEINGDSSDTKYAPSLKDRFTISRDNAKITLYLQMNSVKSEDTATYYCTRP
Cricetulus griseus V832 ighv AMDS01103116.1 3181 VLSQVTLKESGPGLLQPSQTLSLTCSFSGFSLSTSGIGVSWIRQPSGKVLEWLSDIWWNDEKYYNPSLKNRLTISKDNSKNQVLLKVTSMDTADTATYYCSQR
Cricetulus griseus V833 ighv AMDS01103117.1 3201 VRCEVKLVESGGGLVKPGGSLKLSCAASGFTFSDYWMSWFRQAPSKGLEWVAEINGDSSTTKYAPSVNGRFTISRDNDKNTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V834 ighv AMDS01103127.1 1559 VLSQIQLQESGPGLVKPSQSLSLTCSITGFSITTSGYNWNWIRQFPGKKLEWMGYIDNGGTYYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAG
Cricetulus griseus V835 ighv AMDS01103132.1 3567 VHSQVQLQQSGAELVRPGVSVKVSCKASGFTFSSYTMHWVKPRPGQGLEWIGWIYPGDGDTGYNQKFQSKDTLTADTSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V836 ighv AMDS01103135.1 3532 GLLKPGGSLNLSCAASGFTFSDRYMNWVCQAPGKGLEWVGDINQDSSTTYYSPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCVRDSE
Cricetulus griseus V851 ighv AMDS01107814.1 1258 IQGEIQLQQSGSQLVRPGSSVKVSCKVSGYNIIEYYMHWVKQKPGQGLEWMGRLNPRTGSTNYAQKFQGRVSTTSDTSSSTAYMELSSLTSEDSAVYYCVR
Cricetulus griseus V852 ighv AMDS01107858.1 14541 VQCEVQLVESGGGLVQPGKSLKLSCAASGFTFSGAWMNWVCQAPGKGLEWVAQIRIKPDNYATYYGESVKGRFTISRDNSKSSLYLQMNSLRAEDTAIYYCA
Cricetulus griseus V853 ighv AMDS01107858.1 2068 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITTSGYGWSWIRQFPGKKLEWMGYIGYDGGTDYNPSLKSRISITRDPAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V854 ighv AMDS01107860.1 629 VQCEVQLVESGGGLMQPGKSLKLSCAASGFTFSDYWMDWVRQVPGKGLEWVAQIGNKGYNYVTYYGESVSGRFIISRDDSKSSLYLQMNSLRAEDTAIYYCAR
Cricetulus griseus V859 ighv AMDS01109077.1 483 VLSQIQLQESGPGLVKPSQSLSLNCSVTGESITSSYEWSWIRQFPGKKLEWMGNTVNGGTDYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCA
Cricetulus griseus V860 ighv AMDS01109084.1 10898 VLSKVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYDCIWIGQFPGKKLEWMGYITHSGDAVYNPSMRSPISITRDTAKNRFFLQLNSVITEDTATYYCAR
Cricetulus griseus V861 ighv AMDS01109085.1 1458 VQCEVQLVESGGGLVKPGGSLKLSCVASGFTFRDYWMYWFHQAPSKGLEWVGEIKYDGSTTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCV
Cricetulus griseus V863 ighv AMDS01109697.1 1477 VQCEVQLVESGGGLVQPGKSLKLSCEASGFTFSSYDMDWVRQAPGKGLEWVAYISSGSSYINYANAVKGRFTISRDNAKNLLFLQMNSMKSEDTATYYCA
Cricetulus griseus V869 ighv AMDS01110330.1 1755 IHSQVQLLQSGAELVKPGASVKLSCKTSGYTFTSYYIEWVKQRPGHGLEWIGSIDPEDDETDYAQRFQGKATLTADTSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V870 ighv AMDS01110336.1 766 ALSQVTLKESGTGLLQPSQTLSLTCSFSGFSLSTSNMGVGWICQPSGKGLEWLAIIYWDDDKYYNPNLKSRLTISKDTSNNQVFLKTASVDTADTATYYCARG
Cricetulus griseus V877 ighv AMDS01113899.1 972 VQCEVQLVESGGGLVQPGKSLKLSCAASGFTFSDAWMNWVRQAPGKGLEWVAQIGTKGNNYVTYYVESVKDRFTISRDDSKSSLYLQMNILRAEDTAIYYCTR
Cricetulus griseus V878 ighv AMDS01113901.1 1356 VQGEIQVQQSGSQLVRPGSSVKVPCKVSGYNIIEYYMPWVIQETGQRLEWMGRLNPRTGSTNYAQKFQGRVSMTSITSSSTAYMELNSLTSEDSAVYYCAR
Cricetulus griseus V882 ighv AMDS01114735.1 10583 VQCEVQLVESGGGLVQPGKSLKLSCEASGFTFSSFGVNWVRQATGKELEWVASISNDGSNNYYANAVKGRFTISRDNAKNTLFLQMNSVKSEDTATYYCAR
Cricetulus griseus V883 ighv AMDS01114737.1 444 GQCEAQLVESGGGLVQPGMSLKLSCAASGFTFNSYWMNWVRQAPGKGLEWVARINENSGTINYADAVKDRFTISRDNAKNALYLQMNNLKSEDTASYYCAR
Cricetulus griseus V884 ighv AMDS01115338.1 13382 VLSQIQLQESRPGLVKPSQSLFLTCSVTGYSITSGYYRIWIRQSRGKKLEWMGYITHSGDAVYNPSMRSPISITRETSKNQFFLQLNSVTTEDTATYYCAG
Cricetulus griseus V885 ighv AMDS01115342.1 627 VQCEVQLVESGGGLVKPGGSLKLSCAASGFTFSDYWMDWVRQAPGKGLEWVGNFKYDGSYTSYAPSVKGRFTISRDDAKNTLYLQMNSVKSEDTATYYCSI
Cricetulus griseus V886 ighv AMDS01115346.1 980 VHSQVQLQQYGPELVRPGASVKISCKTSGYTFTDGYMQWVEQKPGQGLEWTGRIDPDSGNTKYNQKFQGKATLTRDKSSRTAYMELSSLTSGDSAVYYCAR
Cricetulus griseus V887 ighv AMDS01115348.1 12769 VHSQVQLQQSEAELVKPGASMKLSCKTSGYTFIYEYIHWVKQKPGQGLEWIGCFFPNTGYTDLNQKFKGKVKLTADKSSSTAFMELRSLTSEDSAVYYCATHS
Cricetulus griseus V888 ighv AMDS01115352.1 1277 VHSQVQLQQSGAELVKPGSSLKLSCKTSGHTFTSYLMSWVKQKPAQGLEWTGWINPSYGNTDYNQKFKGKARLTSDKSSSTAYMELSSLTSEDSAVYYCV
Cricetulus griseus V897 igkv AMDS01118676.1 1730 GRCDIQMTQTPSSLSASVGDRVSITCKASEGISDALSWYQQKPGKAPKLLIYYANSLEDGVPSRFSGSGSGTQFSLKISSLEAEDAGIYFCHQGYNPP
Cricetulus griseus V901 ighv AMDS01119622.1 4058 VHSQVQLQQSGPELVKPGSSVKMSCKASGYTFASSVMHWRKKKPRQSLECIGYVYPENGGTSCNQKFQGKATLTAETSSSTVYKDLRSLSAEDSAVYYCAR
Cricetulus griseus V902 ighv AMDS01119622.1 1010 VQCEAQLVESGGGLVKPGGSLKLSCVASGFPFSIEEMHWVRQAPGKGLEWVGNIYDGSTTKYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V903 ighv AMDS01119623.1 3271 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSDYYMNWVRQPSGKGLEWIAVSRNKDNSYSAEYSASVKGRFTVSRDNSKSILYLQMNSLKPEDTATYYCAKL
Cricetulus griseus V904 ighv AMDS01119627.1 2074 VHCEVKLVESGGGLVKPAGSLKLSCVASEFTFSNAAMNWVCQAPGKGMEWVARIRTKPNNYATYYPDSVKGRFTISRDDSQSMVYLQMNNLRTEDMATYYCTK
Cricetulus griseus V905 igkv AMDS01120027.1 1194 ICGDIMMTQSPSPVAVSEGERVSINCKASQNLFGSNTKKNHLAWYQQKAGKSPKLLIYWGSTRHTGVPDRFIGSGSETDFTLTISSVQAEDMGNYYCMQFYNTP
Cricetulus griseus V910 trdv AMDS01121111.1 94748 VSLDVILEQVDQITVSDGNSAKFYCTVTGGDLKNYQMSWYKKSEDNALILVYKLNNSSTDDLMGNFKGEIDASKSQFILDIEKATRKDTGTYYCGSD
Cricetulus griseus V912 trav AMDS01121125.1 11622 WPRQSLSLSRRGEWEKLVQETESATLDCTYDTSDTNYNLFWYRQQRGQMTLIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDLQLEDAAMYFCALMRR
Cricetulus griseus V923 igkv AMDS01124602.1 2015 SVGDIVLIQSPATLTMSPGQSATISCRASQSVNTAGIPLMNWYQQKPGQLYKLLIHDASKLASGVPARFSGSGSGTDFTLTIHPVEADDLATYYCQQGLALP
Cricetulus griseus V926 trav AMDS01125163.1 16883 IVGDAKTTQPSSMESTEEETVHLPCSHSTISGNEYIYWYRQAPLRGPEYVIHGLQQNTSNRMAFLAIPSDRKSSTLILPHVSLRDAAVYHCILRV
Cricetulus griseus V928 trav AMDS01125163.1 1237 VNGQVLSQSVQYVSIPEGKDASMSCNSSSTLNNVQWYKQDPEGGLVLLVAVYKSGELVRNGKVTAEFGGTRKDSVLTISASEPADSSTYFCAG
Cricetulus griseus V929 trav AMDS01125164.1 13878 VSGQANTVIQSPSILDIWEKETAVINCTYTNAAFNYFPWYKRDGRRGLTLLADIRSNVNRRTEGRFTVMLDKNARLVSLHITAAQAGDSASYLCAS
Cricetulus griseus V930 trav AMDS01125165.1 11005 KNGGQQVKQNSPSLTVQEGGISILNCDYNNNMFDYFAWYKKYPSKSPTFLISLRSNVDKNEDRRFTIFLNKTGQHFSLHIAASQPGDSAVYFCGAG
Cricetulus griseus V931 trav AMDS01125167.1 10913 GNRAQTVVQPDAHLTVSEGASLELKCSYSYGATPYLFWYIQYPGQSLELLLKHFGGDTLVKGIKAFEAEFMKSNSSFNLRKKSAHWSDSAKYFCALS
Cricetulus griseus V932 trav AMDS01125170.1 20517 VKGQQVKQSPVSLVLQEGESAELQCNFSTTATQMQWFHQSRGGHLISLFSSPSGTKQNGRLTSTTVTQERRSSLYISSSQTTDSGTYFCAMNAQCS
Cricetulus griseus V933 trav AMDS01125170.1 9134 VSRGEQVEQHPSFLSVQEGGNALINCTYTDSTNYYFYWYKQEPGAGLQLLINVLSNMDRKEEQGVIFLLNKKDKRLSLNITAAHPGDSATYFCAVS
Cricetulus griseus V934 trav AMDS01125170.1 7884 KGNGESISQTEGPVTLTVEAPLILNCNYQTPYSDPLLLWYVQPLNKAPQLLLKSSTANKTTEHQGFYATLQKSSHSFHLEKSSVQLSDSALYYCAVR
Cricetulus griseus V935 trav AMDS01125174.1 5323 VKGQQVKQSPVSLVLQEGERAELQCNFSIGATQMQWFHQSPGGHLISLFVNPSGTKQRGRLTSTTVAKEYRSSLYISSSQTTDSGTYFCAVEPQ
Cricetulus griseus V936 trdv AMDS01125176.1 11036 ASMAQKVTQAQNSISVMEKKTVTLDCGYETRESTYYLFWYKQTTSGEMVFLIRQESYKEENATKGRYSLNFQNSESSIRLIITAAQIEDSAVYFCAMRE
Cricetulus griseus V937 trav AMDS01125177.1 23372 VKGQKVEQSPVSLVLQEGERAELQCNFSTVLNSMQWFYQSRGGHLISLFYNPSGTKQSGRLTSTTVTKDRHSSLHISSSQITDSGTYFCAMNAQCS
Cricetulus griseus V938 trav AMDS01125177.1 2655 IKSQQEKETPQALSTQEGENVTMNCSYKAYSAVVQWYKQDSDRGPVLLILMRSNEREKQSGRLKATFDASTQSSSLSITAARPEDTAAYFCATD
Cricetulus griseus V939 trav AMDS01125179.1 16346 RTHADSVTQTEGKVTLSEEDFLTIHCNYSASGYPALLWYVQYPGEGPQLLFRASKANEKGSSRGFEATYDRESTSFHLQKASVQESDSAVYYCALG
Cricetulus griseus V942 ighv AMDS01125520.1 3207 VYSQVELQQSGPQLVKPGFSVKLSCKASDITFMDYYVSWVKQRPGQGLEWVGDIDLENGDTDYNQKFQGKATITADTSSSTAYMELSRLTSEDSAVYYCA
Cricetulus griseus V943 ighv AMDS01125521.1 3011 VHCEVQLVESGGGLVKPAGSLKLSCAASGFTITDYGMSWVRQAPGKGLGWVATIDSKSYNYAAHYSDSVKGRFTISRDDSQSMVYLQMNNLRTEDTATYYCTR
Cricetulus griseus V944 ighv AMDS01125523.1 5597 VQCEVKLVESGGGLVQPGKSLKLSCAASGFTFSDHWMNWVRQAPGKGLEWVGVIKHKPNNYGTHYGESVRGRFTISRDDSKSTLYLQMDNLRTEDTGIYYCA
Cricetulus griseus V945 ighv AMDS01125524.1 1004 VHSQVQLQQSGAELVKPGSSVKLSCKTSGYTFTDYAMHWVKQKPGQSLEWIGWIVPIIGIANYGQKFQGKATLTRDKSSSTAYMELSSLTSEDSAVYYCGE
Cricetulus griseus V946 ighv AMDS01125542.1 731 VQCEVQLVESGGSQVKPGGSLKLSCAASGFTFSDYWMDWVCQAPGKGLEFVGEIKYDGSTTNYAPSVKGRFTISRDNAKNILYLQINSVKSEDTATYYCVR
Cricetulus griseus V949 ighv AMDS01126165.1 960 VQCEVKLVESGGGLVKPGGSLKLSCVASGFTFSDYWMNWFRQAPGKGLEWVGNINQDRGTTYYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCV
Cricetulus griseus V954 ighv AMDS01128292.1 2777 VHCEVKLVESGGGLVKQGGSLKLSCVASGFTFNDYWMSWFPQSPGKGLAWVGEINEGGSTTRYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V958 ighv AMDS01129685.1 2680 KLVESGGGLVKPGGTLKLSCAVSGFTFSSYWMSWFRQAPGKGLEWVGDINEGGSTTRYAPSVKRRFTISRDNAKNTLYLQMCCSVNSVKSEDTATYYCAR
Cricetulus griseus V960 igkv AMDS01130074.1 1245 SVGDIVLTQSPASLTMSPGQSATISCRASQSVNTVGIPLMNWYQQKPGQLSKLLIHDASKLASGVPARFSGSGSGTDFTLTIHSVEVDDVATYYCQQGL
Cricetulus griseus V961 ighv AMDS01130828.1 619 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITSDSYWSCIRQFPGKKLEWMGNIGYGGGTNYNPSLTSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V962 ighv AMDS01130835.1 446 YPEESGPGLLQPSQTLSLTCSFSGFSLSTSGMGVGWIHQPSGKGLEWLAIIWWDDDKYYNPSLKSRLTISKDISNNRVTLKIASVDTADTATYYCARR
Cricetulus griseus V963 ighv AMDS01130843.1 1666 VTTQIQLVQSGAELKQPGQSVKISCKASGYTFTQYAMNWVKQAPGQDIKWMGWINTETGNPTYADDFKGRFVFSLDTSVSTAYLQISSLKNEDTAMYYCA
Cricetulus griseus V965 ighv AMDS01131394.1 1262 VQCEVQLVESGGGLVKPGGSLKLSCAASGFTFSDYWMQWVRQTPGKVLEWVGNIKHDGSSTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCTR
Cricetulus griseus V969 igkv AMDS01132363.1 3709 SQGQIMLTQPAESLHVSPGERVSVTCRASQSLLYTDGKHYLSWYQQRQGETIKTFIYHASTRIDGVPTRFIGSGSGTEFTLTIEDLQPEDFAVYYCLQ
Cricetulus griseus V971 ighv AMDS01134212.1 5381 VQCEVQLVESGGGLVQPGKSLKLSCAASGFTFSGAWMNWVCQAPGKGLEWVAQIRIKPDNYATYYGESVKGRFTISRDNSKSSLYLQMNSLRAEDTAIYYCA
Cricetulus griseus V977 ighv AMDS01135106.1 685 ISVCEVQLVESGGGLVQPGKSLKLSCAASGFTFSDAWMNWVRQAPGKGLEWIGVIEHKYNNYATDYAESVKGRFTISRDDSKSSLYLQINSLRAEDTAIYYCAA
Cricetulus griseus V979 ighv AMDS01135288.1 446 VHCEVQLVESGGGLVKPAGSLKLSCAASGFTFSNSAMHWVRQAPGKGLEWVARIRTKPNNYATYYADSVKGRFTISRDDSQSMVYLQMNNLRTEDTATYYCTK
Cricetulus griseus V984 ighv AMDS01136602.1 727 VETQVQLVQSGAELKQPGQSVKISCKASGYTFTQYAMHWVKQSPGQGLKYMGWINTETGNPTYADDFKGRFVFSLDTSVSTAYLQISSLKNEDTAMYYCAR
Cricetulus griseus V985 ighv AMDS01136603.1 1678 VLSQVQLLQSESELGRPGSALKLSCKTSGYTFTTYTMNWVKQRPGQGLEWIGRIYAENGHVDYAQKFRGKATLTVDKSSSTAYLELSSLTSEDFAMYYCA
Cricetulus griseus V989 ighv AMDS01137666.1 3170 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITTSVYDWNWIRQFPGKKLEWMGAINYVGGTGYNPTLNSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V990 ighv AMDS01138025.1 1281 VQCEVQLVESGGGLMRPGGSLKLSCAASGFTFSDYWMDWVRQAPGKGLEWVAEINGDGSDTKYAPSLKDRFTISRDNAKSTLYLQMNSVKSEDTATYYCTRP
Cricetulus griseus V991 ighv AMDS01138037.1 2820 VQCEVKLVESGGGLVQPGKTLKLSCAASGFTFSSYWMNWVRQAPGKGLEWVAQIRDKSNNYATHYVESVRGRFTISREDSQSSLYLQMNNLRAEDTAIYYCTR
Cricetulus griseus V992 ighv AMDS01138043.1 984 VHCEVKLVESGGGLVKPTGSLKLSCATSGFTFTDYNMHWVHQAPGKGLEWVAYVSTESNNYATSYADLVKGRFTISRDDSRSMVDLQMNNLRTEDTATYYCTS
Cricetulus griseus V994 igkv AMDS01138602.1 634 ANCEIQMIQSPASLSVSLGKSVTIKCLASEDLYGNLAWYQQKLEEPPKLLIYNTHSLKDGVPSRFSGSGSGTQYSFEITNLQSEDVASYFCQQDYSTP
Cricetulus griseus V997 ighv AMDS01139268.1 17003 VHCEVQLVESGGGLVKPAWSLKVSCATSGFTFTDYAMRWVRQSPGKGLQWVASISTKPNNYATYYSDSVKGRFTISRDDSRRMVYLQMNNLRTEDTATYYCTA
Cricetulus griseus V998 ighv AMDS01139268.1 15271 VYSQVELHQSDPQLVKPGFSGKLSCKASGITFTDYYVYWVKQRPGQGLELVGDIDPENGETDYNQKFQGKATITADTSSSTAYMELSRLTSEDSAVYYCA
Cricetulus griseus V999 ighv AMDS01139268.1 10838 VLSQVSLKESGPGLLQPSQDLSLTCSFSGFSLSTSGMGVGWVQQPSGKGLQGLAIIWWDDDKRYNPSLKSRLTISKDTSNNRVTLKTTSVDTADTATYYCAQR
