WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Neotoma lepida LZPO00000000.1 (LZPO01) 266 76 12 100 62 10 1 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Neotoma lepida V40 igkv LZPO01028264.1 16488 ASCDIQLTQSPSSLSTSPGDKVTITCKASQNINKYLAWYQQKPGEAPKLLIYDASNLQTGVPSRFSGSGSGTDFSLTISTLEPEDIATYYCQQA
Neotoma lepida V0 ighv LZPO01005377.1 743 VHPQVQLQQSGLGLGKPGASVKLSCKASGYTFTDYYMSWVKQRPGQGLEWIGWINPASGGTGYNQKFQGKATLTADKSSSTAYMELNSLTSEDSAVYFCA
Neotoma lepida V1 igkv LZPO01008153.1 12151 TSGDITLTQSPASLAVSLGQSVTISCKASQSVSGSAYTYMHWYQQKPGQSPKLLIHRASNLASGVPARFSGSGSGTDFTLTINPMDADDAATYFCQQSWEDP
Neotoma lepida V2 igkv LZPO01008153.1 40947 STGDIVLTQSPASLAVSLGQKATISCKSSESVNKYGTNLMHWYQQKPGQPPKLLIYAASNLASGVPARFSGSGSGTDFTLTIHPVEADDAATYFCQQGKELP
Neotoma lepida V3 igkv LZPO01008153.1 66800 STGDTVLTQSPASLAVSLGEKATISCKSSQSVNKFGINLMHWYQKKPGQPPKLLIYNEFHLASGIPARFNGDEAALDFTLTIHPVEADDAATYYCQQGIELP
Neotoma lepida V4 igkv LZPO01008153.1 84811 VCGDIMMTQSPSSLSVSAGEKVTIDCKSSQSLFNSNSKKNHLAWYQQKPEQAPKLLIYFASTRNTGVPDRFIGSGSGTDYTLTISSVQDEDLADYYCMQDHSTP
Neotoma lepida V5 igkv LZPO01008153.1 98403 STGDIVLTQSPPSLTVSLGQRATMSCRASQSVTISRFHFMHWYQQKPGQSPKLLIYRASNLESGVPARFSGSGSGTDFTLTIHPVEADDAATYYCQQSKEDP
Neotoma lepida V6 igkv LZPO01008153.1 113615 ICGDIVMTQSPSSLAVSAGETVTINCKSSQNLFGSNSKKNRLDWYQQKPGQSPKLLIYYASTRNTGVPDRFVGSGSETDFTLTISSVQAEDLADYYCMQDLST
Neotoma lepida V7 igkv LZPO01008153.1 136880 IAGDILMIQSPSSLAVSAGEKVTINCKSIQSLFYSYSEKNHLAWYQQKPGQSPKLLIYWASTRNTGVPDRFIGSGSETDFTLTISSVQAEDLADYYCMQDLSTP
Neotoma lepida V8 iglv LZPO01008286.1 21198 SVASYELTQPPSASVTIGETVTISCSGDQLPNKYAHWYQQKPDRIILPLIYKDSERPSGIPDRFSGSSSGTTATMTISGVQPEDEADYYCSSAYGDDN
Neotoma lepida V9 iglv LZPO01008286.1 75363 SFSQPVLTQSPSASASLGASVKLTCTLSSEHSNYNIGWYQQQPDKAPKYVMYLSNTGSHSKGDGIPDRFSGSSSGPDRYLSISNIQPEDEAIYFCGVGY
Neotoma lepida V10 trav LZPO01008366.1 7957 VNNQQGEENPLALSIQEGENVTMNCSYKTSSTVLQWYKQDSVRGPALLIIMYSNEREKHSGRLRATLNTSTQSSSLSITDAQAADTAVYFCATE
Neotoma lepida V11 trdv LZPO01008366.1 55330 SSLGQKVTQVQSTASTHEGEEVTLDCSYETSWSFYHLLWYKQLLSGEMIFLIRQSSATQTERSSHYSVVFQKSAKSISLVISASQLEDSVKYFCALSEQ
Neotoma lepida V12 ighv LZPO01009315.1 14054 VHSQVQLLQSGPELGRPGSSLKVSCKASGDTFSNYYINWVKQKPGQSLVYIGRIYPGSGGTDYAQNFKGKAKLTVDKSSSTAYMEFNSLTSEDTAVYYCAR
Neotoma lepida V13 ighv LZPO01009315.1 19394 VHCEVQLVESGGGLVQPTGSLKLSCATSGFTFSSAAMYWVRQAPGKGLEWVARIRTKSNNYATYYADSVKDRFTISRDDSQSMVYLQMNNLRTEDTAMYYCAG
Neotoma lepida V14 ighv LZPO01009535.1 4229 VHSQVQLQQSGPELVRPGTSVKLSCKASGYTGYINWVKQRPGQGLEWIGNIDTRDSETNYNQKFQGKAKLTADKSSSTAYMELSSLTSEESAVYYCA