Cricetulus griseus V1000 ighv AMDS01139268.1 8727 VHSQVQLQQSGAVLVKPGSSVKVSCKASGFTFTSIYMSWVKQKPGHGLERIGSIFPAFDIIDYGEKFKGKATLTADTSSSTAYMELSSLTSEDSAVYYCA
Cricetulus griseus V1001 ighv AMDS01139268.1 1194 VQCEVQLVESGGGLVKPGGSLKLSCVASGFTFNDHYMNWVRQAPGKGLEWVGDINYDGSTTRYAPSVKGRFTISRDNAKYTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V1002 ighv AMDS01139272.1 6006 VLSQIQLQESLPGLVKPSQSLSLTCSVTSYSITTSGYGWHWIRQFPVKKLEWMGYIGYDGSTDYNPSLKSRISITRDTAKNQCFLQLNSVTTEDTATYYCAG
Cricetulus griseus V1003 ighv AMDS01139272.1 2319 VHCGVQLVESGGGLVKPAGSLKLSCAASGFTFTDYAMNWVSQAPGKGLEWVAHIRSKHYNYATYYADSVKGRFTISRDDSQSMIYLQMNNLRTEDTATYYCTA
Cricetulus griseus V1004 igkv AMDS01139410.1 1593 VTVLSPHGITRSLGQSATISCKASQSVSIGSINLMHWYQQKPGQPPRLLIYGASNRASGIPTRFSGSGSGTDFTLTIHPVEADDAATYFCQQSSELP
Cricetulus griseus V1008 ighv AMDS01140017.1 748 VLSQVQLKESGPDLVKPSETLSLTCTVSGFSLTSYDVHWVRQPPGKGLEWMGVIWSGGGTDYNSNLKSRVTITRDTAKSQVFLKLNSLQHEDTAMYYCTR
Cricetulus griseus V1012 ighv AMDS01141476.1 10172 VHCEVQLVESGGGLVKPAGSLKLSCVASGFTFSNYFMDWVRQAPGKGLEWVAHIETKSYNYATYYADSVKGRFTISRDDTQSMAYLQMNNLRTEDTAIYYCAS
Cricetulus griseus V1018 ighv AMDS01144187.1 590 VLSQVTLKESGPGLLQPSQTLSLTCSFSGFSLSTDGMGVGWICQPSGKGLEWLANILWDYVKRYTPSLKSRLTISKDTSNNRVTLKIASVDTADTATYYCAQR
Cricetulus griseus V1019 ighv AMDS01144201.1 5118 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITTSGYGWSWIRQFPGKKLEWMGAINKGVSTDYNPSLKNCISITRDTAKNQFFLQLNSVTTEDTATYYCAG
Cricetulus griseus V1020 ighv AMDS01144201.1 2480 VQCEVQLVESGGRLIHPGNSLKISCAASGFTFSVYYMHWVRQAPGKGLEWIGVIKHKYNNYATDYAESVKGRFTISRDDSKSSLYLQMNSLRAEDTAIYYCAA
Cricetulus griseus V1021 ighv AMDS01144209.1 611 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITTSGYVWHWIRQFPGNKLEWMGYINYGGGTGYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V1022 igkv AMDS01144428.1 1360 SRGDVVMTQTPTFLPVSLGEQVSISCRSSQSFVHSDGNTYLNWLLQKPGQSPKLLIYKISKRASGVPDRFSGTGSGTDFTLKISRMEPEDFGLYYCMQASYVP
Cricetulus griseus V1024 igkv AMDS01144774.1 8726 SRGDVVMTQSPPSLSVSLGEQVSISCKSSQSLVHSNGNTYLEWYLQKPGQSPKLLVYKVSNRFSGVPDRFSGSGSGTDFTLKISRMEPEDFGVYFCFQGSHA
Cricetulus griseus V1026 igkv AMDS01150271.1 1212 GRCNIQMTQTPSSLSVSLGDRVSLSCKASENIYTTLSWYQQKPGKAPKLLIYYANSLEDGVPTRFSGSGSGTQFSLTISSLEAEDVGTYFCHQGYNLP
Cricetulus griseus V1027 ighv AMDS01151070.1 701 VLSQIQLQESGPGLVNPSQSLYLTCSVTGYSITSGYYWHWNRQSPGKTLEWMGYIYNGGTYYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V1028 ighv AMDS01151713.1 2284 VQCEVQLVESGGGLVQPGKSLKLSCAASGFTFSSYWMNWVRQAPGKGLEWVAQIRVKSNNYATHYVESVKGRFTISREDSQSSLYLQMNNLRAKDTAIYYCTR
Cricetulus griseus V1029 ighv AMDS01152728.1 2352 VQCEVQLVESGGGLVQPGKSLKLSCEASGFTFSSYGMDWVRQSPGKGLEWVAYISSRSSNIYYADAVKGRFTISRDNAKNLLFLQMNSVKSEDTATYYCAR
Cricetulus griseus V1030 igkv AMDS01152994.1 877 SIGDIVLTQSPASMPVSVGQKATVSCKSSESVNSYGINLMHWYQQKQGQPPKLLIYAGSNLASGIPTRFRGSGSGTDFTLTIHPVEADDSAIYYCQQSKELP
Cricetulus griseus V1031 igkv AMDS01153763.1 1571 GRCDIQMTQTPSSLSASVGDRVSITCKASEGISDALSWYQQKPGKAPKLLIYYANSLEDGVPSRFSGSGSGTQFSLKISSLEAEDAGIYFCQQGYNPP
Cricetulus griseus V1033 igkv AMDS01154580.1 492 ACADIVMTQSPSFLAVSAGERATISCKSSQSLLYSGNQKNYLAWYQQKVGQSPKLLIYFASTQYTGVPDRFTGSGSGTDFTLTISNIQAEDMGDYYCMQSLSDP
Cricetulus griseus V1034 igkv AMDS01155466.1 817 ARCDIQMTQSPSSLSASVGDTVTITCRASQEIYSLSWYQQKPGNPPKLLIYGINILEDGVPQRFSGSGSGTQFSLKISSLQAEDIAAYYCQQGRYYP
Cricetulus griseus V1035 ighv AMDS01157412.1 582 VLSQVQLLQSESELGRPGSALKLSCKTSGYTFTTFTMNWVKQRPGQGLEWIGRIYAENGHIDYAQKFRGKATLTVDKSSSTAYLELSSLTSEDFAMYYCA
Cricetulus griseus V1036 ighv AMDS01158442.1 485 VLSQIQLQESGPGLVKPSQSLCLTCSVTGYSITTSGYWWQWIRQFPGKKLAWMGGIRYDGGNSYNPSLKSRISITRDTAKNQFFLLLNSVTTEDTATYYCAR
Cricetulus griseus V1037 igkv AMDS01159666.1 427 GRCDIQMTQTPSSLSASVGDRVSITCKASEGISDALSWYQQKPGKAPKLLIYYANSLEDGVPSRFSGSGSGTQFSLKISSLEAEDAGIYFCQQGYNPP
Cricetulus griseus V1039 ighv AMDS01184915.1 325 VLSQIQLQESGHGLVKPSQKLSITCSVIGFSITTSCYVWHWITQLPGKKLEWMGYINYYGGSTNYNPSHKNGISITRETSKNQFFLQLNSVSTEDTATYYCAR
Cricetulus griseus V1040 igkv AMDS01191542.1 425 VDGNIVITADLLSIPVTPGELASISCRSRKSLLYSDDKTYLHWYHKRPGQSSQLLIFGISNHATGVPDRFSGSGSETDFTLKISRVEAEDMVVYFCQQVLEK
Cricetulus griseus V1044 igkv AMDS01195468.1 526 TCGEIVVTQSPSFLAVSGGEEVKISCRSCQNLLYSANKKNYLVWFQQKPGQSPKLLIYWATTRDTGVPDIFIGRGSGTDFTLTISNVQAEDMADYYCMQNYDIP
Cricetulus griseus V1048 iglv AMDS01197500.1 910 SFSQLVLTQTPSASASLGNSVKITCTLSSQHSNYYIAWYQQHPDKAPKYVMYVNSGGSHGKGDGIPDRFSGSSSGAHRYLSISNIQSEDEADYFCGSGDSNG
Cricetulus griseus V1049 iglv AMDS01197504.1 610 SFSQPVLTQSPSASASLGNSVKITCTLSSQHSHYDIVWYQQHPDKAPKYVMYLQSDGSHSKGDGIPDRFSGSNSGAHRYLSISNIQSEDEADYFCGSGDSSV
Cricetulus griseus V1050 iglv AMDS01197507.1 3834 SFSQLELTQSPSASASLGNSVKITCTLSSQHSNYYIDWYQQHPDKAPKYVMYVNSGGSHGKGDGIPDRFSGSSSGAHRYLSISNIQSEDEADYFCGSGDSSV
Cricetulus griseus V1051 iglv AMDS01197511.1 30453 SFSQPVLTQSPSASASLGASVKITCTLSSQYSTYPIRWYQQHPDKAPKYVMYLYNDGSHSKGDGIPDRFSGSSSEAHRYLSISNLQLEDEAVYYCDIYG
Cricetulus griseus V1052 iglv AMDS01197511.1 7149 SFSQPVLTQSPSASASLGASVKLTCTLSSEHSTYNIDWYQQQSDKAPKYVMYLNSDGSYGKVDGIPDRFSGSSSGAHRYLSISNIQPEDEAIYYCGADYGTV
Cricetulus griseus V1053 iglv AMDS01197512.1 9563 SCAQYELTQPKSVSESLGRTVTISCKRSSGNIEDSFVHWYQQHFGSSPKTVMYNDNKRPSGVPDRFSGSIDSSSNSASLTITDLQIEDEADYFCQSSGIGF
Cricetulus griseus V1054 iglv AMDS01197514.1 6790 SCAQFVLTQPKSVSESLGRTVTISCKCSSGNIGSYYVHWYQQQFGSSPKAVIYENNKRPSGVPDRFSGSIDSSSNSASLTITNLQIEDEADYFCQSYDSNS
Cricetulus griseus V1055 iglv AMDS01197516.1 872 CVHPAPICVRIFGPGEQHILHPQQWKHCKYYVSWYQQHSSNKPRLLIYKYDQRPSGIPDRFSGSMDTSSNSGILTISRLQPEDEGDYYCLSGYDSY
Cricetulus griseus V1056 iglv AMDS01197519.1 19065 SCAQFVLTQPKSVSESLGRTVTISCKRSSGNIGDYFVNWYQQRFGSLPQTVIYEHNKRPSGVSDRFSSSIDSSSNSDSLTITDLQTEDEADYFCSSYDNND
Cricetulus griseus V1057 iglv AMDS01197519.1 1137 SCAQYELTQPKSVSESPGRTVTISCKRSSGNIGNNYVHWYQQHFGSSPKTVIYKDNKRPSGIPDRFSGSIDSSSNSASLTITDLQIEDEADYFCQSSGSGF
Cricetulus griseus V1058 iglv AMDS01197522.1 19135 SCAQFVLTQPKFVSESLGRTVTISCKRSSGNIGGYYVHWYQQRFGSSPKTVIYDDNQRPSGVPDRFSGSIDSSSNSASLTITDLQTEDEADYFCFSYDNNY
Cricetulus griseus V1059 iglv AMDS01197522.1 4519 SCAQYELTQPKSVSESLGRTFTISCKRSSGNIRSSYVHWYQQHFGSSPKTVIYDDNTRPSGIPDRFSGSIDSSSNSASLTITDLQIEDEATYFCQSHDSGF
Cricetulus griseus V1060 iglv AMDS01197524.1 1615 SCAQYDLTQPKSVSESLGRTVTISCKRSSGNIGSSYVYWYQQHFGSSPKTVIYKDNKRPSGIPDRFSGSIDSSSNSASLTITDLQIEDEADYFCQSSGSGF
Cricetulus griseus V1061 iglv AMDS01197526.1 3565 LCAQFVLTQPKSVSESLGRTVTISCKRSSGNIGGYYVSWYQQHFGSLPQTVIYEHNKRPSGVPDRFSGSTDSSSNSASLTITDLQTEDEADYFCFSYDSNY
Cricetulus griseus V1062 iglv AMDS01197532.1 28192 SCAQYELTQPKSVSESLGRTVTISCKRSSGNIEDKYVHWYQQHFGSSPKTVIYADNKRPSGISDRFSGSIDSSSNSASLTITDLQIEDEADYFCQSSGSGF
Cricetulus griseus V1063 iglv AMDS01197532.1 17208 SCAQFVLTQPKSVSESLGRTVTISCKRSSGNIGSYYVSWHQQHFGSSPQTVIYHDNQRPSGVPDRFSGSIDSSSNSASLTITDLQIEDEAEYFCLSYDDNN
Cricetulus griseus V1064 iglv AMDS01197532.1 1442 SCAQYELTQPKSVSESLGRTVTISCKRSSGNIGSNSVYWYQQHFGSSPKTVIYNNNKRPSGVPDRFSGSVDSSSNSASLTITDLQIEDEATYFCQSYGSGF
Cricetulus griseus V1065 iglv AMDS01197533.1 3573 SCAQFVLTQPKSVSESLGRTVTISCKRSSGNIGGYYVSWYQQHSGSPPQTVIYGDDKRPSGVPDRFSGSIDRSSNSASLTITELQTEDEADYFCLSYDSNY
Cricetulus griseus V1066 iglv AMDS01197536.1 33641 SCAEVVFTQPQSVSGSLGQEISISCTRSSGNIASNYVSWYQQHSSNKPRLLIYKYDQRPSGIPDRFSGSKDTSSNSGILTISRLQPEDEGDYYCLSGYDSY
Cricetulus griseus V1067 iglv AMDS01197536.1 18976 SCAQFELTQQKSVSESLGRTVTISCKRSSGNIGSSYVHWYQQHFGSSPKTVIYADNTRPSGIPDRFSGSIDSSSNSASLTITDLQIEDEATYFCQSYGSGF
Cricetulus griseus V1099 trbv AMDS01213357.1 15929 SAKAQVTQTPRHIITEPGKELIIACSQNLNHDSMYWYRQDLGLGLRLIYYSVNVGIIDKGAVSDGYNVSREELKAFPLTLKFTRISQTSTYFCASS
Cricetulus griseus V1100 trbv AMDS01213357.1 12742 LVDMEVTQMPRYLVTRMEEGVLLECAQDLGHERMYWYRQDPDLGLRLIYFSYDVDSNSEGDIPKGYMVSRKKREHFSLILKSAQTNQTSVYFCASSL
Cricetulus griseus V1101 trbv AMDS01213357.1 7621 SVFGVLLYQKPKQDICQSGTSLKIQCEVDTQVAGMFWYRQFQGQSLVLMAAANQGSEATYESGFTNEKFPISRPNLTFSTLTVNNARPEDSSFYFCSSG
Cricetulus griseus V1102 trbv AMDS01213359.1 12808 SCDAEVTQTPRYLFKAKGQVANMSCNPEKGHTVFYWYQQNQNGELKLLIYFRNEEIIEQTDSVKKRFSAKCRSNSPCSLDILSSEAGDSALYLCASSL
Cricetulus griseus V1103 trbv AMDS01213360.1 440 FVDAAVTQTPSHLIKTEGQRATMKCNPEKGQTVVYWYQQRQNKELKFLIYFQGQQPIDQIDMVKKRFSAECPSNSPCSLEINISEVGDSALYFCASSQ
Cricetulus griseus V1105 trbv AMDS01213361.1 11430 SMDTEVIQNPRYLVKGKEQRAKMDCTRIKGHSYIYWYYKKLGEELKFLVYFQNADIVDKTDKIDKNISAKCLPNVPCTLEIQSSQLADSAVYFCASSQ
Cricetulus griseus V1106 trbv AMDS01213361.1 2108 SLNGQVIQTPQHLLKGKGQKAKMSCRPENGHTFVFWYQQKQNKELNFLISFQRQEVRERTDLVKERFLAECPLNSPCSLEIQSSEAGDSALYLCASSL
Cricetulus griseus V1107 trbv AMDS01213363.1 18634 PTNAGVIQTPRSKVMEKGQEATLRCEPISGHSSVSWYKQTSVRGMEFLISFQNQEPIDNTGMPKERFSAQMPSAKLSTLKIQTTQPQDSAVYLCASSL
Cricetulus griseus V1108 trbv AMDS01213363.1 13333 CVDAMVTQNPRYKVARVGKAVNLSCSQNLNHNAMYWYRQKPNQGPKFLLYYYDSTLNKEADTSDNFQSSRPNNSFCLLDIRSAGLGDSAMYLCASSR
Cricetulus griseus V1109 trbv AMDS01213363.1 8454 HTDAGVTQSPRHEVAEKGQTESLTCEPVSGHNDLFWYRQTNIQGLELLSYFRSKSLMEDDKTGKDRFTAEVLDSSVSILKIKPTEPQDSAVYLCASSL
Cricetulus griseus V1110 trbv AMDS01213363.1 942 TMQDEVTQTPKFLIGRPGQSLTLECKQDFNHDTMYWYRQDPDKGLRLIYYSITEKDIQKGELSEGYDVSREKKQLFPLTVTSAQKSHKAVYLCASSL
Cricetulus griseus V1111 trbv AMDS01213364.1 73468 PVSAGISQTPSWMILKTGQLVSVNCTQHLKHDCMFWYRQDPGLGLRLIYYSYDVSNTEKGDVSEGYSVSRSNAEDFSLTLESATHSQTSVYFCASSY
Cricetulus griseus V1112 trbv AMDS01213364.1 68769 LTDAGITQTPRYWITQTGRKMVLGCSQNMGHYWMFWYRQDAGQGFRLIHYSGSVGSTTKGDVPEGYSVSRNESDHFPLTLDSTRPSQTSTYFCASS
Cricetulus griseus V1113 trbv AMDS01213364.1 54024 QTKAGVSQSPIHRITKIGQNVSFWCNPISSHNSLYWYRQRWGQGPEFLAYFQNKVAPDKSGLPRNHFIERPEGSYSFLKIQPVKQEDSAVYLCASSS
Cricetulus griseus V1114 trbv AMDS01213364.1 48597 AANPGVIQTPRHLIKAQGGRSILKCIPMSGHDNVAWYQQPLGQELKFLIQHYEKMERAKGDMPNRFSVQQFSDYHSEMNMSALQLEDSAVYFCAS
Cricetulus griseus V1115 trbv AMDS01213364.1 45895 HMEAAVTQSPRSKVTVTGQKVELSCRQTFNHNNMYWYRQDPGHGLRLIHYSYGAGNTEKGDVPDGYKATRPQKASFSLVLEVASPSQTAVYFCASSD
Cricetulus griseus V1116 trbv AMDS01213364.1 36928 AANPGVIQTPRHLIKAQGGRSILKCIPMSGHNNVAWYQQPLGQELKFLIQHYEKMEREKGDMPNRFSAQQFSDYHSEMNMSALQLEDSAVYFCAS
Cricetulus griseus V1117 trbv AMDS01213364.1 34431 HMEAAVTQSPRSKVTVTGQKVELSCRQTFNHNYMYWYRQDPGHGLRLIHYSYGPDNTEKGDVPDGYKATRPQQASFSLVLEVASPSQTAVYFCASSD
Cricetulus griseus V1119 trbv AMDS01213364.1 23688 HMEAAVTQSPRSKVTVTGRKVELSCQQTNNHDYMYWYRQDPGHGLRLIHYSYGAGNTEKGDVPDGYKATRPQQANFSLVLEVASSSQTAVYFCASAD
Cricetulus griseus V1120 trbv AMDS01213364.1 16370 HMEAAVTQSPRSKVTVTGRKVELSCHQTNNHDNMYWYRQDPGHGLRLIHYSYGANNTEKGDVPSGYKATRPRTEDFSLVLEVASSSQTAVYFCASS
Cricetulus griseus V1121 trbv AMDS01213364.1 4954 HTDAGVTQSPRHEVAEKGQTVSLTCEPVSGHNDLFWYRQTNIQGLELLSYFRSKSLMEDDKTRKDRFTAEMLDSSVSILKIEPTEPQDSAVYLCASSL
Cricetulus griseus V1122 trbv AMDS01213366.1 20206 PVDPRIVQTPKYLVTVTGNEKTLTCKQYLNHNAMYWYRQSAKKSLELMFAYSYQRLVDNQTVPHRFQTHNPEKSLLELQISALENDDSATYFCASSQ
Cricetulus griseus V1123 trbv AMDS01213366.1 18511 HTGPKVIQMPSHQVILVGQKVTLSCDPVSNHLYFYWCKQNLEQQMEFLVSFYDGKTMDKSELFKEDSFSVERQDDSYFTLKIQPTTLKDSAVYFCASSL
Cricetulus griseus V1124 trbv AMDS01213366.1 9685 PLETVVFQTPRYLVTRVGNKASLKCDQTLNHDTMYWYKQDSKQQLKVMFSYNNKQLIINESVPSRFSPQSPDKAHLNLHVKFIEPDDSAVYLCASS
Cricetulus griseus V1125 trbv AMDS01213366.1 6009 LTDTKILQTPRYLVMGRANNKSLKCEQQLGNNAMYWYKQNAGQPPELMFLYNLKQLILNETVPSRFFPECPDTSQLFLHLSALEPEDSAVYFCASSK
Cricetulus griseus V1131 ighv AMDS01215091.1 10371 QLVESRGQGRGLVKPGKSLTLSCEASGFTFSDYEMAWVHQAPGKGLERVACISTVGGAMHAEAVKGRFTISRDNAKNALYLQMNNLKSEDTATYYCA
Cricetulus griseus V1132 ighv AMDS01215093.1 8351 VLSQVQLKESGPGLLQPSQTLSLTCTVSGFSLTSYHVIWEHQPPGKGLEWMGGIGYDGSPAYNSSLQSQVSITRDTSKSQVFLKLNKLQTEDTAMYYCAR
Cricetulus griseus V1133 ighv AMDS01215098.1 7240 VLSQLQLKEKGPSLVKPSETLSLTCTVSGFSLTSYHVIWVHQPPGKGPEWMGVMWNSGGTDYNSALKSPVTITRDISKSHVFLKLNNLQTEDTATYYCAR
Cricetulus griseus V14 trav APMK01010332.1 8888 VSSQQKVQQTPESLSVSEGSVASLNCTSSDRNYDYFWWYRQHPGKGPEFLLSIFSNGEKEEGRFTAHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V26 ighv APMK01017688.1 868 VLSQVQLQESGPGLLKPSQSLSLTCTVTGYSISRGYWWSWIRQHPGKGLEWMGDIYNNGDTYYNPSLKNRITMTVDTSKNQFSLRLSSVTTEDTAVYYCAR
Cricetulus griseus V27 ighv APMK01017949.1 258 VHCQVQLQQSGAELENPGSSVKLSCKASGYTFTDHYMSWVKQKPGQGLEWIGYIGAGGGDTYYNQRFQCKATLTRDKSSSTVYMELSSLTSDDSAVYFCAR
Cricetulus griseus V34 igkv APMK01021147.1 327 ICADIVMTQSPTSLAVSAGEKVTISCKSSQSLYSSTYQVNYLAWYQQKPRQAPKLLIYYASTRHTGVPDRFTGGGSGTDFTLSISSVQAEDLGDYYCVKHYRS
Cricetulus griseus V44 ighv APMK01027467.1 1370 QLVESRGQGRGLVKPGKSLTLSCEASGFTFSDYEMAWVHQAPGKGLERVACISTVGGAMHAEAVKGRFTISRDNAKNALYLQMNNLKSEDTATYYCA
Cricetulus griseus V53 trbv APMK01031399.1 1810 PVSAGISQTPSWMILKTGQLVSVNCTQHLKHDCMFWYRQDPGLGLRLIYYSYDVSNTEKGDVSEGYSVSRSNAEDFSLTLESATHSQTSVYFCASSY
Cricetulus griseus V54 trbv APMK01031399.1 6509 LTDAGITQTPRYWITQTGRKMVLGCSQNMGHYWMFWYRQDAGQGFRLIHYSGSVGSTTKGDVPEGYSVSRNESDHFPLTLDSTRPSQTSTYFCASS
Cricetulus griseus V55 trdv APMK01031417.1 3854 VSLDVILEQVDQITVSDGNSAKFYCTVTGGDLKNYQMSWYKKSEDNALILVYKLNNSSTDDLMGNFKGEIDASKSQFILDIEKATRKDTGTYYCGSD
Cricetulus griseus V59 ighv APMK01032853.1 6644 VQCEVQLVESGGGLVQPGKSLKLSCAASGFTFSDYWMDWVRQVPWKGLEWVAQIGTKGYNYVTHYGESVSGRFTISRDDSKSSLYLQMNNLRAEDTAIYYCTR
Cricetulus griseus V87 trav APMK01052330.1 4413 RTHAESVTQTEGKVTLSEEDFLTIHCNYSATGYPALFWYVQYPGEGPQLLFRASKANEKGSSRGFEATYDRESTSFHLQKASVQESDSAVYYCALG
Cricetulus griseus V90 ighv APMK01054573.1 1232 VQCEVQLVESGGGLVQPGKSLKLSCEASGFTFSDYTMHWFRQAPGKRLEWVAYINSGSSDINYADAVKGRFTISRDNAKNTLFLQMNSVKSEDTATYYCAR
Cricetulus griseus V91 trav APMK01054580.1 2931 KINGDSVTQTEGLVTVTEGSPVMLSCAYQTTYSAPTVFWYVQDLNKAPQLLLKSLTDNKRTEHQGFHATLHKSNSSFHLQKSSVQLSDSALYYCALS
Cricetulus griseus V106 igkv APMK01068439.1 627 ANCEIQMIQSPASLSVSLGKSVTIKCLASEDLYGNLAWYQQKLEEPPKLLIYNTHSLKDGVPSRFSGSGSGTQYSFEITNLQSEDVASYFCQQDYSTP
Cricetulus griseus V110 trbv APMK01070668.1 239 AGAQTIRQWPASRVQPVGSPLSLECTIKGQSNPNLYWYWQATGGPLQQLFFSISVGNVESVVSRNLSASRPQDGQFTLSSEKVLLSHTGFYFCAWS
Cricetulus griseus V113 trbv APMK01071556.1 8844 QTKAGVSQSPIHRITKIGQNVSFWCNPISSHNSLYWYRQRWGQGPEFLAYFQNKVAPDKSGLPRNHFIERPEGSYSFLKIQPVKQEDSAVYLCASSS
Cricetulus griseus V114 trbv APMK01073098.1 2211 SLNGQVIQTPQHLLKGKGQKAKMSCRPENGHTFVFWYQQKQNKELNFLISFQRQEVRERTDLVKERFLAECPLNSPCSLEIQSSEAGDSALYLCASSL
Cricetulus griseus V115 trbv APMK01073098.1 5017 FVDAAVTQTPSHLIKTEGQRATMKCNPEKGQTVVYWYQQRQNKELKFLIYFQGQQPIDQIDMVKKRFSAECPSNSPCSLEINISEVGDSALYFCASSQ
Cricetulus griseus V117 ighv APMK01075069.1 3029 VHCQVQLQQSGAELGKPGASVKLSCKASGYNFIAYYMYWMKQRPGQGLEWIGRIDPEYDNTNYNKKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V118 trbv APMK01075633.1 365 SCDAEVTQTPRYLFKAKGQVANMSCNPEKGHTVFYWYQQNQNGELKLLIYFRNEEIIEQTDSVKKRFSAKCRSNSPCSLDILSSEAGDSALYLCASSL
Cricetulus griseus V119 trbv APMK01079991.1 16677 SAKAQVTQTPRHIITEPGKELIIACSQNLNHDSMYWYRQDLGLGLRLIYYSVNVGIIDKGAVSDGYNVSREELKAFPLTLKFTRISQTSTYFCASS
Cricetulus griseus V120 trbv APMK01079991.1 19864 LVDMEVTQMPRYLVTRMEEGVLLECAQDLGHERMYWYRQDPDLGLRLIYFSYDVDSNSEGDIPKGYMVSRKKREHFSLILKSAQTNQTSVYFCASSL
Cricetulus griseus V121 trbv APMK01079991.1 24984 SVFGVLLYQKPKQDICQSGTSLKIQCEVDTQVAGMFWYRQFQGQSLVLMAAANQGSEATYESGFTNEKFPISRPNLTFSTLTVNNARPEDSSFYFCSSG
Cricetulus griseus V127 trav APMK01081160.1 11935 VNGQVLSQSVQYVSIPEGKDASMSCNSSSTLNNVQWYKQDPEGGLVLLVAVYKSGELVRNGKVTAEFGGTRKDSVLTISASEPADSSTYFCAG
Cricetulus griseus V139 trav APMK01099705.1 170 VSSQQKVQQTPESLSVSEGAMASLNCTSSDQNFQYFWWYRQYPGKGPKALVSIFSDGKKEEGKFTVHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V150 trbv APMK01102606.1 5696 PTNAGVIQTPRSKVMEKGQEATLRCEPISGHSSVSWYKQTSVRGMEFLISFQNQEPIDNTGMPKERFSAQMPSAKLSTLKIQTTQPQDSAVYLCASSL
Cricetulus griseus V151 trbv APMK01102977.1 5671 HTDAGVTQSPRHEVAEKGQTVSLTCEPVSGHNDLFWYRQTNIQGLELLSYFRSKSLMEDDKTRKDRFTAEMLDSSVSILKIEPTEPQDSAVYLCASSL
Cricetulus griseus V153 igkv APMK01103226.1 518 ICGDIVMTQSPSSVAVSAGERVSINCNSSQNLFGNKTKKNCLVWFQQKPGQSPKFLIYWASARHTGVPDCFIGSGSETDFTLTISSVQAEDLADYYCMQDHIYP
Cricetulus griseus V156 trbv APMK01106311.1 605 AANPGVIQTPRHLIKAQGGRSILKCIPMSGHDNVAWYQQPLGQELKFLIQHYEKMERAKGDMPNRFSVQQFSDYHSEMNMSALQLEDSAVYFCAS
Cricetulus griseus V157 ighv APMK01106628.1 994 VLSQVTLKESGPGLLQPSQTLSLTCSFSGFSLSTSNTAVGWIRQPSGKGLEWLANIWWDDDKYYNPSLKSRLTIYKDTSYNRVTLKIASVDTADNATYYCAGT
Cricetulus griseus V165 trgv APMK01111568.1 1387 GLGQLEQTELSVTRAMDESAQISCKVSLQDFGKVDIHWYRHKRNQQFEYLMFVRTNYNERTLEGKIKKIEATKDVQTSTSTLKVNFLKKGDEAIYYCAVWS
Cricetulus griseus V174 trav APMK01122216.1 238 AAGQGTEQPAKLMSVEGTSIQVNCTYSTSGFYGLSWYKQHDGQAPVFLSYDVLDSLKDSEHFSIFLSRWDGHSYLLLTEHRASSELQVKDSASYLCAVR
Cricetulus griseus V179 igkv APMK01128643.1 129 ACADIVMTQSPPSLTVSAGEKATVSCKSSQSLFNSNTNKNHLNWYLQKPGQSPKLLIYLASTRHTGVPDRFKGSGSGTDFTLTISSVQDEDLGDYYCQQWYSSP
Cricetulus griseus V186 trbv APMK01134371.1 2669 CVDAMVTQNPRYKVARVGKAVNLSCSQNLNHNAMYWYRQKPNQGPKFLLYYYDSTLNKEADTSDNFQSSRPNNSFCLLDIRSAGLGDSAMYLCASSR
Cricetulus griseus V187 trav APMK01135852.1 325 KGNGESISQTEGPVTLTVEAPLILNCNYQTPYSDPLLLWYVQPLNKAPQLLLKSSTANKTTEHQGFYATLQKSSHSFHLEKSSVQLSDSALYYCAVR
Cricetulus griseus V189 ighv APMK01138484.1 548 VHSQVQLKQSGPELVKPGASVKISCKTSGYTFTYGYMHWVEQKPGQGLEWIGIIDPDSGNTKYNQKFQGKATLTRDKSSSTVYMELNSLTSEDSAVYYCAR
Cricetulus griseus V201 ighv APMK01144778.1 822 VLSQVQLQESGPGLLKPSQSLSLTCTVTGYSISSGNWWNWIRQRPGKGLEWMGQIYNDGDTNYNPSLKSRITMTVDTSKNQFSLRLSSVTTEDTAVYYCAR
Cricetulus griseus V202 ighv APMK01145507.1 734 VLSQVSLKESGPGLVQPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIYWDDDKRYNPNLKSRLTISKDTSNNQVFLKISSVDTADTATYYCARR
Cricetulus griseus V205 ighv APMK01148659.1 34 VLSQIQLQESGPGLVKPSQSLSLTCSVTGDSITNSGSWWTWIRQFPGLKMESMGYINNDGGTDYNPSLESRISIPRDTAKNQFFLQLNSVTSEDTATYYCAR
Cricetulus griseus V209 trav APMK01149773.1 9225 VSSQQKVQQTPESLSVPEGAVASLNCTFSDSASWNFWWYRQHPGKGMELLVSIMSNGEKEEGRFTAHLNKASLHLSLHIRDSQTSDSAVYLCAV
Cricetulus griseus V210 trav APMK01149773.1 16130 VNSLQGEENPWTLSIQEGESVTMNCSYKTSIEALQWYRQDSGKGPAVIILIRSNEKKKQSGRVRVTLNTSTQSSSLSIIAARPEDTAAYFCATE
Cricetulus griseus V211 trav APMK01149773.1 24402 DVQAQSVSQADAHVTIFEGDSVELRCNYSYGGASYLFWYMQRHGHSLQFLLKYISGDPVVQGMNGFEAEFRKSDSSFHLKKASVHLRDSAVYFCALS
Cricetulus griseus V212 trav APMK01149773.1 33617 ESLGEQVEQQPSTLSVQEGDSAIINCTYTGSAFSYFSWNKQEAGESPQLIIDILENVDRKQSQRLTVLLNKKTKQLSLHISATQPGDTAMYFCAVR
Cricetulus griseus V223 ighv APMK01154554.1 3375 VQCEVQLVESGGGLVQPGKSLKLSCATSGFTFTNAWMSWVRQAPGKGLEWLGRIKNKANNYATEYAESVKGRFTISREDSQSSVSLQMNNLRAEDTAIYFCAA
Cricetulus griseus V233 ighv APMK01163812.1 3994 QLQQSGAEMRKPGASVKVSCKTSGYTFTEYTMHWVKQKPGQGLEWIGYVYPYNGNTKYNQKFQGKATLTADKSSSTAYMELSSLTSEDSAVYYCA
Cricetulus griseus V235 trav APMK01164390.1 2843 KNGGQQVKQNSPSLTVQEGGISILNCDYNNNMFDYFAWYKKYPSKSPTFLISLRSNVDKNEDRRFTIFLNKTGQHFSLHIAASQPGDSAVYFCGAG
Cricetulus griseus V236 ighv APMK01164405.1 2479 VLSQIQLQESGPGLVKPSQSLSLNCSVTGESITSSYEWSWIRQFPGKKLEWMGNTVNGGTDYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V239 trav APMK01166295.1 1593 TWSLAKTTQPLSMDSYEGQEVNVSCSHTNIATNEYIYWYRQVPHQGPQFIVQGYKVHVSNEWASLFISADRKFSTLSLPWVSLRDTGVYYCIVA
Cricetulus griseus V249 trbv APMK01172277.1 767 SMDTEVIQNPRYLVKGKEQRAKMDCTRIKGHSYIYWYYKKLGEELKFLVYFQNADIVDKTDKIDKNISAKCLPNVPCTLEIQSSQLADSAVYFCASSQ
Cricetulus griseus V253 trav APMK01175148.1 2101 VSRGEQVEQHPSFLSVQEGGNALINCTYTDSTNYYFYWYKQEPGAGLQLLINVLSNMDRKEEQGVIFLLNKKDKRLSLNITAAHPGDSATYFCAVS
Cricetulus griseus V263 trav APMK01182082.1 1365 GVKGMQVEQNPPSLSLQEGAGSALRCNFSLTMTNAQWFRQNPGGSLIRLFFMTPGTKENGRLKSIFDSKERYSTLHIRNAQLEDSGTYLCAAD
Cricetulus griseus V267 ighv APMK01188099.1 356 VHCEVQLVESGGGLVKPAGSLKLSCVASGFTFSNYFMDWVRQAPGKGLEWVAHIETKSYNYATYYADSVKGRFTISRDDTQSMAYLQMNNLRTEDTAIYYCAS
Cricetulus griseus V270 trbv APMK01191166.1 6037 HMEAAVTQSPRSKVTVTGRKVELSCHQTNNHDNMYWYRQDPGHGLRLIHYSYGANNTEKGDVPSGYKATRPRTEDFSLVLEVASSSQTAVYFCASS
Cricetulus griseus V273 ighv APMK01197316.1 1242 VHSQIQQQQSVAEVVRPGASVKVSCKASGYTFSYDYMHWVKQKPGQGLEWIGGIFTGIGIANYGQKFQGKATLTADTSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V279 trbv APMK01199994.1 6641 PVDPRIVQTPKYLVTVTGNEKTLTCKQYLNHNAMYWYRQSAKKSLELMFAYSYQRLVDNQTVPHRFQTHNPEKSLLELQISALENDDSATYFCASSQ
Cricetulus griseus V280 trbv APMK01199994.1 8350 HTGPKVIQMPSHQVILVGQKVTLSCDPVSNHLYFYWCKQNLEQQMEFLVSFYDGKTMDKSELFKEDSFSVERQDDSYFTLKIQPTTLKDSAVYFCASSL
Cricetulus griseus V281 trbv APMK01199994.1 17373 PLETVVFQTPRYLVTRVGNKASLKCDQTLNHDTMYWYKQDSKQQLKVMFSYNNKQLIINESVPSRFSPQSPDKAHLNLHVKFIEPDDSAVYLCASS
Cricetulus griseus V282 trbv APMK01199994.1 21049 LTDTKILQTPRYLVMGRANNKSLKCEQQLGNNAMYWYKQNAGQPPELMFLYNLKQLILNETVPSRFFPECPDTSQLFLHLSALEPEDSAVYFCASSK
Cricetulus griseus V283 igkv APMK01200074.1 17682 ARCDIQVTQSPSTLPASLGDRVTITCKASQNINNYMSWYQQKPGEVLKLLIYSASTLQSGVPTRFSGSGSGTDYSFTISSLEPEDAAVYYCLQSYSY
Cricetulus griseus V290 trav APMK01203078.1 2475 IVGDAKTTQPSSMESTEEETVHLPCSHSTISGNEYIYWYRQAPLRGPEYVIHGLQQNTSNRMAFLAIPSDRKSSTLILPHVSLRDAAVYHCILRV
Cricetulus griseus V291 ighv APMK01207963.1 731 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITTSVYDWNWIRQFPGNKLEWMGAITYGGGTGYNPSVKSRISITRDTSKNRFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V292 ighv APMK01208593.1 361 DLSQIQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYWIWIGQSRGKKLEWMGYITHSGDAVYNPSMRSPISITRETSKNQFFLQLNSVTTEDTATYYCAQ
Cricetulus griseus V301 trav APMK01216270.1 357 VSRGEQLEQQPSLLSVQEGGGIFINCTYKATAPSFFSWYKQEPGAGLQLLIKILSNVDRKEEQGLIVLLNKKDKRLSLNITAAHPGDSATYFCAES
Cricetulus griseus V302 ighv APMK01216843.1 992 VRCEVKLVESGGGLVKPGGSLKLSCAASGFTFSDYWMSWFRQAPSKGLEWVAEINGDSSTTKYAPSVNGRFTISRDNDKNTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V304 trgv APMK01219500.1 37020 RQTSPNLEERIKSIVRPMGSSFIIPCDIHITNSYIHWYLFQKGKAPQHLLYYNLFISQTVVDFGLSSKKYHVYEGTDKIYKFGLRNVEESDSGLYYCASWA
Cricetulus griseus V305 trgv APMK01219500.1 46318 GLGNLEQPAISISRTKDESVQISCKASINSFKSVAIHWYRQKPNQGLEFLLYVIATPTHILLDEKYKKMEASKNSSASTSTLTIYSLKEDDEAIYYCSYG
Cricetulus griseus V307 ighv APMK01221163.1 176 AAGGVWGWPGEAWGSLKISCAASGFTVSNYLMDWFHQAPGKGLEWVGYINKDGSTTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCPRE
Cricetulus griseus V308 ighv APMK01221163.1 4716 VHSQVQLQQSGAELVRPGASVKLSCKTSGYTFTEYTMHWVKQRPGQGLEWIGWIYPGDGDTKYNQKFQGKATLTADKSSSTAYMELRSLTSEDSAVYYCAR
Cricetulus griseus V309 trav APMK01221797.1 2479 VSSQQKVQQTPESLSVPEGAMASLNCTFSDRASQYIWWYRQHPGKSPKALMYVISNGEKEEGRFTAHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V310 trav APMK01221797.1 7963 KINGDSVTQTEDLVTVSEGSPVMLSCTYQTTDSAPTVFWYIQYLSKAPQLLLKSFTDNKRTEHQGFHATLHKTNSSFHLQKSSVQLSDSALYYCALS
Cricetulus griseus V315 ighv APMK01225035.1 1635 VHSQILLHQSSAELVKPGASVKLSCKASGYTFTSHYMSWVKQKPRQGLEWIGWIDPGNSGTGYNLNFQHKATLTVDTSSSTAYMELSSLTFEDSAVYYCA
Cricetulus griseus V320 ighv APMK01228566.1 740 VHSQVQLQQSGAELVKPGASVKLSCKASGYTFTSYYMSWVKQKPGQGLEWIGYIYPGNGGTNYNQKFQGKATLTADKSSSTAYMELSSLTSEDSAIYYCA
Cricetulus griseus V327 trav APMK01231542.1 7155 VNSQQKVQQNPESLIVQEGAMASLNCTSSDRSNSDYFWWYRVHPGKGPKALMSIFSNGKKEEGRFTAHLNKASLHLSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V335 trbv APMK01240471.1 1966 AANPGVIQTPRHLIKAQGGRSILKCIPMSGHNNVAWYQQPLGQELKFLIQHYEKMEREKGDMPNRFSAQQFSDYHSEMNMSALQLEDSAVYFCAS
Cricetulus griseus V336 trbv APMK01240471.1 4463 HMEAAVTQSPRSKVTVTGQKVELSCRQTFNHNYMYWYRQDPGHGLRLIHYSYGPDNTEKGDVPDGYKATRPQQASFSLVLEVASPSQTAVYFCASSD