Neotoma lepida V15 ighv LZPO01009789.1 12873 VQGEVQLVESVEDLVQPGSSLKLSCAASGFTFSAVLMHWVRQAPGKGLEWVAQIRSKTFSYEAYYAESVKGRFTISRDDSKSSVYLQMSRLRAEDTDIYYCTR
Neotoma lepida V16 ighv LZPO01011979.1 261 VYSQVQLQQSGAELVRPGASVKLSCKASGYTFTSYYMHWVKQRQGQGMEWIGDIYPGNGVTNYNQKFKGKAKLTADKSSSTAYMELSSLTSEDSAVYYCA
Neotoma lepida V17 trbv LZPO01016191.1 2419 SLDGQVIQTPQHLFRGKGEKAKMGCSPENGHTFVYWYQQKQNKELKFLISFQRQEVRERIDLVKERFLAECPLNSPCSLEIQSSEAGDSALYLCASSL
Neotoma lepida V18 igkv LZPO01017523.1 26013 SRCDIQMTQSPSQTTSLRDTVTIKCQASQSIGAALAWYQQKPGKSPKLLIYDASSLYSGVPSRFSGSGSGTDFTLTISSLEPEDIGTYYCQQYRSY
Neotoma lepida V19 igkv LZPO01017523.1 58552 ARCDIQMTQSPSSLSASLGERVTLSCKASQGISNYLNWYQQKPGKAPKLLIYYTNSLEDGVPSRFSGSGSGADYSLTISSLESEDIATYYCLQYDKLP
Neotoma lepida V20 igkv LZPO01017523.1 71023 AKCDIQMTQSPSSLSASLGDTVKLTCRASQGISSYLNWYQQKPGKAPKRLIYAASYLNNGVPSRFSGSGSGTDYSLTISSLESEDMATYYCLQYDKLP
Neotoma lepida V21 igkv LZPO01017523.1 108991 AKCDIQMSQSPSSLSASLGERVTITCRASQNINKYLRWFQQKPGKAPKLLIYRASNLEDGVPSRFSGSGSGTDYSLTISSLESEDIATYYCLQYDELP
Neotoma lepida V22 igkv LZPO01017523.1 129007 ARCDIQVTQSPSFLSASLGDKITISCLASQSISNDLNWYQQKSGQAPTLLIYYATNLQSGVPSRFSGQYSRKSFTLTISSLEPEDVGTYYCLQHYNA
Neotoma lepida V23 ighv LZPO01017988.1 199 VKCEVQLVESGGGLVQPGKSLKLSCAASGFTFSSYGMNWVRQAPGRGLEWVAYISYSSGTIHYANAVKGRFTVSRDNAKNNLYLEMSNLKPEDTAMYYCTG
Neotoma lepida V24 ighv LZPO01017988.1 12909 VQCEVQLVESGGSLVQPGKSLKLSCAASGFTFSSYYMSWVRQAPGKGLEWVAHISDGSSDIKYADTVKGRFTISRDNAKNTLSLEMNSLRSEDTAMYYCTR
Neotoma lepida V25 igkv LZPO01018011.1 35355 SRGDVVMTQTPTSLPVSLGDHVSISCRSSQSVVHSNGNTYLHWYQQKPGQSPQPLIYRVSNRFSGVPDRFSGSGSGTDFTLTISRVEPEDLGIYYCFQGTHAP
Neotoma lepida V26 ighv LZPO01018110.1 9589 VHSQVQLQQSGAQLVRPGASVKLSCKASGYTFTSYYMHWVKQRPGQGLEWIGRIDPADDETKYAQKFQGKAKLTADKSSSTAYMELSSLTSEDSAVYYCA
Neotoma lepida V27 ighv LZPO01018110.1 14556 VQCEVKLVESGGGLVQPGGSLRLSCAASGFTFSDYWMNWVRQAPGKGLEWVGMIEHKPNNYATYYAESVKGRFTISRDDSKSSVYLQMSSLRAEDTAMYYCTR
Neotoma lepida V28 ighv LZPO01018110.1 23248 VCCEVQLVESGGSLVQPGGSLRLSCAASGFTFSSAWMAWVRQAPGKGLEWIGEINGDSSTIKHAPSLKDQFTISRDNAKSTLYLQMNSVRSEDTATYYCA
Neotoma lepida V29 igkv LZPO01018210.1 302 ARCDIQMTQTPSSLSASLGDRVTLGCQASEDISNFLSWYQQKPGEAPKRLIYYTNTLADGVPSRFSGSGSGTDYSLTINSLEYGDMGIYYCLQSDQLP
Neotoma lepida V30 igkv LZPO01018210.1 30075 AICDIQVTQTPTSLSASLGDKVTITCKASQGISNYLNWYQQKPGEAPKPLIYYTNRLADGVSSRFSGSGSGTDYSLNIGSLESGDMGTYYCQQHAQYP
Neotoma lepida V31 igkv LZPO01018210.1 37216 ARCDIQMTQTPSSLSASLGDRVTLRCQASEDISKYLSWYQQKPGEAPKPLIYYTNRLEDGVPSRFSGSGSGTDYSLTISNLESEDIADYYCLQYYKLP