Cricetulus griseus V348 ighv APMK01243728.1 2139 VHSQGHLQQSASELRAPGAAVKVTCKDSDPNDFPIAYMNWVRQKPGHGLEWIGNILPSIGRTNYGQTFEDRATLTADTQLNTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V349 ighv APMK01244126.1 182 VHCEVQLVESGGGLVKPGASLKLSCAASGFTFSDYWMHWVRKTPGKGLEWVGEINYDGSTTNYAPSVKGRFTISRDNAKNTLYLKMNSVKSEDTATYHCVR
Cricetulus griseus V350 ighv APMK01246660.1 914 VQCEVQLVESGGGLVKPGGSLKLSCVASGFTFSDFWMHWVRQAPGKGLEWFGEIMYDGSTTRYAPSVMGRFTISRDNAKNTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V351 igkv APMK01248310.1 612 ACGDIVMTQSPSSLALSAGEKVTISCRSSQSLYHSGISKNLLAWYQQKPGQSPKLLIYYASTRLAGVPDRFTGTGSGTDYSLTISSVQAEDMGHYFCQQGLNNP
Cricetulus griseus V358 trav APMK01252170.1 6378 GNRAQTVVQPDAHLTVSEGASLELKCSYSYGATPYLFWYIQYPGQSLELLLKHFGGDTLVKGIKAFEAEFMKSNSSFNLRKKSAHWSDSAKYFCALS
Cricetulus griseus V360 trav APMK01253709.1 1669 ESQGEKVEQLPSILSVQEGASAAINCTYTDSAAVYFPWYKQEPGKHPQIIIDIRSNVERKQSQRLTLLLDKKDKQLSLYITDTQPGDSAIYFCAAD
Cricetulus griseus V361 ighv APMK01254938.1 2192 PASRVRTWPGEALSVTLPHLLCHWLLHHQWIWWIWIRQSRGKKLEWMGYITHSADAVYNPSMRSPISITRDTAKNQFFLQLNSVTTEDTATYYCAGD
Cricetulus griseus V369 trav APMK01261225.1 6304 ASMAQTVTQPQQEKFVQETESATLDCTYDTSDTNYNLFWYRQQRGQMTLIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDLQLEDAAMYFCALMRR
Cricetulus griseus V371 ighv APMK01262424.1 5329 VQCEVKLVESGGGLVQPGKSLKLSCAASGFTFSNAWMSWVRQAPGKGLEWVVQIKHKSNNYATHYVESVRGRFTISREDSQSSLYLQMNNLRAEDTAIYFCAA
Cricetulus griseus V373 trav APMK01264708.1 1435 VSSQQNVEQTPESLSVPKGAMASLNCTFSDQNSLYFWWYRQYPGKGPKALISIFSNGEREEGRFTAHLNKASLHISLHIRDSQPSDSAVYLCAV
Cricetulus griseus V378 trav APMK01269670.1 4669 GVKGMQVEQNPSALSLQEGASSALKCNFSTTMRSVQWFRQNSLGSLISLFYLAPGTKDNGRLKSTFDSKERYSTLHIRDAQLEDSGTYLCAAE
Cricetulus griseus V379 trav APMK01269670.1 18160 GTDGDSVTQKQGQVTLSEDDFLLINCTYSATGYPTLFWYVQYPGKGLELLLKVTTANNKGSSRGFEATYDQGSTSFHLQKASVQESDSAVYYCALS
Cricetulus griseus V389 trav APMK01273227.1 42 VKGQQVKQSPVSLVLQEGESAELQCNFSTTATQMQWFHQSRGGHLISLFSSPSGTKQNGRLTSTTVTQERRSSLYISSSQTTDSGTYFCAMNAQCS
Cricetulus griseus V393 igkv APMK01274396.1 2493 GRCDIQMTQTPSSLSASVGDRVSITCKASEDIFDALSWYQQKPGKAPKLLIYYANSLEDGVPSRFSGSGSGTQFSLKISSLEAEDAGIYFCHQGYNPP
Cricetulus griseus V404 trbv APMK01281103.1 2496 HTDAGVTQSPRHEVAEKGQTVSLTCEPVSGHNDLFWYRQTNIQGLELLSYFRSKSLMEDDKTGKDRFTAEVLDSSVSILKIKPTEPQDSAVYLCASSL
Cricetulus griseus V405 trbv APMK01281103.1 10008 TMQDEVTQTPKFLIGRPGQSLTLECKQDFNHDTMYWYRQDPDKGLRLIYYSITEKDIQKGELSEGYDVSREKKQLFPLTVTSAQKSHKAVYLCASSL
Cricetulus griseus V427 trav APMK01301870.1 4000 VSGQANTVIQSPSILDIWEKETAVINCTYTNAAFNYFPWYKRDGRRGLTLLADIRSNVNRRTEGRFTVMLDKNARLVSLHITAAQAGDSASYLCAS
Cricetulus griseus V429 trgv APMK01302043.1 905 ASGSSPTSHLMPYITKKKGNTAFLECLIKTSVLNHNTYVHWYRQKPGQPPKRMLYISSKENTVYEEGFSKERYEAKKWHSDLSSILRIHQVTEEDTGIYYCAWWD
Cricetulus griseus V430 trgv APMK01302043.1 2649 GDSWISQDQLSSTRNPNKTVHISCKLSGVPLQNTIVHWYQMKEGESLKRIFYGSAKNYKQDKPNSRLEAYENDGTFYLIINNVITADEATYYCACWD
Cricetulus griseus V433 ighv APMK01306927.1 456 VQCEIQLQESGSKLVRPGSSVKVSCKVSGYNIIEYYMHWVKQKTGQGLEWMGSFNPRTGSTNYAQKFQGRVSMTSDTSSSTAYMEFSSLTSEDSAVYYCAR
Cricetulus griseus V434 ighv APMK01307795.1 489 VQCEVKLVESGGGLVKPGGSLKLSCAASGFTFSDYWMTWFCQAPGKRLEWVGEINKDSSTTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCA
Cricetulus griseus V438 trav APMK01310592.1 1145 IKSQQEKETPQALSTQEGENVTMNCSYKAYSAVVQWYKQDSDRGPVLLILMRSNEREKQSGRLKATFDASTQSSSLSITAARPEDTAAYFCATD
Cricetulus griseus V439 trdv APMK01310592.1 6165 ASMAQKVTQAQNSISVMEKKTVTLDCGYETRESTYYLFWYKQTTSGEMVFLIRQESYKEENATKGRYSLNFQNSESSIRLIITAAQIEDSAVYFCAMRE
Cricetulus griseus V446 ighv APMK01314430.1 786 VLSQIQLQESGPGLVKPSQSLFLTCSVTGYSITSGYYWIWIRQSRGKKLEWMGYITHSGDAVYNPSMRSPITITRETSKNQFFLQLNSVITEDTATYYCTR
Cricetulus griseus V448 ighv APMK01315006.1 395 VHSQVQLQQYGPELVRPGASVKISCKTSGYTFTDGYMQWVEQKPGQGLEWIGRIDPDSGNTKYNQKFQGKATLTRDKSSRTAYMELSSLTSGDSAVYYCAR
Cricetulus griseus V452 trav APMK01000816.1 12441 LSQGEQVEQLPSILSVQDGDSAVINCTYTDSGSSYFPWYKQGPGEHPKLIIDIRSTMERKQDKRLIVLQFKKAKHFSLHITDTQPGDSAMYFCATD
Cricetulus griseus V453 trav APMK01000816.1 10846 KSNGDSVAQTEGLVTVTEGSPVMLNCTYQTIYSGPVVFWYVQYLNKAPQLLLRSATENKRTEQQGFHATLHKRNSSFHLEKSSMQLSDSALYYCALS
Cricetulus griseus V454 trav APMK01000816.1 3415 VKGQQVKQSPVSLVLQEGERAELQCNFSTTTKQVQWFHQNPRGHLISLFYNPSGTKQRGRLTSTTVTQERRSSLFISSSQTTDSGTYFCAIDAQCS
Cricetulus griseus V459 igkv APMK01002752.1 5584 SIGDIVLTQSPASMPVSVGKKATISCKSSNRVDEYGIDLVQWYQQKPGQPPKLLIYAASNLAPGVPARFSGSGSGTDFTLTIHPVETDDAATYYCQQSKELP
Cricetulus griseus V462 trav APMK01005136.1 3459 RSNGDSVTQTDGLVTATEGSPVKLNCTYQTTVPAPTVFWYIQSLNKAPHLLLKSFTDNKRTEHQGFHATLHKSNSSFHLQKSSVQLSDSALYYCALS
Cricetulus griseus V463 ighv APMK01005144.1 895 VQCEVQLVESGGGLVQPGKSLKLSCAASGFTFSDAWMNWVRQAPGKGLEWVAQIGTKGNNYVTYYVESVKDRFTISRDDSKSSLYLQMNILRAEDTAIYYCTR
Cricetulus griseus V466 trav APMK01007504.1 1606 RSSGDSVTQTGQVTVTEGSPVMMNCTYQTIDLTPTFFWYVQGLNKAPRLLLRSSTDNKQTEQQGFHATLHKSNSSFHLQKSSVQLSDSALYHCALT
Cricetulus griseus V469 trdv APMK01010819.1 16124 SILGQKVTQVQSTASSQEGEEVNLDCSYETSQNLYHVLWYKQLLSGEMVFLIRQISFSTQSERSGRYSIIFQKSAKSVSLVISASQIEDSVTYFCALWEQ
Cricetulus griseus V470 trav APMK01011201.1 11969 VSSQQKVQQTPESFSVPEGAMASLNCTFSDQNSLYFWWYRQYPGKGPKALMSIFSNGEREEGRFTAHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V471 trav APMK01011201.1 5639 KINGDSVTQTEGLVTVTVESPVMLSCTYQTISSAPTVFWYVQFLNKAPQLILMSFTDNKRTEKEGFHATLHKSNSSFHLQKSSAQLSDSALYYCALS
Cricetulus griseus V473 trav APMK01014238.1 3516 VSSQQKVQQTPGSLSVPEGDTASLNCTFSDRASQSFWWYRQHPGKSPKALTSIFTDGKNEEGRFTARLNRASLHLSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V483 igkv APMK01022580.1 3524 ICGDIMLTQSPSSVAVSEGEKVSINCKASQNLFGSNSKKNRLAWYQQKAGQSPKLLIYWGSTRHTGVPDRFVGTGSETDFTLTISSVQAEDMGDYYCLQDHTSP
Cricetulus griseus V485 iglv APMK01025938.1 1522 AISQFAVIQESSLTTTPGGTVTLTCGSSTGAVTTNNYANWVQEKSQEVHTGLIGGTSNRVPGVHARFSGSLLGDKAALTITGAQPEDEAVYYCAL
Cricetulus griseus V491 iglv APMK01030787.1 8225 GISQAIVIQASSLTTSPGGTVTLTCGSSTGAVTTNNYANWVQEKPNQVHTDMIAATSRRATGVPAQFSGSLLGDKAALTITGAQPEDEGIYYCALWNGDH
Cricetulus griseus V495 trav APMK01033504.1 5108 DVQAQSVTQRDAHVTVIEGDSVELRCNYSYGGASYLFWYMQRHGHNIQFLLRYYSGDPVVHGLNGFEAEFRKSDSSFHLKKASVDLSDSAVYFCALS
Cricetulus griseus V498 ighv APMK01036121.1 1718 AAGRVGGSLGEAWKVPETLLCSLWIHFSDYWTNWVCRAPGKGLEWVAQIRNKDYNYATYYGESVKGRFTNSRDDSKSSLYLQMNNLGAEDTAIYYCA
Cricetulus griseus V499 ighv APMK01036726.1 1892 VYSQVELHQSDPQLVKPGFSGKLSCKASGITFTDYYVYWVKQRPGQGLELVGDIDPENGETDYNQKFQGKATITADTSSSTAYMELSRLTSEDSAVYYCA
Cricetulus griseus V500 ighv APMK01037176.1 1780 VHCEVQLVESGGGLVKPAGSLKLSCAASGFTFTEYAMSWVRQAPGKGLEWVARIRTKPNNYATYYADSVKGRFTISRDDSQSMAYLQMNNLRPEDTATYYCTA
Cricetulus griseus V514 ighv APMK01048799.1 998 VQCEVQLVESGGSQVKPGGSLKLSCAASGFTFSDYWMDWVCQAPGKGLEFVGEINKDSSYTRYAPSMKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCSR
Cricetulus griseus V527 ighv APMK01055672.1 2472 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITTSGYGWSWIRQFPGKKLEWMGYIGYDGGTDYNPSLKSRISITRDPAKNQIFLQLNSVTTEDTATYYCAR
Cricetulus griseus V536 trav APMK01060986.1 2333 SFAGDSRAQSVTQPQARITITEEASLQLRCNYSSSVAPYLFWYVQYPRQGLQLLLKYYSGEPVVRGLRGFEAEFSKSDSSFHLKKASVHLSDSAVYFCALG
Cricetulus griseus V547 ighv APMK01074398.1 1630 VQCEVKLVESGGGLLKPGGSLKLSCVASGFSFSHSWMHWVRQAPGKGLEWLVYINYDGSTTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCSR
Cricetulus griseus V550 trav APMK01077707.1 319 DIQAQSVTQHDAHVTVFEGDSVELRCNFSYIGVPYLFWYMQSPSHSLQFLLKYISGDPVVHGMNGFEAEFQKSKSSFHLKKASVHLSDSAVYFCALN
Cricetulus griseus V564 ighv APMK01083833.1 1782 VHCGVQLVESGGGLVKPAGSLKLSCAASGFTFTDYAMNWVSQAPGKGLEWVAHIRSKHYNYATYYADSVKGRFTISRDDSQSMIYLQMNNLRTEDTATYYCTA
Cricetulus griseus V572 igkv APMK01090754.1 11384 STGDIVLTQSPATLTRSLGQSATISCKASQSVSIGPINFMHWYQQKPGQPPRLLIYGASNIESGVPARFSGSGSGTDFTLTIHPVEADDAATYFCQQSRERP
Cricetulus griseus V582 ighv APMK01103377.1 1337 VQCEVQLVESGGGLVQPGKSLKLSCAASGFTFSGAWMNWVCQAPGKGLEWVAQIRIKPDNYATYYGESVKGRFTISRDNSKSSLYLQMNSLRAEDTAIYYCA
Cricetulus griseus V587 trdv APMK01112540.1 6640 SILGQKVTQVQSTTSTREGEEVSLDCSYETSQKLYHLLWYKQLLSGEMIFLIRQISSWPQNEKSGRYSVIFQKSAKSIGLVISASQMEDSGTYFCALLEW
Cricetulus griseus V594 ighv APMK01118001.1 373 VLSQIQLQESGPGLVNPSQSLYLTCSVTGYSITSGYYWHWNRQSPGKTLEWMGYIYNGGTYYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V598 trav APMK01121289.1 9617 ESNGDSVTQTEGQVTLSEGTSVTVNCSYETQQYPALFWYVQYPGEGPQLLFRVSKANEKGSSRGFEATYDKESTSFHLQKASVQESDSAVYYCALS
Cricetulus griseus V599 trav APMK01121289.1 3231 RTHGDSVTQTGEQVTISEGEFLTINCTYSITSIAYPAHFWYVRYPGESLQLLLKVLTAGEKGSSRGFEATYDKGSKSFHLQKASVQESDSAEYYCAVG
Cricetulus griseus V600 trav APMK01121289.1 735 AAGKTQVEQSPQSLTVLQGENCTLQCSYTVSPANNLRWYRQDTARGLVPLAIITHRENSKSNGRYSATMNRDARHSTLHITASHLEDTASYICVVG
Cricetulus griseus V603 iglv APMK01123309.1 2746 TISQAAVIQESSLTTSPGGTVTFTCASRTGAVTTSNYANWVQEKSHQVHTGLIGGTTYRAPDVPARFSGSLIGDKAALTITGAQPEDEAIYYCALWYSDQ
Cricetulus griseus V604 trav APMK01124387.1 2915 ESNGDSVTQTEGQVTLSEGTSLTVNCSYETKQYPALFWYVQYPGEGPQLLFRASKANEKGSSRGFEATYDRESTSFHLQKASVQESDSAVYYCALG
Cricetulus griseus V606 igkv APMK01127510.1 1362 GRCDIQMTQTPSSLSASVGDRVSIACKASEGISDELSWYQQKPGKAPKLLIYYANSLEDGVPSRFSGSGSGTQFSLKISSLEAEDAGIYFCQQGYNPP
Cricetulus griseus V611 igkv APMK01130696.1 14801 ICGDIMMTQSPSPVAVSEGERVSINCKASQNLFGSNTKKNHLAWYQQKAGKSPKLLIYWGSTRHTGVPDRFIGSGSETDFTLTISSVQAEDMGNYYCMQFYNTP
Cricetulus griseus V618 trav APMK01135169.1 1139 FFAGDSRAQSVTQPQARITVTEEASLQLRCNYSSSMTPHLFWYVQYPQQGLQLLLKYYSGEPVVPGLRGFEAEFSKSDSSFHLKKASVHLSDSAVYFCALS
Cricetulus griseus V625 ighv APMK01142769.1 2986 VQCEVQLVESGGGLVQPGGSLKLSCAASGFTFSDYYMNWVRQPSGKGLEWIAVSRNKDNSYSAEYSASVKGRFTVSRDNSKSILYLQMNSLKPEDTATYYCAKL
Cricetulus griseus V627 ighv APMK01148194.1 1131 VHCELQLVESGGGLVKPAWSLKVSCATSGFTFTDYAMRWVRQSPGKGLQWVASISTKPNNYATYYSDSVKGRFTISRDDSRRMVYLQMNNLRTEDTATYYCTA
Cricetulus griseus V648 trav APMK01166048.1 1699 VSSQQKVEQTPESFSVPEGAMVSLNCTSSDRNSDYFWWYRQYPGKGPKALMYVISNGEKEEGRFKAHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V649 trav APMK01167157.1 977 AAGNSQVEQSPQSLAVLQGENCTLQCSYTVGPFNNLRWYRQDTGRGLVSLAVMTHRENRKSKGRYSATLNTDVKHSALHITASQLEDTASYICVVG
Cricetulus griseus V650 ighv APMK01167255.1 1531 VHCEVQLVESGGGLVKPAGSLKLSCVSSGFTFSNYFMNWVRQAPGKGLEWVAQIDTKSYNYATYYADSVKGRFTISRDDSQSMAYLQMNNMRTEDTATYYCAS
Cricetulus griseus V660 iglv APMK01172576.1 2289 SFSQPVLTQSPSASASLGASVKITCTLSSQYSTYPIRWYQQHPDKAPKYVMYLYNDGSHSKGDGIPDRFSGSSSEAHRYLSISNLQLEDEAVYYCDIYG
Cricetulus griseus V677 trav APMK01181558.1 7722 VSSQQKVQQTPESLSVSEGDTASLNCTFSDSASQYFWWYRQHPGKGPKALVSIFSNGEREEGRFTVHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V678 trav APMK01181558.1 3099 VNSLQGEEKPWTLSIPEGENVTVNCSYKTSITTLQWYRQYSGKGPAMLILIRSNEKEKQSGRLRVTLNTSTQSSSLSIKASRPEDTAAYFCATE
Cricetulus griseus V680 trdv APMK01182081.1 8235 SILGQKVTQVQSTASSQEGEEVNLDCSYETSQSFYHLFWYKQLHSGEMVFLIRQISSVTQSEKSDRYSVIFQKSAKSISLVISASQIEDSVIYFCALWEL
Cricetulus griseus V682 trdv APMK01185137.1 1352 KDALCITLTQDSSDKTVTSGSQVTLFCTYDVNFYNLDLFWYRKRQDLSFQFILYRDDTRSHDAEFVQGRFSVKHSKVYRTFHLVINPVWLEDSGTYYCALG
Cricetulus griseus V696 igkv APMK01193437.1 2012 ACADIVMTQTPSFLAVSAGERATISCKSSQSLLSSANQKNYLNWYQQKAGQSPKLLIYLASTRYTGVPDRFTGSGSGTDFTLTISNIQAEDMADYYCMQDYSAP
Cricetulus griseus V697 ighv APMK01194351.1 3154 VQCEAQLVESGGGLVKPGGSLKLSCVASGFPFSIEEMHWVRQAPGKGLEWVGNIYDGSTTKYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCAK
Cricetulus griseus V700 ighv APMK01198637.1 359 VLSQIQHQESGPGLVKPSQSLSLTCSVTGESITTSGYRWNWIRQFPGKKLEWMGNISYGGGTNYNPSLKSHISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V723 trav APMK01211747.1 5240 GVRGVEVEQNPSALSLHEGTNSTLTCKFSTAVNAVQWFQQNPRGSLINLFYMVLGTKENGRLTATFDSKELYSTLHIRDAQLEDSGTYLCAVR
Cricetulus griseus V747 ighv APMK01237834.1 1189 VHCEVQLVESGGGLVKPAGSLKLSCAASVFTFTDYAFHWVRQAPGKGLEWVARIRSKSNNYATNYADSVTGRFTISRDNSQSMVYLQMNNLRTDDTATYYCTT
Cricetulus griseus V757 ighv APMK01246015.1 1613 VHSQVQLQQSGPELVKPGSSVKMSCKASGYTFASSVMHWRKKKPRQSLECIGYVYPENGGTSCNQKFQGKATLTAETSSSTVYKDLRSLSAEDSAVYYCAR
Cricetulus griseus V768 ighv APMK01257374.1 334 VQCEVQLVESGGGLVKPGGSLKLSCVASGFTFNDHYMNWVRQAPGKGLEWVGYINYDGSTTRYAPSVKGRFTISRDNAKYTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V783 ighv APMK01267628.1 1075 YSEGVWPWAVTAFPDSQSETCSFSGFSLSTSNTAVGWIPQPSGKGLEWLANIWWDDDKRYNSNLKSRLTISKDTSNNRVTLKIFSVDTADTAIYYCAQR
Cricetulus griseus V787 ighv APMK01272153.1 1089 VHSQVQLQQSGAELVKPGSSVKLSCKTSGYTFTDYAMHWVKQKPGQSLEWIGWIVPIIGIANYGQKFQGKATLTRDKSSSTAYMELSSLTSEDSAVYYCGE
Cricetulus griseus V788 ighv APMK01272464.1 3461 VHSKVQLQQSGAELVKSESSVKLSCKASGYAFTGYYVHWVKQRPGYGMEWIGYIGCGVGSTGYNQKFQGKTTLTVEKFSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V791 ighv APMK01273829.1 2803 IHCQILLHQSSAELVKPGASVKLSCKASGYTFTSHYMSWVKLKPRQGLEWIGWIDPGNSGTGYNQNFQHKATLTVDTSSSTAYMELRGLTSEDSAVYYCAR
Cricetulus griseus V792 ighv APMK01278099.1 860 VHSQVQLQQSGPELVMPGASVKISCKTSGYTFTIGYMHWVEQKPGQGLEWIGRIDPDSGNTQYNQKFQGKATLTREKSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V794 ighv APMK01279676.1 20032 VHSHVQLQQSGAEVAKPGASVKLSCKASRYTFTSHYMSWVKQKPGQGLEWIGWIGGGSGDTDYNQRFQGKATLTRDKSSSTAYMELKSQTSDKAAVYYCTR
Cricetulus griseus V808 iglv APMK01293030.1 3731 SMALYTLTQPPLVSVALGQTATITCSGDKLSDKSVHWYQQKTGQAPVMVIYRDSNRPSGIPDQFSGSNSGNMATLTISKAQAGDEADYYCQCWD
Cricetulus griseus V810 igkv APMK01295880.1 1344 SNGHVVLTKYPASLVMFLGNRATISCKASQNVTIGPIDFMSWYQQKPGQGHKLLIYGASKLASGVHTRFSGSGSGTDFSLTIHPVEADDVATYYCQQGLVVP
Cricetulus griseus V811 ighv APMK01297245.1 1430 VQCEVKLVKSGGGLVQPGKSLKLSCAASGFTFSNAWMNWVLQAPGKGLEWVAEIRDKSNNYATSYRESVRGRFTISREDSQSSVSLQMNSLRAEDTAIYFCSA
Cricetulus griseus V835 trav APMK01316636.1 465 KSNGDSVTQTEGLVTVTEGSPVMMTCTYKTTYSDISLFWYVKFLNKAPQLLLRTATDNKRTEHQGFHATLHKSNSSFHLHKSSVQLSDSALYYCALR
Cricetulus griseus V9 ighv AFTD01056743.1 5587 VLSQLQLKEKGPSLVKPSETLSLTCTVSGFSLTSYHVIWVHQPPGKGPEWMGVMWNSGGTDYNSALKSPVTITRDISKSHVFLKLNNLQTEDTATYYCAR
Cricetulus griseus V10 ighv AFTD01056747.1 4869 VLSQVQLKESGPGLLQPSQTLSLTCTVSGFSLTSYHVIWEHQPPGKGLEWMGGIGYDGSPAYNSSLQSQVSITRDTSKSQVFLKLNKLQTEDTAMYYCAR
Cricetulus griseus V11 ighv AFTD01056756.1 2775 QLVESRGQGRGLVKPGKSLTLSCESSGFTFSDYEMAWVHQAPGKGLERVACISTVGGAMHADAVKGRFTISRDNAKNALYLQMNNLKSEDTATYYCA
Cricetulus griseus V15 igkv AFTD01057944.1 968 ICGDIVMTQSPSSVAVSAGERVSINCNSSQNLFGNKTKKNCLVWFQQKPGQSPKFLIYWASARHTGVPDCFIGSGSETDFTLTISSVQAEDLADYYCMQDHIYP
Cricetulus griseus V19 ighv AFTD01060060.1 31371 VHSHVQLQQSGAEVAKPGASVKLSCKASRYTFTSHYMSWVKQKPGQGLEWIGWIGGGSGDTDYNQRFQGKATLTRDKSSSTAYMELKSQTSDKAAVYYCTR
Cricetulus griseus V20 ighv AFTD01060219.1 1777 VHSQVQLQQSGAELGRPGASVKVSCKASGYTFSYENMHWVKQKPGQGLERIGSIFTYNGDTQYNQNFQGKATLTADTSSSTAYMELSSLTSEDSAVYYCVR
Cricetulus griseus V50 ighv AFTD01069253.1 8724 VLSQVQLQESGPGLLKPSQSLSLTCTVTGYSISSGYWWHWICQRPGKRLEWMGRIYNNGNTYYNPSLKSRITMTVDTSKNQFSLRLSSVTTEDTAVYYCAR
Cricetulus griseus V51 ighv AFTD01069254.1 2292 VHSQVQLLQSGAELVKPGSSVKLSCKTSGYTFTSYYIEWVKQKPGQGLKWVGRNDPENGNTKYAQKFQVKATLTADTSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V52 ighv AFTD01069254.1 5121 VLSQIQLQESGPGLVKPSQSLSLTCSVTDFSIITSGYYWSCIRQFPGKKLEWMGYIDNGGGTDYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAG
Cricetulus griseus V53 ighv AFTD01069254.1 8882 VHSQVKLKPSEAELVKPGASVKLSCKTSGYTFIYEYIHWVKQKPGQGLEWIGSFFPNTGYTDLNQKFKGKAKLTADKSSSTAFMELRSLISEDSAAYYCA
Cricetulus griseus V54 ighv AFTD01069254.1 18145 AAGGVGGGGGLVQPGKSLKLSCAASGFTFSSYWMNWVRQAPGKGLEWVAQIRDKSNNYAIHYVESVKGRFTISREDSQISLYLQMNNLRAEDTAIYYCTR
Cricetulus griseus V55 ighv AFTD01069254.1 23241 VLSQIQLQESGPGLVKPSQSLSLTCSVTRHSITTSGYWWHCIRQFPGKKLAWMGGIRYDGGNRYNPSVKSRISITRDTAKNQFFLLLNSVTTEDTATYYCAR
Cricetulus griseus V56 ighv AFTD01069255.1 8275 VLSQVQLLQSESELGRPGSALKLSCKTSGYTFTTFTMNWVKQRPGQGLEWIGRIYAENGHTDYAQKFRGKATLTVDKSSSTAYLELSSLTSEDFSMYYCA
Cricetulus griseus V57 ighv AFTD01069255.1 13532 VQTQIQLVQSGAEVKQPGQSVKISCKASGYTFTEQGMQWLKQAPGQDIKWMGWINTNTGKTTYADDFTGQILFSLDTSVSTAYLQINSLKNEDTAIYYCTR
Cricetulus griseus V58 ighv AFTD01069260.1 9486 VQCEQHLVYSGGDLVQPGGSLTLSCVASVFTFTSNWMKWVRQAPGKGLEWVADINGDSRAKRYVPSVKGRFTISRDNGKSTLYLQLNNLKTEDTASYYCAS
Cricetulus griseus V67 igkv AFTD01070496.1 1973 ACGDIVMTQSPSSLALSAGEKVTISCRSSQSLYHSGISKNLLAWYQQKPGQSPKLLIYYASTRFTGVPDHFIGTGSGTDYSLTISSVEAEDMGHYFCQQGLNNP
Cricetulus griseus V81 igkv AFTD01076090.1 15601 SIGDIVLTQSPASMPVSVGKKATISCKSSNRVDEYGIDLVQWYQQKPGQPPKLLIYAASNLAPGVPARFSGSGSGTDFTLTIHPVETDDAATYYCQQSKELP
Cricetulus griseus V82 igkv AFTD01076094.1 769 STGDIVLTQSPATLTRSLGQSATISCKASQSVSIGPINFMHWYQQKPGQPPRLLIYGASNIESGVPARFSGSGSGTDFTLTIHPVEADDAATYFCQQSRERP
Cricetulus griseus V111 ighv AFTD01085380.1 2648 VQCEVQLVESGGGLVQPGKSLKLSCEASGFTFSSYSMDWVRQAPGKGLEWVAYISSGSSTIYYANAVKGRFTISRDNAKNTLFLQMNSVKSEDTATYYCAR
Cricetulus griseus V112 ighv AFTD01085390.1 6419 VQCEVQLVESGGGLVQPGKSLKLSCEASGFTFSSFGVNWVRQATGKELEWVASISNDGSNNYYANAVKGRFTISRDNAKNTLFLQMNNLKSEDTATYYCAR
Cricetulus griseus V125 trav AFTD01090527.1 6256 SFAGDSRAQSVTQPQARITITEEASLQLRCNYSSSVVPYLFWYVQYPRQGLQLLLKYYSGEPVVHGLSGFEAEVSKSDSSFHLKKASVHLSDSAVYFCALS
Cricetulus griseus V126 trav AFTD01090527.1 13694 LSRGEQVEQLPSTLSVQEGDSAVINCTYTDSFSSYFPWYKQEPGEHPKLIIDIRSNEERKQDQRLIVLLDKKAKHFSLHITDTQPGDSAMYFCAAS
Cricetulus griseus V127 trav AFTD01090527.1 28778 LSQGEQVEQLPSTLSVQEGDSAVINCTYTDSASDYFPWYKQGAGEHPKLIIDIRSTMERKQDQRLIVLQDKKAKHFSLHITDTQPGDSAMYFCAAS
Cricetulus griseus V128 trav AFTD01090527.1 40287 RTHAESVTQTEGKVTLSEEDFLTIHCNYSATGYPALFWYVQYPGEGPQLLFRASKANEKGSSRGFEATYDRESTSFHLQKASVQESDSAVYYCALS
Cricetulus griseus V129 trav AFTD01090528.1 11808 VSSQQKVQQTPESLSVPEGAVASLNCTFSDSASWNFWWYRQHPGKGMELLVSIMSNGEKEEGRFTAHLNKASLHLSLHIRDSQTSDSAVYLCAV
Cricetulus griseus V130 trav AFTD01090528.1 18713 VNSLQGEENPWTLSIQEGESVTMNCSYKTSIEALQWYRQDSGKGPAVIILIRSNEKKKQSGRVRVTLNTSTQSSSLSIIAARPEDTAAYFCATE
Cricetulus griseus V131 trav AFTD01090528.1 26985 DVQAQSVSQADAHVTIFEGDSVELRCNYSYGGASYLFWYMQRHGHSLQFLLKYISGDPVVQGMNGFEAEFRKSDSSFHLKKASVHLRDSAVYFCALS
Cricetulus griseus V132 trav AFTD01090529.1 4105 ESLGEQVEQQPSTLSVQEGDSAIINCTYTGSAFSYFSWNKQEAGESPQLIIDILENVDRKQSQRLTVLLNKKTKQLSLHISATQPGDTAMYFCAVR
Cricetulus griseus V133 trav AFTD01090529.1 11901 SVTPTGGQMTISEDEFLTINGTYSITSPACPALCWYVRYPGESLQLLLKVLTAGEKGSSRGFEATYDKGSKSFHLQKASVQESDSAEYYCAVG
Cricetulus griseus V134 trav AFTD01090529.1 21069 VNSQQKVQQNPESLIVQEGAMASLNCTSSDRSNSDYFWWYRVHPGKGPKALMSIFSNGKKEEGRFTAHLNKASLHLSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V135 trav AFTD01090529.1 28413 KINGDSVTQTEGLVTVTEGSPVMLSCAYQTTYSAPTVFWYVQDLNKAPQLLLKSLTDNKRTEHQGFHATLHKSNSSFHLQKSSVQLSDSALYYCALS
Cricetulus griseus V136 trav AFTD01090529.1 37216 VKGQKVEQSPVSLVLQEGERAELQCNFSTNLYQMQWFHQSPGGHLISLFSNPSGTKQRGRLTSTTVTQERHSSLYISSAQTTDSGTYFCAMDAQCS
Cricetulus griseus V137 trav AFTD01090531.1 11523 GVRGVEVEQSPSALSLHEGTNSTLTCKFSTTMNTVQWFRQNPRGSLINLFFLTPGTKENGRLTATFNSKDRNSTLHIRDAQLEDSGTYLCAVS
Cricetulus griseus V138 trav AFTD01090531.1 29732 RSNGDSVAQTEGLVTVTEGSPVMMTCTYQTTYPNIVLFWYVQYLNKVPQLLLRTATDNKRTEHQGFHATLHKSSSSFHLEKSSVQLLDSALYYCALS
Cricetulus griseus V139 trav AFTD01090531.1 32913 VKGQQVKQSPVSLVLQEGERAELQCNFSTTANQMQWFHQSPGGHLISLFYNPSGTKQRGRLTSTTVTQERRSSLYISSSQTTDSGTYFCAMNAQCS
Cricetulus griseus V146 iglv AFTD01093989.1 1760 SCAQYELTQPKSVSESLGRTVTISCKRSSGNIGNNYVHWYQQHFGSSPKTVIYEYNARPSGIPDRFSGSTDRSSNSASLTITDLQIEDEADYFCQSSGSGF
Cricetulus griseus V147 iglv AFTD01093990.1 1010 SCAQFVLTQPKSVSESLGRTVIISCQRSSGNIWNYYVSWYQQYFGSSPQIVFYEHNNKPSGVPDRFSGSIDSSSNSASLTITDLQTEDEADYFCFSYDNNY
Cricetulus griseus V148 iglv AFTD01093992.1 1784 SCAQYELTQPKSVSESPGRTVTISCKRSSGNIGSSYVHWYQQHFGSSPKTVIYEDNKRPSGIPDRFSGSIDRSSNSASLTITGLQIEDEADYFCQSSGSGF
Cricetulus griseus V149 iglv AFTD01093995.1 1446 SCAQFVLTQPKSVSESLGRTITISCKRSSGNIGGYYVSWYQQHFGSSPQTVIYEHNKRPSGVPDRFSGSIDSSSNSASLTITDLQIEDEADYFCFSYDNNY
Cricetulus griseus V150 iglv AFTD01093997.1 2000 SCAQFVLTQPKSVSESLGRTITISCKRSSGNIGGYYVSWYQQHFGSSPQTVIYEHNKRPSGVPDRFSGSIDSSSNSASLTITDLQTEDEADYFCLSYDSNY
Cricetulus griseus V151 iglv AFTD01093999.1 3892 SCAQFVLTQPKSVSESLGKTVTISCKHSSGNIGSYYVHWYQQHFGSPPKTVIYRDNERPSGVPDRFSGSIDSSSNSASLTITDLQIEDEDDYFCQSSGSGF
Cricetulus griseus V152 iglv AFTD01094006.1 2901 LCAQFVLTQPKSVPESLGRTVTISCKRSSGNIGGYYVSWYQQHFGSLPQTVIYEHNKRPSGVPDRFSGNIDSSSNSASLTITDLQTEDEADYFCFSYDSNY
Cricetulus griseus V166 iglv AFTD01098635.1 11537 SFSQPVLTQSPSASASLGTSVKLTCTLSSQHSSYFIEWYQQHPDKAPKYVMQLKSDGSHSKGDGIPDRFSGSSSGAHRYLSISNIQPEDEADYYCGVSENSL
Cricetulus griseus V167 iglv AFTD01098636.1 26493 SFSQSVLTQSPSASASLGASVKLTCTVSSEHSSYTIYWYQQHPEKAPKYVMYLNNDGSHNKGDGIPDRFSGSSSGAHRYLSITDLQPEDEAIYHCGIYDGSGG
Cricetulus griseus V168 iglv AFTD01098637.1 17881 SFSQLVLTQSPSASASLGASIKISCTLSSQHSTYSIGWLQQQPDKAPKYVMYLSSDGSHNKGDGIPDRFSGSSSRAHRYLSISNIQSEDEADYYCVSADSNG
Cricetulus griseus V169 iglv AFTD01098637.1 89926 SFSQPVLTQSPSASASLGASVKLTCTLSSEHSSYTIYWYQQHPDKAPKYVMRLKSDGSHSKGDGIPDRFSGSSSGAHRYLSITDLQPEDEAIYHCGTYSSGG
Cricetulus griseus V170 iglv AFTD01098640.1 9819 SFSQLVLTQSPSASASLGASVKISCTLSSQHSTYTIIWLQQHPDKAPKYVMYLSSDESHNKGDGIPDRFSGSSSGAHRYLSITNIQSEDEADYYCVSRDSSG
Cricetulus griseus V171 trav AFTD01098844.1 5050 LSQGEQVEQLPSTLRVQEGDSAVINCTYTDSTSYYFPWYKQGLGEHPKLIIDILSTMERKQDQRLIVLQNKKAKHFSLHITDTQPGDCARYFCAAS
Cricetulus griseus V172 trav AFTD01098844.1 6828 RSSGDSVTQTGQVTVTEGSPVMMNCTYQTIDLTPTFFWYVQGLNKAPRLLLRSSTDNKQTEQQGFHATLHKSNSSFHLQKSSVQLSDSALYHCALT
Cricetulus griseus V173 trav AFTD01098844.1 12196 VKGQQVKQSPVSLVLQEGERAELQCNFSSTSYQVQWFHQSPGGHLISLFVNPSGTKQSGRLKSTTVTQERHSSLYISSSQTTDSGTYFCAMNAQCS
Cricetulus griseus V178 igkv AFTD01100408.1 2438 SNGHVVLTKYPASLVMFLGNRATISCKPSQNVTIRPIDFMSWYQQKPVQGHKLLIYGASKLASGVHTRFSGSGSGTDFSLTIHPVEADDVATYYCQQCLVVP
Cricetulus griseus V182 iglv AFTD01103334.1 26366 SCAEVVFTQPQSVSGSLGQEISISCTRSSGNIASTYVSWYQQHSSNKPRLLIYKYDQRPSGIPDRFSGSMDTSSNSGILTISRLQPEDEGDYYCLSGYDSY
Cricetulus griseus V183 iglv AFTD01103334.1 40745 SCAQFVLTQPKSVSESLGRTVTISCKCSSGNIGSYYVHWYQQQFGSSPKAVIYENNKRPSGVPDRFSGSIDSSSNSASLTITNLQIEDEADYFCQSYDSNS
Cricetulus griseus V194 igkv AFTD01104627.1 1516 ICGDIMLTQSPSSVAVSEGEKVSINCKASQNLFGSNSKKNRLAWYQQKAGQSPKLLIYWGSTRHTGVPDRFVGTGSETDFTLTISSVQAEDMGDYYCLQDHTSP
Cricetulus griseus V202 trbv AFTD01106986.1 14005 PVDPRIVQTPKYLVTVTGNEKTLTCKQYLNHNAMYWYRQSAKKSLELMFAYSYQRLVDNQTVPHRFQTHNPEKSLLELQISALENDDSATYFCASSQ
Cricetulus griseus V203 trbv AFTD01106986.1 15714 HTGPKVIQMPSHQVILVGQKVTLSCDPVSNHLYFYWCKQNLEQQMEFLVSFYDGKTMDKSELFKEDSFSVERQDDSYFTLKIQPTTLKDSAVYFCASSL
Cricetulus griseus V204 trbv AFTD01106986.1 24758 PLETVVFQTPRYLVTRVGNKASLKCDQTLNHDTMYWYKQDSKQQLKVMFSYNNKQLIINESVPSRFSPQSPDKAHLNLHVKFIEPDDSAVYLCASS
Cricetulus griseus V205 trbv AFTD01106986.1 28434 LTDTKILQTPRYLVMGRANNKSLKCEQQLGNNAMYWYKQNAGQPPELMFLYNLKQLILNETVPSRFFPECPDTFQLFLHLSALEPEDSAVYFCASSK
Cricetulus griseus V206 trbv AFTD01106987.1 2099 PVSAGISQTPSWMILKTGQLVSVNCTQHLKHDCMFWYRQDPGLGLRLIYYSYDVSNTEKGDVSEGYSVSRSNAEDFSLTLESATHSQTSVYFCASSY
Cricetulus griseus V207 trbv AFTD01106987.1 6798 LTDAGITQTPRYWITQTGRKMVLGCSQNMGHYWMFWYRQDAGQGFRLIHYSGSVGSTTKGDVPEGYSVSRNESDHFPLTLDSTRPSQTSTYFCASS
Cricetulus griseus V208 trbv AFTD01106987.1 21513 QTKAGVSQSPIHRITKIGQNVSFWCNPISSHNSLYWYRQRWGQGPEFLAYFQNKVAPDKSGLPRNHFIERPEGSYSFLKIQPVKQEDSAVYLCASSS
Cricetulus griseus V209 trbv AFTD01106987.1 27108 AANPGVIQTPRHLIKAQGGRSILKCIPMSGHDNVAWYQQPLGQELKFLIQHYEKMERAKGDMPNRFSVQQFSDYHSEMNMSALQLEDSAVYFCAS
Cricetulus griseus V210 trbv AFTD01106987.1 29810 HMEAAVTQSPRSKVTVTGQKVELSCRQTFNHNNMYWYRQDPGHGLRLIHYSYGAGNTEKGDVPDGYKATRPQIASFSLVLEVASPSQTAVYFCASSD
Cricetulus griseus V211 trbv AFTD01106987.1 39111 AANPGVIQTPRHLIKAQGGRSILKCIPMSGHNNVAWYQQPLGQELKFLIQHYEKMERAKGDMPNRFSVQQFSDYHSEMNMSALQLEDSAVYFCAS
Cricetulus griseus V212 trbv AFTD01106987.1 41608 HMEAAVTQSPRSKVTVTGQKVELSCRQTFNHNYMYWYRQDPGHGLRLIHYSYGPDNTEKGDVPDGYKATRPQQASFSLVLEVASPSQTAVYFCASSD
Cricetulus griseus V214 trbv AFTD01106987.1 52337 HMEAAVTQSPRSKVTVTGRKVELSCQQTNNHDYMYWYRQDPGHGLRLIHYSYGAGNTEKGDVPDGYKATRPQQANFSLVLEVASSSQTAVYFCASAD
Cricetulus griseus V215 trbv AFTD01106987.1 59632 HMEAAVTQSPRSKVTVTGRKVELSCHQTNNHDNMYWYRQDPGHGLRLIHYSYGANNTEKGDVPSGYKATRPRTEDFSLVLEVASSSQTAVYFCASS
Cricetulus griseus V216 trbv AFTD01106987.1 71105 HTDAGVTQSPRHEVAEKGQTVSLTCEPVSGHNDLFWYRQTNIQGLELLSYFRSKSLMEDDKTRKDRFTAEMLDSSVSILKIEPTEPQDSAVYLCASSL
Cricetulus griseus V217 trbv AFTD01106989.1 5776 PTNAGVIQTPRSKVMEKGQEATLRCEPISGHSSVSWYKQTSVRGMEFLISFQNQEPIDNTGMPKERFSAQMPSAKLSTLKIQTTQPQDSAVYLCASSL
Cricetulus griseus V218 trbv AFTD01106989.1 11093 CVDAMVTQNPRYKVARVGKAVNLSCSQNLNHNAMYWYRQKPNQGPKFLLYYYDSTLNKEADTSDNFQSSRPNNSFCLLDIRSAGLGDSAMYLCASSR
Cricetulus griseus V219 trbv AFTD01106990.1 2489 HTDAGVTQSPRHEVAEKGQTESLTCEPVSGHNDLFWYRQTNIQGLELLSYFRSKSLMEDDKTGKDRFTAEVLDSSVSILKIKPTEPQDSAVYLCASSL
Cricetulus griseus V220 trbv AFTD01106990.1 10001 TMQDEVTQTPKFLIGRPGQSLTLECKQDFNHDTMYWYRQDPDKGLRLIYYSITEKDIQKGELSEGYDVSREKKQLFPLTVTSAQKSHKAVYLCASSL
Cricetulus griseus V222 trbv AFTD01106992.1 1212 SMDTEVIQNPRYLVKGKEQRAKMDCTRIKGHSYIYWYYKKLGEELKFLVYFQNADIVDKTDKIDKNISAKCLPNVPCTLEIQSSQLADSAVYFCASSQ
Cricetulus griseus V223 trbv AFTD01106992.1 10536 SLNGQVIQTPQHLLKGKGQKAKMSCRPENGHTFVFWYQQKQNKELNFLISFQRQEVRERTDLVKERFLAECPLNSPCSLEIQSSEAGDSALYLCASSL
Cricetulus griseus V224 trbv AFTD01106992.1 13342 FVDAAVTQTPSHLIKTEGQRATMKCNPEKGQTVVYWYQQRQNKELKFLIYFQGQQPIDQIDMVKKRFSAECPSNSPCSLEINISEVGDSALYFCASSQ
Cricetulus griseus V225 trbv AFTD01106992.1 15316 SCDAEVTQTPRYLFKAKGQVANMSCNPEKGHTVFYWYQQNQNGELKLLIYFRNEEIIEQTDSVKKRFSAKCRSNSPCSLDILSSEAGDSALYLCASSL
Cricetulus griseus V226 trbv AFTD01106994.1 15023 SAKAQVTQTPRHIITEPGKELIIACSQNLNHDSMYWYRQDLGLGLRLIYYSVNVGIIDKGAVSDGYNVSREELKAFPLTLKFTRISQTSTYFCASS
Cricetulus griseus V227 trbv AFTD01106994.1 18210 LVDMEVTQMPRYLVTRMEEGVLLECAQDLGHERMYWYRQDPDLGLRLIYFSYDVDSNSEGDIPKGYMVSRKKREHFSLILKSAQTNQTSVYFCASSL
Cricetulus griseus V228 trbv AFTD01106994.1 23330 SVFGVLLYQKPKQDICQSGTSLKIQCEVDTQVAGMFWYRQFQGQSLVLMAAANQGSEATYESGFTNEKFPISRPNLTFSTLTVNNARPEDSSFYFCSSG
Cricetulus griseus V232 igkv AFTD01108256.1 3080 VKCDIQMTQSPDILSASLGESVTITCQSSQSIYSNLAWYQQKPGEHPKLLIYAASNLADGIPSRFSGSGSGTQYSLKISSLQPEDVANYYCQQGYSYP
Cricetulus griseus V235 igkv AFTD01109618.1 7035 ICADIVMTQSPTSLAVSAGEKVTISCKSSQSLYSSTYQVNYLAWYQQKPGQAPKLLIYYASTRHTGVPDRFTGGGSGTDFTLSISSVQAEDLGDYYCVKHYRS
Cricetulus griseus V236 igkv AFTD01109620.1 2076 ACADIVMTQSPPSLTVSAGEKATVSCKSSQSLFNSNTNKNHLNWYLQKPGQSPKLLIYLASTRHTGVPDRFKGSGSGTDFTLTISSVQDEDLGDYYCQQWYSSP
Cricetulus griseus V238 ighv AFTD01113103.1 5788 VHSQVQLQQSGAELRRPGASVKMSCKTSGYTFTVYVMHWVKQKPGKGLEWVGGIDLENGDTKYAQKFQGKATLTADKSSSTVYMELSSLTSEDSAVYYCTT
Cricetulus griseus V239 ighv AFTD01113104.1 2269 VHCEVQLVESGGGLVKPAGSLKLSCVASGFTFSNYFMNWVRQAPGKGLEWVAQIETKSYNYATYYADSVKDRFTISRDDTQSMAYLQMNNLRTEATDIYYCAS
Cricetulus griseus V240 ighv AFTD01113104.1 8070 VYSQVELQQSGPQLVKPGFSVKLSCKASGYNFTDYSVNWVKQRPGQGLEWVGGIDPENGDTGYNQKFQGKATITADTSSITAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V241 ighv AFTD01113104.1 26118 VQCEVKLVESGGGLVQPGKSLKLSCAASGFTFSDAWMNWVRQAPGKGLEWVAQIRDKSNNYATSYGESVRGRFTISREDSQSRVSLQMNSLRAEDTAIYFCAA
Cricetulus griseus V242 ighv AFTD01113108.1 16 VHCEVQLVESGGGLVKPAGSLKLSCVASGFTFSNYFMHWVHQAPGKGLEWVARIDTKSYNYATYYSDSVKGRFTSSRDDTQSMVYLQMNNLRTEDTAIYYCAS
Cricetulus griseus V243 ighv AFTD01113109.1 3484 VQCEVQLVESGGGLVKPVGSLKLSCAASGFTLSGYWMYWLCQAPGKGLDWVGEINKDSSYTMYAPSVKGRFTISRDNARFSLYLQMNSVKSEDTATYYCSR
Cricetulus griseus V250 ighv AFTD01116541.1 1385 VLSQVTLKESGPGLLQPSQTLSLTCSFSGFSLSTSGLGVGWICQPSGKGLEWLSNIWWNDDKYYTPSLKSWLTISKDTSNNRVTLKITSVDTEDTATYYCARVT
Cricetulus griseus V251 ighv AFTD01116541.1 13130 VHCEVQLVESGGGLVKPAGSLKLSCVASGFTFSAAWMNGIRQAPGKGLECVAHIEPKSYNYATYYSDSVKGRFTISRDDSQSMVYLQMNNLRTEDTATYFCTR
Cricetulus griseus V252 ighv AFTD01116542.1 4714 VQCEVKLVESGGGLVKPGVSLKLSCAASGFTFSDYWMNWFRQAPGKGLEWVGDINQDSSTTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCV
Cricetulus griseus V253 ighv AFTD01116544.1 8697 VHSQVQLQQSGADLVKPGASVKLSCQTSGFNFINSYMHWVKQKPGHGLEWIGRIDPENGDTKYNQKFQGKATVTAETSSSTTYMEPSSLTSEDSAVYYCA
Cricetulus griseus V254 ighv AFTD01116546.1 5402 VLSQVTLKESGPGLVQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNSNLKSRLTISKDTSNNQVFLKITSVDTADIATYYCARR
Cricetulus griseus V255 trav AFTD01116756.1 5294 LSQGEQVEQLPSILSVQDGDSAVINCTYTDSGSSYFPWYKQGPGEHPKLIIDIRSTMERKQDKRLIVLQFKKAKHFSLHITDTQPGDSAMYFCATD
Cricetulus griseus V256 trav AFTD01116756.1 6889 KSNGDSVAQTEGLVTVTEGSPVMLNCTYQTIYSGPVVFWYVQYLNKAPQLLLRSATENKRTEQQGFHATLHKRNSSFHLEKSSMQLSDSALYYCALS
Cricetulus griseus V257 trav AFTD01116756.1 14319 VKGQQVKQSPVSLVLQEGERAELQCNFSTTTKQVQWFHQNPRGHLISLFYNPSGTKQRGRLTSTTVTQERRSSLFISSSQTTDSGTYFCAIDAQCS
Cricetulus griseus V258 trdv AFTD01116758.1 3415 SILGQKVTQVQSTTSTREGEEVSLDCSYETSQKLYHLLWYKQLLSGEMIFLIRQISSWPQNEKSGRYSVIFQKSAKSIGLVISASQMEDSGTYFCALLEW
Cricetulus griseus V259 trav AFTD01116758.1 26120 LSQGEQVEQLPSNLRVQEGDSAIINCTYTDSTLSYFLWYKQGPGEHPKLIIDIRSTMERKQDQRLIVLQDKKAKHFSLHITDTQPGDSAMYFCAAS
Cricetulus griseus V260 trav AFTD01116759.1 4466 RTHADSVTQTGGKVTLSEEDFLTIHCNYSASGYPALLWYVQYPGEGPQLLFRASKANEKGSSRGFEATYDRESTSFHLQKASVQESDSAVYYCVVG
Cricetulus griseus V261 trav AFTD01116760.1 9856 VSSQQKVQQTPGSLSVPEGDTASLNCTFSDRASQSFWWYRQHPGKSPKALTSIFTDGKNEEGRFTARLNRASLHLSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V262 trav AFTD01116763.1 1350 DVQAQSVTQRDAHVTVIEGDSVELRCNYSYGGVSYLFWYMQRHGHNIQFLLRYYSGDPVVHGLNGFEAEFRKSDSSFHLKKASVDLSDSAVYFCALS
Cricetulus griseus V263 trav AFTD01116763.1 8863 ESNGDSVTQTEGQVTLSEGTSVTVNCSYETQQYPALFWYVQYPGEGPQLLFRVSKANEKGSSRGFEATYDKESTSFHLQKASVQESDSAVYYCALS
Cricetulus griseus V264 trav AFTD01116763.1 15243 RTHGDSVTQTGEQVTISEGEFLTINCTYSITSVAYPALFWYVRHPGESLQLLLKVLTAGEKGSSRGFEATYDKGSKSFHLQKASVQESDSAEYYCAVG
Cricetulus griseus V265 trav AFTD01116763.1 17739 AAGKTQVEQSPQSLTVLQGENCTLQCSYTVSPANNLRWYRQDTARGLVPLAIITHRENSKSNGRYSATMNRDARHSTLHITASHLEDTASYICVVG
Cricetulus griseus V266 trav AFTD01116763.1 24914 VSSQQKVQQTPESFSVPEGAMASLNCTFSNSASDNFRWYRQHPGKGLELLVSIFSSGKREEGRFTAHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V267 trav AFTD01116763.1 31258 KINGDSVTQTEGLVTVTVESPVMLSCTYQTISSAPTVFWYVQFLNKAPQLILMSFTDNKRTEKEGFHATLHKSNSSFHLQKSSAQLSDSALYYCALS
Cricetulus griseus V268 trdv AFTD01116763.1 50537 SILGQKVTQVQSTASSQEGEEVNLDCSYETSQNLYHVLWYKQLLSGEMVFLIRQISFSTQSERSGRYSIIFQKSAKSVSLVISASQIEDSVTYFCALWEQ
Cricetulus griseus V269 trav AFTD01116763.1 66563 LSQGEQVEQLPSTLRVQEGDSAVINCTYTDSTSYYFLWYKQGPGEHPKLIIDIRSNEERKQDQRLIVLLDKKAKHFSLHITDTQPGDSAMYFCAAS
Cricetulus griseus V270 trav AFTD01116763.1 68285 RSKADSVTQTEGQVTITEGSPMMLSCTYQATYSGSFLFWYVQYLNKAPQMLLRSSTDKKTEHQGFHASLHKSNSSFHLEKSSVQLSDSALYYCALS
Cricetulus griseus V271 trav AFTD01116765.1 2229 FFAGDSRAQSVTQPQARITVTEEASLQLRCNYSSSMTPHLFWYVQYPQQGLQLLLKYYSGEPVVPGLRGFEAEFSKSDSSFHLKKASVHLSDSAVYFCALS
Cricetulus griseus V272 trav AFTD01116765.1 10836 GVRGVEVEQSPSALSLHEGTNSTLTCKFSTTMNTVQWFQQNPRGSLINLFYMAPGTKENGRLTATFNSKERYSTLHIRDAQLEDSGTYLCAAE
Cricetulus griseus V273 trav AFTD01116765.1 15414 LSRGEQVEQLPSTLRVQEGDSAVINCTYTDSASNYFPWYKQGPGEHPKLIIDIRSTMERKQDQRLTVLQDKKAKHFSLHITDTHPGDSAMYFCAAS
Cricetulus griseus V274 trav AFTD01116766.1 17463 LSQGEQVEQLPSTLRVQEGDSAVINCTYTDSASNYFLWYKQEPGEHPTLIIDLRSNVERKQDQRLIVLQNKKAKHFSLHITDTQPGDSVMYFCAAS
Cricetulus griseus V275 trav AFTD01116766.1 25577 RTHGDSVTQTEGKVTLSEEDILTIHCNYSASGYPTLYWYVQYPGEGPQLLFRATKANEKGNSRGFEATYNRESTSFHLQKTSVQESDSAVYYCAVG
Cricetulus griseus V276 trav AFTD01116766.1 33872 VSSQQKVQQTPESLSVSEGDTASLNCTFSDSASQYFWWYRQHPGKGPKALVSIFSNGEREEGRFTVHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V277 trav AFTD01116766.1 38495 VNSLQGEEKPWTLSIPEGENVTVNCSYKTSITTLQWYRQYSGKGPAMLILIRSNEKEKQSGRLRVTLNTSTQSSSLSIKASRPEDTAAYFCATE
Cricetulus griseus V278 trav AFTD01116766.1 50042 DIQAQSVTQHDAHVTVFEGDSVELRCNFSYIGVPYLFWYMQSPSHSLQFLLKYISGDPVVHGMNGFEAEFQKSKSSFHLKKASVHLSDSAVYFCALN
Cricetulus griseus V279 trav AFTD01116766.1 53445 ESNGDSVTQTEGQVTLSEGTSLTVNCSYETKQYPALFWYVQYPGEGPQLLFRATKANEKGSSRGFEATYDRESTSFHLQKASVQESDSAVYYCALG
Cricetulus griseus V280 trav AFTD01116766.1 68516 RTHGDSVTQTGGQMTISEGEFLTINCTYSITSIAYPAHFWYVRYPGESLQLLLKVLTAGEKGSSRGFEATYDKASESFHLQKASVQESDSAEYYCALS
Cricetulus griseus V281 trav AFTD01116766.1 71022 AAGNSQVEQSPQSLAVLQGENCTLQCSYTVGPFNNLRWYRQDTGRGLVSLAVMTHRENRKSKGRYSATLNTDVKHSALHITASQLEDTASYICVVG
Cricetulus griseus V282 trav AFTD01116766.1 83800 VSSQQKVEQTPESFSVPEGAMVSLNCTSSDRNSDYFWWYRQYPGKGPKALMYVISNGEKEEGRFKAHLNKASLHVSLHIRDSQPSDSAVYLCAV
Cricetulus griseus V283 trav AFTD01116766.1 91698 RSNGDSVTQTDGLVTATEGSPVKLNCTYQTTVPAPTVFWYIQSLNKAPHLLLKSFTDNKRTEHQGFHATLHKSNSSFHLQKSSVQLSDSALYYCALS
Cricetulus griseus V284 trdv AFTD01116768.1 6404 SILGQKVTQVQSTASSQEGEEVNLDCSYETSQSFYHLFWYKQLHSGEMVFLIRQISSVTQSEKSDRYSVIFQKSAKSISLVISASQIEDSVIYFCALWEL
Cricetulus griseus V285 trav AFTD01116768.1 15385 SFAGDSRAQSVTQPQARITVTEEASLQLRCNYSSSVPPSLFWYVQYPRQGLQLLLKYYSGEPVVRGLSGFEAEFSKSDSSFHLKKASVHLGDSAVYFCALG
Cricetulus griseus V286 trav AFTD01116768.1 22895 LSHGKQVEQLPSTLRVQEGDSTVINCTYTDSTSYYFPWYKQGPGEHPKLIIDIRSNEERKQDQRLIVLLDKKAKHFSLHITDTQPGDSAMYFCAAS
Cricetulus griseus V287 trav AFTD01116768.1 24575 KSNGDSVTQTEGLVTVTEGSPVMMTCTYKTTYSDISLFWYVKFLNKAPQLLLRTATDNKRTEHQGFHATLHKSNSSFHLHKSSVQLSDSALYYCALR
Cricetulus griseus V288 trav AFTD01116769.1 12240 SFAGDSRAQSVTQPQAHITITEEASLQLRCNYSSSVAPYLFWYVQYPRQGLQLLLKYYSGEPVVRGLRGFEAEFSKSDSSFHLKKASVHLSDSAVYFCALG
Cricetulus griseus V289 igkv AFTD01117344.1 5376 SIGDIVLTQSPASMPVSVGQKATVSCKSSESVNSYGINLMHWYQQKQGQPPKLLIYAGSNLASGIPTRFRGSGSGTDFTLTIHPVEADDSAIYYCQQSKELP
Cricetulus griseus V309 ighv AFTD01123862.1 1128 VQGEAQLVESGGGLVQTGKSLKLSCAASGFTFSSYWMNWVRQAPGKGLEWVARISENSGTINYADAVKDRFTISRDNAKNALYLQMNNLKSEDTATYYCAR
Cricetulus griseus V310 ighv AFTD01123864.1 1789 VLSQLKLEESGPGLVQPSETLSLTCTVTGFLLTGYGVHWFRQAPGKGLEWMGGTWSGGGIYYSSILKSRITISRDTSKSQVFLKLNNLQTEDTATYYCAR
Cricetulus griseus V318 ighv AFTD01126971.1 680 VETQVQLVQSGAELKQPGQLVKISCKASGYTFTQYSMHWVKQAPGQGLKYMGWINTNTGNPTYADDFKGRFVFSLDTSVSTAYLQISSLKDEDTAMYYCAR
Cricetulus griseus V319 ighv AFTD01126973.1 4243 VHYQGHLQQSASELRAPGAAVKVTCKDSDPNDFPIAYMNWVRQKPGHGLEWIGNILPSIGRTNYGQTFEDRATLTADTQLNTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V320 ighv AFTD01126973.1 8038 AAGGVGGGLGQPGKSLKLSCAASGFTFSDYWMNWVRQAPGNGLEFVAQIRDKSNNYETQYVKSVKGRFTISREDSQSSVSLQMNNLRSEDTAIYFCAA
Cricetulus griseus V321 ighv AFTD01126975.1 13955 VHSQVQLQQSGPEIVKTGATTQFSCKTSGYAVIGYYIHWVNQIPGQGLQWIGRIYPGIGNTDYNQKFQGKATLTVDTSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V322 ighv AFTD01126976.1 1446 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITSYDWSWIRKFPGKKLEWMGYIGYSGGTDYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAG
Cricetulus griseus V323 ighv AFTD01126977.1 2207 VRCEVKLVESGGGLVKPGGSLKLSCAASGFTFSDYWMSWFRQAPSKGLEWVAEINGDSSTTKYAPSVNGRFTISRDNDKNTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V324 ighv AFTD01126977.1 5518 VLSQVTLKESGPALLQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKVLEWLSDIWWNDEKYYNPSLKNRLTISKDTSKNQVLLKVTSMDTADTATYYCSQR
Cricetulus griseus V325 ighv AFTD01126977.1 19746 VQCEVQLVESTGGLVKPGGSLKLSCVASGFTFSDYWVGWVRQSPGKGLEWVGYIKYDGSYTNYAPSVKGRFTISRDNAKNTLYLQMNNVKSEDTATYYCAR
Cricetulus griseus V326 ighv AFTD01126977.1 24289 VHSQVQLQQSEAELVKPGASAKVSCKASGYTFSYNYMYWVKQKPGQGLEWIGYVYPDNGDTQYNQKFKGKATLTADKSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V327 ighv AFTD01126980.1 861 VLSQVQLQESGPGLLKPSQSLSLTCTVTGYSISSGYWWGWIRQRPGKGLEWMGEIYKDGDTNYNPSLKSRITMTVDTSKNQFFLRLNSVTTEDTAVYYCAR
Cricetulus griseus V328 ighv AFTD01126986.1 3131 GVLSQIQLQESGPSLVKPSQSLSLTCSVTGFSITTSVYDWNWIRQFPGKKLEWMGAIIYGGGTGYNPSVKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V329 ighv AFTD01126986.1 10102 VQCEVQLVESGGGLLKPEGSLKLSCVASGFSFSHSWMHWVRQAPGKGLEWLVYINYDGSYTNYAPSVKGRFTISRDNAKNTLYLQMNNVKSEDTATYYCTR
Cricetulus griseus V330 ighv AFTD01126986.1 17921 VHCEVKLVESGGGLVKPAGSLKLSCAASGFTFTDYAMRWVRQDPGKGLEWVASIGIKPSNYVTYYVDSVKGRFTISRDDSQSMVYLQMNNLRTEDTATYYCTA
Cricetulus griseus V335 igkv AFTD01127604.1 4147 GRCDIKMTQTPSSLSGSLGDRVSLICKASEDISNALSWYQQKPEQVPKLLICDANILEHGVPSRFSGSGFSLEISSLEAEDVGTYICQQGYDTS
Cricetulus griseus V339 igkv AFTD01128630.1 634 ANCEIQMIQSPASLSVSLGKSVTIKCLASEDLYGNLAWYQQKLEEPPKLLIYNTHSLKDGVPSRFSGSGSGTQYSFEITNLQSEDVASYFCQQDYSTP
Cricetulus griseus V345 ighv AFTD01130223.1 7148 VQCEAQLVESGGGLVQTGKSLKLSCAASGFTFSSYWMNWVRQAPGKGLEWVAHINENSGTINYADAVKDRFTISRDNAKNALYLQMNNLKSEDTATYYCAR
Cricetulus griseus V346 ighv AFTD01130225.1 725 VQCEVQLVESGGGLVQPGKSLKLSCEASGFTFSSYSMDWVRQAPGKGLEWVAYISSGSSYIYYANAVKGRFTISRDNAKNLLFLQMNSMKSEDTATYYCA
Cricetulus griseus V351 igkv AFTD01132313.1 7014 TRCDILMTQLPSQTVSLKDPVTITCQASQSIGSALAWYQQKPGKSPNLLIYYAKGLVDGVPSRFSGSGTGTDFTLTISSLEPEDIATYYCQQHNNN
Cricetulus griseus V352 igkv AFTD01132318.1 7130 SSCDIQLTQSPSQTVSLKDTVSINCQVSQRLSRTLSWYQQKPGQSPKLLVYEASSWSPGVPSRSSGSESGTDFTLSTSSLEPEDIGTYYCQQYWSY
Cricetulus griseus V360 igkv AFTD01136053.1 4752 GRCDIQMTQTPSSLSASVGDRVSITCKASEDIFDALSWYQQKPGKAPKLLIYYANSLEDGVPSRFSGSGSGTQFSLKISSLEAEDAGIYFCHQGYNPP
Cricetulus griseus V363 igkv AFTD01137311.1 628 SNGDIILTQSPESLAISQGEKVTITCSASSSISSNYLHWYQQKPGAPPKLMVYRTSSLASGVPTHFSGSGSGTSYSFTISSIEHEDTATYYCNQGSSK
Cricetulus griseus V364 igkv AFTD01137319.1 1774 ARCDTQMTQSPASLSASLGDSVTITCQSSQDIYGNLAWFQQKPGKAPKLLIYTTSSLSHGVPPRFSGSGYGTQYSLKISSLQPEDIASYFCLQYSYVP
Cricetulus griseus V365 igkv AFTD01137324.1 3849 SISDAVMTQTPLSMPVSFGDSVSISCKSSQSLVHSNGNTYMNWLLQKPGQSPELLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVDPEDLGIYYCLQH
Cricetulus griseus V366 igkv AFTD01137325.1 2504 SRCHIQMTQSPASLSASLGNSVTITCQASQSINNWLAWYPQKTGKAPKLLICAACNLANRVPLRSSGSGSVTEYSLKISSLWLEDFATYYCQQG
Cricetulus griseus V369 ighv AFTD01138249.1 293 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITSGYYWSWIRQFSGKKLEWMGGIGYSGGTDYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V374 ighv AFTD01139853.1 633 VYSQVELQQSGPQLVKPGFSVKLSCKASGITFTDYYVIWVKQSPGQGLELVGDIDPENDNTDYNQKFQGKATLTADTSSSTAYMELSSLTSEDSAVYYCA
Cricetulus griseus V375 ighv AFTD01139853.1 14386 VLSQIQLQESGPGLVKPSQSLSLTCSVTGYSITSGYWWTWIRQFPGNKLEWMGNTVNGGTYYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V376 ighv AFTD01139853.1 20740 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITTSGYGWSWIRQFPGKKLEWMGYIGYSGGTDYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V377 ighv AFTD01139853.1 25084 VHCDVQLVEYGGGLVKPVGSLKLSCAASGFTFSDCWMNWVCQAPGKGLQWVGNFKYDGSYTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCSI
Cricetulus griseus V378 ighv AFTD01139853.1 32745 VHCEVQLVESGGGLVKPAWSLKVSCATSGFTFTDYAMRWVRQSPGKGLQWVASISTKPNNYATYYSDSVKGRFTISRDDSRSMAYLQMNNLRTEDTATYYCTA
Cricetulus griseus V379 ighv AFTD01139853.1 34458 VYSPVELHQSDPQLVKPGFSVKLSCKASGITFTDYYVYWVKQRPGQGLELVGDIDPENGETDYNQKFQGKATITADTSSSTAYMELSRLTSEDSAVYYCA
Cricetulus griseus V380 ighv AFTD01139853.1 38896 VLSQVTLKESGPGLLQPSQDLSLTCSFSGFSLSTSGMGVGWVQQPSGKGLEGLAIIWWDDDKRYNPSLKSRLTISKDTSNNRVTLKITSVDTADTATYYCAQR
Cricetulus griseus V381 ighv AFTD01139854.1 3908 VQCEVKLVESGGGLVKPGGSLKLSCVASGFTFSDHYMNWVRQAPGKGLEWVGDINYDGSTTRYAPSVKGRFTISRDNAKYTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V382 ighv AFTD01139856.1 3929 VQCEVQLVECGRGLVQPGKSLKLSCAASVFTFSDYWMGWVRKAPGKGLECIAEINGDSSTTKYAPSLKDQFTISRDNAKNTLYLQMNSVKSADTVTYYCVI
Cricetulus griseus V383 ighv AFTD01139856.1 7561 VQCEVQLVESGGGLLKPAGSLKLSCVASGFTFSDYWMHWVRQAPGKVLEWVGNINKDGSTTNYAPSVKGRFTISRDNAKNTLYMQMNSVKSEDTATYYCA
Cricetulus griseus V391 trav AFTD01146125.1 2207 LSKGEQVEQLPFTLRVQEGDSAVINCTYTDSTSYYFPWYKQGPGEHPKLIIDIRSNEERKQDQRLIVLQNKKAKHFSLHITDTHPGHSAMYFCAAS
Cricetulus griseus V395 igkv AFTD01149651.1 670 ACADIVMIQSPSSLAVSSGEKVTISCISSQSLFHSATQKNYLAWYQQKAGQSPKLLIYLASTRETGVPDRFIGSGSGTDFTLTISSAQAEDMGDYYCQQHHSYP
Cricetulus griseus V396 igkv AFTD01149654.1 213 ICGDIVMTQSPSSVSVSAEERVSINCKASQNLFGSDTKKNHLAWFQQKPGQSPKQLISWASTRLTGVPDRFIGSGSQTDFTLIISNVQAEDMAHYYCMQ
Cricetulus griseus V400 igkv AFTD01150897.1 57 ICGDIMMTQSPSSVSVSAKERISINCKASQNLFGSNTKKNHLAWFQQKPGQSPKQLISWASTRLTGVPDRFIGSGSQTDFTLTISSVQAEDMAHYYCMQ
Cricetulus griseus V401 iglv AFTD01151122.1 5763 SCAQYELTQPKSVPESLGRTVTISCKRSSGNIGSNSVHWYQQHFGSSPKTVIYNNNKRPSGVPDRFSGSIDSSSNSASLTITDLQIEDEATYFCQSYGSGF
Cricetulus griseus V402 iglv AFTD01151124.1 11294 SFAQFVLTQPKSVSESLGRTVTISCKRSSGNIGSYYVSWHQQRFGSSPQTVIYLHNERPSGIPDRFSGSIDSSSNSASLTITDLQTEDEADYFCSSYDDNY
Cricetulus griseus V404 igkv AFTD01152417.1 351 SIGDIVLTQSPASMPVSVGQKATVSCKSSESVYSYGINLVQWYQQKPGQPPKLLIYAASNLASGVPARFSGSGSGTDFTLTIHPVEADDAATYYCQQSKELP
Cricetulus griseus V406 ighv AFTD01153417.1 3084 VQCEVQLVESGGGLMRPGRSLQLSCAASGFTFSGYWMGWVHQAPGKGLEWVAEINGDSSDTKYTPSLKDRFTISRDNAKNTLYLQTNTVKSEDTATYYCARP
Cricetulus griseus V407 iglv AFTD01153936.1 7170 SCAQYELYQPKSVSESLGRTVTISCKRSSGNIGSSYVHWYQQHFGSSPKTVIYDYNKRPSGIPDRFSGSTDSSSNSASLTITDLQIEDEATYFCQSYDSGY
Cricetulus griseus V408 iglv AFTD01153936.1 17573 LCAQFVLTQPKSVSESLGRTVTISCKRSSGNIGDYYLNWYQQRFGSSPKTVIYEHNKRPSGVPDRFSGSIDSSSNSASLTITDLQSEDEADYFCSSYDNND
Cricetulus griseus V413 ighv AFTD01159159.1 1164 VLSQVQLKESGPGLVKPSETLSLICTVSGFSLTSNDVHWVHQPPGKGLEWMGGIAYNGYTAYNSAFQSRISISKDNSKSQVFLKLNSLQHEDTAMYYCA
Cricetulus griseus V414 ighv AFTD01159161.1 11780 VLSQVQLKESGPGLVQPSETLSVTCTVSGFSLSDYNIHWVCHPLGKRLEWMGGISWDGNPGYNSALQSRVSITRDTSKSQVVLKLNNLQTEDTALYYCAR
Cricetulus griseus V416 trav AFTD01159809.1 16 LSQGEQVEQLPSTLRVQEGDSAVINCTYTDSTSNYFLWYKQGHGEHPKLIIDIRSNVERKQDQRLIVLQNKKAKHFSLHITDTQPGDSVMYFCAASAHCSP
Cricetulus griseus V421 igkv AFTD01165024.1 4031 TSGDVVLTQTPLSLPVSIGQSASISCRSSQSLLHSDGNTYLDWHIQRPGQSPQRLIYWVSKLASGVPDRFSGSGSGTDFTLKISRVEAEDFGVYYCMQA
Cricetulus griseus V422 igkv AFTD01168416.1 7839 ARCDIQMTQSPSPLSASMGETVTITCLASQKIYGNLAWYQQKQEGSPNLLIYDAASLADGVPSRFSGSGSCTKFSLKISSLQPEDAAIYYCQ
Cricetulus griseus V423 igkv AFTD01171096.1 866 GRCDIQVTQSPSLLSASLGDKVTINCLVTQDISYYLSWYQQKSGQSPTLLIYNGNSLQSGVPSRFSGQYSGRSFTLSLSSLEPEDAGTYYCLQHYSAP
Cricetulus griseus V424 ighv AFTD01174236.1 712 IHCEVQLIVSGGGLVKPAGSLKLSCAASGFTFTGYAMSWVCQAPGKGLEWVARIRTKPNNYATHYSDSVKGRFTISRDDSQSMAYLQMNNLRTEDTATYYCAI
Cricetulus griseus V425 igkv AFTD01181167.1 384 GRCDIQMTQTPSSLSASVGDRVSITCKASEDIFDALSWYQQKPGKAPKLLIYYANSLEDGVPSRFSGSGSGTQFSLKISSLEAEDAGIYFCHQGYNPP
Cricetulus griseus V426 igkv AFTD01181976.1 445 ACADIVMTQSPPSLTVSAGEKATISCKSSQSLFSSNTKKNYLNWYLQKPGQSPKLLIYHASTRHTGVPDRFIGSGSGTDFTLTISSVQDEDLADYYCQQWYSFP
Cricetulus griseus V427 igkv AFTD01183209.1 215 SRCDAVMTQTPPSLTASLGDQVSISCRSSQSLVLSDGNTYLHWYLQKPGQSPKLLTYRVSNRFSGVPDRFSGSGSGTDFTLKISKMEPEDFGVYYCFQE
Cricetulus griseus V428 igkv AFTD01183722.1 155 ACADIVMTQSPSFLAVSAGERATISCKSSQSLLYSANQKNYLAWYQQKVGQSPKLLIYHASTRYTGVPDRFTGSGSGTDFTLTISNIQAEDMGDYYCMQSLSDP
Cricetulus griseus V429 igkv AFTD01232091.1 64 SQGQIMLTQPAESLHVSPGERVSVTCRASQSLLYTDGKHYLSWYQQRQGETIKTFIYHASTRIDGVPTRFIGSGSGTEFTLTIEDLQPEDFAVYYCLQ
Cricetulus griseus V430 ighv AFTD01232429.1 18 VLSQVQLLQSESELGRPGSALKLSCKTSGYTFTTFTMNWVKQRPGQGLEWIGRIYAENGHTDYAQKFRGKATLTVDKSSSTAYLELSSLTSEDFSMYYCA
Cricetulus griseus V431 igkv AFTD01240499.1 165 VDGNIVITADLLSIPVTPGELASISCRSRKSLLYSDGKTYLHWYHKRPGQSSQLLIFGISNHATGVPDRFSGSGSETDFTLKISRVEAEDMVVYFCQQVLEK
Cricetulus griseus V432 igkv AFTD01241331.1 46 TRCDILMTQLPSQTVSLKDPVTITCQASQSIGSALAWYQQKPGKSPNLLIYYAKGLVDGVPSRFSGSGSGTDFTLTISSLEPEDIATYYCQQHNNN
Cricetulus griseus V435 igkv AFTD01253150.1 543 GKCDIQMTQSPSTLSASMGDSVTISCHASQNINSWLSWHQQKPGDAPKLLIYKTSSLHTGIPSRFRGSGSGTDYSLTIINVQPEDIATYYCQQDQSIP
Cricetulus griseus V496 igkv AFTD01076086.1 6854 ACANIVMTQSPSSLAVSAGDKATISCKSSQSLLYSEDQKNNLVWYQQKAGQSPKLLIYLASTRYNGVPDRFIGSGSGTDFTLTISSVQEEDMGDYHCMQKYSKP
Cricetulus griseus V524 ighv AFTD01087405.1 2673 VLSQVQLQESGPGLLKPLQSLSLTCTVTGYSISSGYLWHWIRQHPGKGLEWMGRIYNNGDTYCNPSLKSRITMTVDTSKNHFFLRLNSVFAEDTAVYFCAR
Cricetulus griseus V525 ighv AFTD01087406.1 1999 VQCEVQLVESGGGLAQPGSSPKLSCAASGFTFTNAWMSWARQAPGKGLEFVAQIRDKSNNYATGYGESVRGRFTISREDSQSSVSLQMNNLRAEDTAIYYCTR
Cricetulus griseus V526 ighv AFTD01087407.1 7861 VLSQMQLQDSGPGLVKPSQSLSLTCSVTGFSITTIGYEWSWIRQFPGKTLEWMGYITSPGGTYYNPSLTSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V527 ighv AFTD01087408.1 26037 VHSQVQLQQSGAELRRPGASVKMSCKTSGYTFTVYVMHWVKQKPGKGLEWVGGIDLENGDTKYAQKFQGKATLTADKSSSTAYMELSSLTSEDSAVYYCTT
Cricetulus griseus V528 ighv AFTD01087408.1 23607 FLSQIQLQESGPGLVKPSQSLSLTCSVTGESITSGYDWSWIRQFPGKKLEWMGYIDIGGGTNYNPSLTSSISITRDTSKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V529 ighv AFTD01087408.1 15111 VHSQVQLQQSGTELGRPGASVMVSCKASGYTFSYDYMHWVKQKPGQGLEWIGYVYPFIGNTKYNQKFQGKATLPADTSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V530 ighv AFTD01087408.1 7758 VLSKVQLQESGPGLVKPSQSLSLTCSVTGDCITTNGYWWHWIMQFPGRKLEWMGNIGYGGGTDYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V531 ighv AFTD01087412.1 12383 VQTQIQLVQSGAELKQPGQSVKISCKASGYTFTQYAMRWVKPAPGQGLKYMGWINTETGNPTYADDFKGRFVFSLDTSVSTAYLQISSLKDEDTAMYYCAR
Cricetulus griseus V532 ighv AFTD01087412.1 5987 VHCEVQLVESGGRLVKPAGSLKLSCAASGFTFTDYAMFWVRQAPGKGLEWVASISTKSYNYATYYSDSVKGRFTISRDDSQSMAYLQMNNLRTEDTATYYCTR
Cricetulus griseus V533 ighv AFTD01087412.1 919 YPEGVWPWAVAAFPDSQSDLLFLCVFTEHFWCGVGWIRQPSGKGLEWLANIWWNDDKYYTPSLKSRLTISKDTSNNRVTLKIASVDTEDTATYYCARVL
Cricetulus griseus V534 ighv AFTD01087414.1 15010 VHSQVQLQQSGAELVKPGSSVNLSCKTSGYTFTSYLMSWVKQKPAQGLEWIAWINPSHGNTDYNQKFKSKVTLTAEKSSSTVYMELSSLTSEDSAVYYCA
Cricetulus griseus V535 ighv AFTD01087416.1 696 VHSQVQLQQSGAELGRPGASVKVSCKASGYTFSYENMHWVKQKPGQGLEWIGRIFTYNGDTQYNQKFQGKATLTADTSSSTAYMELRSLTSEDSAVYYCVR
Cricetulus griseus V549 iglv AFTD01096264.1 21131 SCAQFELTQQKSVSESPGRTVTISCKRSSGNIGNSYVHWYQQHFGSSPKTVIYDYNTRPSGIPDRFSGSTDSSSNSASLTITDLQIEDEATYFCQSYVSGF
Cricetulus griseus V550 iglv AFTD01096264.1 10098 SCAQYELSQPKSVSESLGRTVTISCKRSSGNIWGYYVSWYQQHFGSSPQTVIYEHNKRPSGVPDRFSGSTDSSSNSASLTITDLQTEDESDYFCFSYDNNN
Cricetulus griseus V551 iglv AFTD01096268.1 1174 SCAEVVFTQPQSVSGSLGQEISISCTRSSGNIASNYVYWYQQHSSNKPRLLIYKYDQRPSGIPDRFSGSKDTSANSGILTISRLQPEDEGDYYCLSGYDSY
Cricetulus griseus V552 iglv AFTD01096273.1 753 SCAQVVLTQPNSVSESLGRTVTISCKRSSGNILGYDVSWYQQHFGSSPQTVIYEHNKRPSGVPDRFSGSIDRSSSNSASLTITDLQTEDEADYFCLSYDSNY
Cricetulus griseus V553 iglv AFTD01096278.1 4530 SCAQYELSQPKSVSESLGRTVTLSCKRSSGNIGSYYVSWYQQYFGSSPQIVIYEHNKRPSGVPDRFSGSIDSSSNSASLTITDLQTEDEADYFCFSYDSNY
Cricetulus griseus V564 igkv AFTD01099981.1 682 GRCDIQMTQTPSSLSASVGDRVSITCKASEGISDALSWYQQKPGKAPKLLIYYANSLEDGVPSRFSGSGSGTQFSLKISSLEAEDAGIYFCQQGYNPP
Cricetulus griseus V565 igkv AFTD01099990.1 5727 STGDIVLTQSPDSLFLSLGQKAIISCKSSRSVNKFGINLMHWYQKKLGQPPKLLIYNEFYLASGIPARFSGNEVELVFTLTIHPVEADAIPIYYCQQGIEHP
Cricetulus griseus V576 trav AFTD01103419.1 79217 AAGQGTEQPAKLMSVEGTSIQVNCTYSTSGFYGLSWYKQHDGQAPVFLSYDVLDSLKDSEHFSIFLSRWDGHSYLLLTEHRASSELQVKDSASYLCAVR
Cricetulus griseus V589 ighv AFTD01106093.1 6497 VQCEVQLVESGGGLVQPGKSLKLSCEASGFTFSNHYMNWVRQAPGKGLEWVAYISSASSYIYYADAVKGRFTISRDNAKNILFLQMNSVKSEDTEKYYCAR
Cricetulus griseus V590 ighv AFTD01106093.1 1984 VLSQVQLKESGPGLVKPSETLSLICTVSGFSLTSNDVHWVHQPPGKGLEWMGGIAYNGYTAYNSAFQSRISISKDNSKSQVFLKLNSLQHEDTAMYYCA
Cricetulus griseus V591 ighv AFTD01106096.1 14590 VLSQVQLKESGPGLVKPSETLSLICTVSGFSLTSNDVHWVRQPPGKGLEWMGVVWASGSTKYNSALQSRISISRDTSKSQVFLKLNSLQHEDTAMYYCAR
Cricetulus griseus V592 ighv AFTD01106098.1 2320 VQCEVQLGESGGGLVQPGKSLKLSCEASGFTFSSYGMDWVRQSPGKGLEWVAYISSRSSNIYYANAVKGRFTISRDNAKNTLFLQMNSVKSEDTATYYCAR
Cricetulus griseus V593 ighv AFTD01106100.1 707 VLYQVQLKESGPGLLQPSQTLSLTCTVSGFSLTDCDVHWVCQPPGKGLDWLGAIWAGTNTEYNSALQSRISITRDTSKSQVFLKLNNLQTEDTAMYFCAR
Cricetulus griseus V604 igkv AFTD01109622.1 667 GRCNIQMTQTPSSLSVSLGDRVSLSCKASENIYTTLSWYLQKPGKAPKLLIYYANSLEDGVPSRFSGSGSGTQFSLKISSLEAEDAGIYFCQQGYNPP
Cricetulus griseus V645 igkv AFTD01126539.1 3572 ICGDIMMTQSPSPVAVSEGERVSINCKASQNLFGSNTKKNHLAWYQQKAGKSPKLLIYWGSTRHTGVPDRFIGSGSETDFTLTISSVQAEDMGNYYCMQFYNTP
Cricetulus griseus V647 ighv AFTD01127512.1 2302 VLSQIQLQESRPGLVKPSQSLFLTCSVTGYSITSGYYRIWIRQSRGKKLEWMGYIAHSGDAVYNPSMRSPISITRETSKNQFFLQLNSVTTEDTATYYCA
Cricetulus griseus V648 ighv AFTD01127513.1 20440 VLSQIQLQESGPGLVKPSESLSLTCSVTGDSITSYDWIWIRQFPGKKLEWMGYIDNGGGTDYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V649 ighv AFTD01127513.1 7967 VLSQVQLQESGPGLLKPSQSLSLTCTVTGYSISRGYWWHWIRQHPGKGLEWMGWIYNDGDTNYNPSLKSQITMTVDTSKNQFSLRLSSVTTEDTAVYYCAR
Cricetulus griseus V650 ighv AFTD01127515.1 1263 VHSQVQLQQSGAELVKPGSSVKLSCKTSVHTFTSYLMSWVKQKPAQGLEWIGWISLSYGNTDYNQKFKGKATLTADKSSSTAYMELSSLTSEDSAVYYCA
Cricetulus griseus V651 ighv AFTD01127516.1 34842 VQTQIQLVQSGAEVKQPGQSVKISCKASGYTFTEQGMQWLKQAPGQDIKWMGWINANNGKTTYADDFTGQILFSLDTSVSTAYLQISSLKNEDTAMYYCTR
Cricetulus griseus V652 ighv AFTD01127516.1 6582 VLSKVQLQESGPGLVKPSQSLSLTCSVTGYSITTSSFGWHWIRQFPGKKLEWIGYISSTGRTNYNPSLKSRISTTRDTAKNQFFLQLNSVTTEDTATYYCAG
Cricetulus griseus V653 ighv AFTD01127517.1 12104 VLSQVSLKESGPGVFPPSQDLTLTCSFSGFSLSTSGMGVGWVCHPSGKGLEDLAIIYWDDNKRYNPSLKSWLTISKDTSNNRVTLEITSVDTADTATYYCARR
Cricetulus griseus V654 ighv AFTD01127517.1 1850 SGVRTWPGEALTVAVPHLLCHWFLHLHQLCLELDQAVPREPLEWMGYITSPGGTYYNPSLKSRISITRDTAKNQIFLQLNSVTTEDTATYYCAR
Cricetulus griseus V655 ighv AFTD01127518.1 4161 VHCEVQLVESGGGLVKPAGSLKLSCVASGFTFSAAWMNWVRQTPGKGLEWVARIDTKSYNYATYYVDSVKGRFTISRDDSRTMVYLQMNNLRTEDMATYYCTR
Cricetulus griseus V656 ighv AFTD01127521.1 6980 VQCEVKLVESGGGLVTAGKSLKLSCAASGFTFSSYWMNWVRQAPGKGLEWVAEIRDKSNNYATHYGESVRGRFTISREDSQSSLYLQMNNLRAEDTAIYYCTR
Cricetulus griseus V657 ighv AFTD01127525.1 2266 VHCGVQLVESGGGLVKPAGSLKPSCAASGFTFTDYNMHWVRQAPGKGLEWVAYVSTESNNYATSYADSVKARFTISRDDSRSMVYLQMNNLRTEDTATYYCTS
Cricetulus griseus V658 igkv AFTD01127604.1 12046 ACADIVMTQTPSFLAVSAGERATISCKSSQSLLSSANQKNYLNWYQQKAGQSPKLLIYLASTRYTGVPDRFTGSGSGTDFTLTISNIQAEDMGDYYCLQDYSAP
Cricetulus griseus V660 igkv AFTD01128629.1 3822 AKCDIQMTQSPVILSASLGESVTITCQSSQSIYTYLAWYQQKPGEHPKLLIYAASNLADGIPSRFSGSGSGTQFSLKINNLQPEDVANYYCQQCYSNP
Cricetulus griseus V661 igkv AFTD01128633.1 2369 SKGEIVLTQSPGYMTTSNGEKVIITCRASSSISANYFHWYQQKPGASPKLLIYSTSYLAAGVHGSFTGSGSETSYSLTISCMQAEDAATYYCQQGSTS
Cricetulus griseus V680 igkv AFTD01134400.1 4432 SVGDIVLTQSPASLTMSPGQSHTISCRASQSVNTVGIPLMNWYQQKPGQLSKLLIHDASKLASGVPARFSGSLSGTDFTLTIHPVEADDVATYYCQQGLALP
Cricetulus griseus V681 ighv AFTD01134909.1 8692 VLSKVQLKETGPGLVKPLETLSLTCTVSGFSLTSYGVHWVRQPPGKVLEWMGVIWSGGSTDYNSNLKSRITITRDTAKSQVFLKLNSLQHDDTAMYYCAR
Cricetulus griseus V682 ighv AFTD01134909.1 3555 VLSQLKLEESGPGLVQPSETLSVICTVTGFLLTGYGVHWFRQAPGKGLEWMGGTWSVGGVYYSSILKSRTTISRDTSKSQVFLKLNNLQTEDTATYYCAR
Cricetulus griseus V683 ighv AFTD01134910.1 16684 VLSQVQLKESGPGLLQPSQTLSLTCTVSGFSLTDCDVHWVRQPPGKGLEWLGTIWAGTNTEYNSALQSRIRITRDTYKSQVLLTLNNLQTEDTATYFCA
Cricetulus griseus V684 ighv AFTD01134910.1 7698 VQCEVQLMESGGGLVQPGKSLKLSCEASGFPFSDHYMNWVRQAPGKGLEWVAYISGGSSYINYANAVKGRFTISRDNAKNILFLQMNSVKSEDTATYFCA
Cricetulus griseus V685 ighv AFTD01135005.1 813 VQCEVKLVESGGGLVKPGDTLKLSCAASGFTFSSYWMSWVRQSPGKGLEWVGDIKYDGSTTRYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCAR
Cricetulus griseus V686 ighv AFTD01135006.1 3793 VLCQIQLQESGPGLVKPSQSLSLTCSVTGFSITSSGYWWQWIRQFPGNKLEWMGYIGYNGGINYNPSVKSRISITRDTAKNQIFLQLNSVTTEDTATYYCA
Cricetulus griseus V687 ighv AFTD01135008.1 14911 VQCEVKLVESGGGLVKTGGSLKLSCVASGFTFSGYWMDWVRQAPGKGLEWVGNIKYDGSTTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTTTYYCA
Cricetulus griseus V688 ighv AFTD01135008.1 903 VHSQVQLQQSGPQLVKPGSSVKVSCKASGYTFTSYNMQWVKQKPGQGLEWMGGMNPNSGGTSYAQKFQGRVSMTRDPSSSTAYMELSSLTSDYSGLYYCAR
Cricetulus griseus V689 ighv AFTD01135011.1 5550 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITTSGYRWSWIRQFPGNKLEWMGGIRYDGGNSYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCAR
Cricetulus griseus V690 ighv AFTD01135011.1 343 VLSQVQLQESGPGLLKPTQSLSLTCTVTGYSISSGYWWHWIRQHPGKGLEWMGQIYKNGDTYYNPSLKSRITMTVDTSKNQFSLRLSSVTTEDTAMYYCAR
Cricetulus griseus V693 igkv AFTD01137307.1 3484 ARCDIQVTQSPSTLPASLGDRVTITCKASQNINNYMSWYQQKPGEVLKLLIYSASTLQSGVPTRFSGSGSGTDYSFTISSLEPEDAAVYYCLQSYSY
Cricetulus griseus V694 igkv AFTD01137443.1 5950 ICGDIIMTQSPSSVAVSEGERVSINCKASQNLFGNKTKKNRLVWYQQKAGQSPKLLIYWGSTRHTGVPDRFVGTGSETDFTLTISSVQAEDMGDYYCMQDYNTP
Cricetulus griseus V702 ighv AFTD01140198.1 23511 VQCEVKLVESGGGLVKSGGSLKLSCAASGFTFTGYWMDWFRQAPGKGLEWVGNINKDGSTTNYAPSVKGRFTISRDNAKNTLYLQMNNVKSEDTATYYCA
Cricetulus griseus V703 ighv AFTD01140198.1 5394 VHSQVQLLQSGPELAMPGASVKMSCKASGYTFTDYAMHWMKQKPGQGLEWIGWIGGKSGDTKYNLKFQGKASLTRDKSSSTAYMELSSLTSEDSAVYHCARE
Cricetulus griseus V704 ighv AFTD01140202.1 2716 VLSQIQLQESGPGLVKPSQSLSLTCSVTGFSITTSGYGWHWIRQFPGKKLEWMGYIGYSGGTSYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCA
Cricetulus griseus V705 ighv AFTD01140205.1 1518 VLSQVQLQESGPGLLKPSQSLSLTCTVTDYGISSGNWWKWIRQRPGKGLEWMGQIYNDGYTNYNPSVKSRITMTVDTSRNQCSLRLSSVTTEDTAVYFCAR
Cricetulus griseus V706 ighv AFTD01140206.1 3147 VLSQIQLQESGPGLVKPSQSLSLTCSVTGYSITTSGYIWTWIRQFPGKKLEWMGYITYAGSTGYNPCVKSRISITRDTAKNQFFLQLNSVTTEDTATYYCVR
Cricetulus griseus V707 ighv AFTD01140207.1 712 VHSQVQLKQSGPELVEPGASVKISCKTSGYTFTFGYMHWVEQKPGQGLEWIGRIDPDNGNTQYNQKFQGKATLTRDKSSSTVYMELSSLTSEDSAVYYCAR
Cricetulus griseus V709 igkv AFTD01140765.1 4839 SRGDVVMTQSPPSLSVSLGEQVSISCKSSQSLVHSDGNTYLEWYLQKPGQSPKLLVYKVSNRFSGVPDRFSGSGSGTDFTLKISRMEPEDFGVYFCFQGSHA
Cricetulus griseus V715 ighv AFTD01144405.1 32277 VHCGVQLVESGGGLVKPAGSLKLSCAGSGFTFTDYNMHWVCQAPWKGLEWVAYVSTKSNNYAASYADSVKGRFTISRDDSRSMADLQMNNLRTEDTATYYCTS
Cricetulus griseus V716 ighv AFTD01144405.1 29600 VHSQIQQQQSVAEVVRPGASVKVSCKASGYTFSYDYMHWVKQKPGQGLEWIGGIFTGIGIANYGQKFQGKATLTADTSSSTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V717 ighv AFTD01144405.1 25074 AAGGVRGGGLGQPGKFLKLPCAASGFTFSDAWMNWVRQAPGKGLEWVGRIKNKANNYATDYVESVKGRFTFSKKDSKSSLYLQMNSIRAEDTAIYYCA
Cricetulus griseus V722 ighv AFTD01146348.1 29906 VHSQVQLQQSVAEVVRPGSSVKLSCKASGYTFTDYVMNWVMQRPGEGLEWIGYIYTWNDVTDYNQKFKGKAKLTVDKSSSTAYMELSSLTSEDSAVYFCAR
Cricetulus griseus V723 ighv AFTD01146348.1 23428 VHCQVQLQQSGAELAKPGSSVKLSCKASGYTFTDHYMSWVKQRPAQGLEWIGYIGAGGGGTYYNQRFQGKATLTRDKSSSTVYMELSSLTSEDTAVYFCAR
Cricetulus griseus V724 ighv AFTD01146348.1 12646 VHSQGHLQQSASELRAPGAAVKVTCKDSDPNIFPIAYMNWVRQKPGHGLEWIGNILPSIGMTNYGQTFEDRATLTADTQLNTAYMELSSLTSEDSAVYYCAR
Cricetulus griseus V726 ighv AFTD01146684.1 503 VLSQIQLQESGPGPMKPSQSLSLTCSVTGDSITSGYYWSWIRQFPGKKLEWMGYIGYSGGTGYNPSLKSRIYITRDTSKNHFFLQLDSVTTEDTATYYCAR
Cricetulus griseus V734 trav AFTD01149203.1 5316 LSQGEQVEQLPSTLRVQEGDSAVINCTYTDSTSNYFLWYKRGHGEHPKLIIDIRSNVEIKQDQRLIVLQNKKAKHFSLHITDTQPGDSVMYFCAAS
Cricetulus griseus V735 ighv AFTD01150271.1 3653 VHSQGHLQQSASELRAPGAAVQVTCKDSDPNDFPIACMNWVRQKPGHGLEWIGNILPSIGRTNYAQTFEDRATLTADTQLNTAYMELSSLTSEDSAVYYCA
Cricetulus griseus V736 igkv AFTD01150736.1 495 SRGDVVMTQSPSSLSVSLGEQVSISCKSSQSLVHNNGNTYLEWYLQKPGQSPKLLVYKVSNRFSGVPDRFSGSGSGTDFTLKISRMEPEDFGVYFCFQGSHA
Cricetulus griseus V737 ighv AFTD01151718.1 13752 VLSQIQLQESGPGLVKPSQSLSLTCSVTGYSITSDYWWHWIRQFPGKKLEWMGYINYVGGTNYNPSLKSRISITRDTAKNQFFLQLNSVTTEDTATYYCA
Cricetulus griseus V738 ighv AFTD01151718.1 9585 VHCEVQLVESGGGLVKPAGSLKLSCAASGFTFSNAATNWVRQAPGKGLEWVARIRTKPNNYATYYKDSVKGRFTISRDDSRSMVYLQMNNLRTEDTAAYYCTS
Cricetulus griseus V739 ighv AFTD01151718.1 2838 VLSQVTLKESGPGLLQPSQTLSLTCSFSGFSLSTSNTAVGWIRQPSGKGLEWLANIWWDDDKYYNPSLKSRLTIYKDTSNNRVTLKIASVDTADNATYYCAGT
Cricetulus griseus V740 ighv AFTD01151719.1 1107 VHSQVKLQQTVAELVKPGASVKPSCKASGYTFTSHYMSWVKQKPRQGLELIGWIDPGNSGNSYNQNFQHKATLTADTSSSTAYMELNRMTSEDSAVYYCAR
Cricetulus griseus V741 ighv AFTD01151720.1 42225 VHCEVQLVESGGGLVKPAGSLKLSCAASGFTFSNYFMNWVRQAPGKGLEWVAHIETKSYNYATYYVDSVKGRFTISRDDSQSMAYLQMNNLRTEDMATYYCTR
Cricetulus griseus V742 ighv AFTD01151720.1 33805 VLSQVTLKESGPGVFPPSQDLTLTCSFSGFSLSTSGVGVGWVRQPSGKGLEGLAIIWWDDDKRYNPSLKSRLTISKDTSNNRVTLKITSVDTADTATYYCARR
Cricetulus griseus V743 ighv AFTD01151720.1 27369 VQCEVQLVESGGGLMQPGKSLKLSCAASGFTFSDYWMDWVRQVPGKGLEWVAQIGTKGYNYVTYYGESVSGRFTISRADSKNSLYLQMNSLRAEDTAIYYCAR
Cricetulus griseus V744 ighv AFTD01151720.1 25953 VLAQIQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYWIWIRQSRGKKLEWIGYITHSGDAVYNPSMRSRISITRDTAKNQFFLQLNSVTTEDTATYYCAG
Cricetulus griseus V745 ighv AFTD01151720.1 12836 VHSQVQLQQSGAELVKPGASVKLSCKASGYTFTSYVMSWVKQKPGQGLEWIGYIYPGNGGTNYNQKFQGKATLTADKSSSTAYMELSSLTSEDSAVYYCA
Cricetulus griseus V746 ighv AFTD01151720.1 8495 VQCEVQLVESGGGLVQTGGSLWLSCAASGFTFSDYWMIWLRQTPEKKLEWVANINKDSSVTNYAPSVKGRFTISRDNAKNTLYLQMNSVKSEDTATYYCVT
Cricetulus griseus V747 ighv AFTD01151720.1 4045 VTTQIQLVQSGAELKQPGQSVKISCKASGYTFTQYAMTWVKQAPGQGLKYMGWINTETGNPTYADDFKGRFVFSLDTSVSTAYLQISSLKDEDTAMYYCAR
Cricetulus griseus V750 ighv AFTD01152581.1 11906 VLSQVQLKETGPGLVKPSETLSLTCTVSGFSLTSYDVHWVRQPPGKVLEWMGVIWSGGGTDYNSNFKSRVTITRDTAKSQVFLKLNSLQHEDTAMYYCTR
Cricetulus griseus V753 igkv AFTD01155847.1 846 SRGDVVMTQTPTFLPVSLGEQVSISCRSSQSFVYSDGNTYLNWLLQKPGQSPKLLIYKISKRASGVPDRFSGTGSGTDFTLKISRMEPEDFGLYYCMQASYVP
Cricetulus griseus V754 trav AFTD01158402.1 4710 VKGQQVKQSPVSLVLQQGETAELQCNFSSTSYQVQWFHQSPGGHLISLFYNPSGTKQRGRLKSTTVTQERHSSLYISSSQTTDSGTYFCAMDAQCS
Cricetulus griseus V755 ighv AFTD01158986.1 5506 VHCDVQLVEYGGGLVKPVGSLKLSCAASGFTFSDYWMNWVCQAPGKGLEWVGDINKDGSTTNYAASVKGRFTISRDNAKNTLYLPMNSGKSEDTATYYCV
Cricetulus griseus V756 ighv AFTD01158986.1 1120 VHSQVQLQQSGPQLVKPGASVKLSCKTSGYTFTDYAMHWVKQKPGQGLEWIGGIVPIIGITNYGQKFQGRATLTADTSSSTAYMELRSLTSEDSAVYYCAR
Cricetulus griseus V759 igkv AFTD01164937.1 5218 SRGDVVMTQTPTFLPVSLGEQVSISCKSSQSFVHGDGNTYLNWLLQKPGQSPKLLIYKISTRASGVPDRFSGSGSGTDFTLKISRMEPEDFGLYYCMQASYVP
Cricetulus griseus V763 igkv AFTD01183743.1 644 ARCDTQMTQSPASLSASLGDSVTITCQSSQDIYGNLAWFQQKPGKAPKLLIYTTSSLSHGVPPRFSGSGYGTQYSLKISSLQPEDIASYFCLQYSYVP
Cricetulus griseus V766 igkv AFTD01237307.1 453 ARSDIQMTQSPSMLSASLGETVTITCLASQNINGYLAWYQQKQQGRPNLLIYGATSLAVGVPPRFSGSGSGTQYSFKINSLQAEDAGIYFCHQGDSTP
Cricetulus griseus V767 igkv AFTD01238681.1 315 TSCDIQLTQLPSSLSASPGDKVTITCKASQNINQYLHWYQQKPDEAPKLLIYSASNLQTGIPSRFSGSGSGTDFSLTINSLDSEDVGTYFCQQGY
Cricetulus griseus V768 igkv AFTD01247925.1 526 TCGEIVVTQSPSFLAVSGGEEVKISCRSSQNLLYSANKKNYLVWFQQKPGQSPKLLIYWATTRDTGVPDIFIGRGSGTDFTLTISNVQAEDMADYYCMQNYDIP
Cricetulus griseus V770 igkv AFTD01254404.1 630 VTGNTVTQSPAFLSLSLGETTTLSCRSSENIGRYLAWYQQKPGQVPRLLIYDSSNRVSDVPARFSGSGSGTDFTLTISRLEPEDVAVYYCETYKSWS
Cricetulus griseus V771 igkv AFTD01258570.1 391 AKCDIQMTQSPYLPSAFLEDSVTITCQSSQNIYSNLAWYQQKPGEPPKQLIYYTKNLADGTLSRFSGSGSGTQYSLKISSLQPEDMASYYCL