Neotoma lepida V32 trav LZPO01018388.1 5817 VSSQQKVQQNPESLSVPEGAKASLNCTFSDRASQYFWWYRQQPGKGPKALVSIFSNGEKEEGRFTVYLNKDSLHVSLHIRDSQPNDSAVYFCAV
Neotoma lepida V33 trav LZPO01018388.1 21214 ESQGEQVKQHPSTLSIQEGDSTVINCTYTDSTSAYFPWYKQEPGKHPQFIIDIRSNVERKQNQRLTLLLDKKAKHLSLYITATQPADSAIYFCAAD
Neotoma lepida V34 ighv LZPO01018714.1 14730 VHCEVQLVESGGGLVQPEGSLKLSCAASGFTFSKAAMYWVRQAPGKGLEWVARIRTKSNNYATYYTDSVKDRFIISRDDSQSMVYLQMNNLRTEDTAMYYCTR
Neotoma lepida V35 trav LZPO01018761.1 5850 RTHGNSVTQTGGQVTILEGGFLTINCTYSVTTIGSPTLFWYVRYPGESLQLLLKVITAGAKGSSRGFEATYDKESTSFHLQKASVQESDSAVYYCALG
Neotoma lepida V36 trav LZPO01018761.1 8322 VAGKTQVEQSPQSLAVLQGDNCVLHCSFTVIPTNNLKWYRQDTGRGLVSLAVMTHTENKQSNRRYSATLDTDAQHSTLHITASQLEDTAFYICVVG
Neotoma lepida V37 ighv LZPO01018904.1 3684 VHSQVQLQQSGPELVRPGSSVKLSCKASGYTVKYIHWVKQRPGQGLEWIGRIDVRDSDTSYNQKFQGKAKLTADKSSSTAYVELSSLTSEDSAVYFCA
Neotoma lepida V38 ighv LZPO01018904.1 13313 VHSQVQLQQSGPELGKPGASVKLSCKASGYTFTDYVMHWVKQRPGQGLEWIGWIGTSSGDTGYAQKFQGKAKLTVDKSSSTAYMELSSLTSEDSAVYYCA
Neotoma lepida V39 igkv LZPO01024087.1 82 VRCDIQMTQSPSTLSASLGDRVTITCHASQNINSWLAWHQQKPGNAPKPLIYKTSNLHTGVPSRFSGSGSGTDYSLTISNLQPEDIATYYCQQDNSNP
Neotoma lepida V41 igkv LZPO01028264.1 27677 SNGDIVLTQSPASMAASPGEKVSLTCSVSSSISSSYLNWYQQKPGASPKPLIYRTSTLASGVPARFSGSGSGTSYSLTISSMEPEDTAIYFCQQWSSYPS
Neotoma lepida V42 trav LZPO01028312.1 22304 VSSQQKVQQNPESLSVSEGAMASLNCTSSDRNSDYFWWYKQHPGKGPKALLSVFSNGDKEEGRFTVHLNKASLHVSLHIKDSQPSDSAVYLCAV
Neotoma lepida V43 ighv LZPO01029027.1 1638 VQCDVQLVETGGSLVQPGGSLRLSCSASGFTFRDYWMNWFRQAPGKGPEWIAEINEDSSTINYAPSLKDRLTISRDNAKNTLYLQMNSVRSEDTAMYYCVI
Neotoma lepida V44 trbv LZPO01031625.1 902 LTDAGITQTPRYWITQTGRKLTLECSQNMNHYSMFWYRQEAGQGLRLIHYSGSVGSTNKGDVPEGYSVSRNKSEDFPLTLESTRPSQTSMYFCASS
Neotoma lepida V45 ighv LZPO01033300.1 504 VLSQVTLRESGPGLLQPSQDLSLTCSFSGFSLSTSGIGVSWIRQPPGKGLEWLANIWWDDDKRYNPYLKSRLTISKDTSNNQVFLKVTRVDTADTATYYCARR
Neotoma lepida V46 trav LZPO01035157.1 48338 TWSLAKTTQPLSMDSYEGQEVNVSCSHTNIATNEYIYWYRQVPHEGPHFIIQGYNVHVANEVASLFIAADRKFSTLSLPRVSLRDTAVYYCIVV
Neotoma lepida V47 trav LZPO01035157.1 56007 VSRGEQVEQQPSLLSVQEGDSAVINCTYTASAPSFFSWYKQEPGVGLQLLINVLSNVDKKEEQGLIVLLKKKDKHLSLNIIAARPEDSATYFCATS
Neotoma lepida V48 trav LZPO01035157.1 75792 GVRGMQVEQNPPALSLHEGASFALRCNFSITMTYVQWFRQNPGSSLIRLFSMAPGTKDNGRFKSTFNSKERYSTLHIRDAQLEDSSTYLCAAD
Neotoma lepida V49 trav LZPO01035157.1 81560 ESRGEQVEQHPSTLSVLEGDSIVINCTYTDSASVYFLWYKQEPGKHPEFIIDIRSNVERKQNQRLTLLLDKKAKHLSLYITDTQPGDSAIYFCAVD
Neotoma lepida V50 trav LZPO01035157.1 92651 VSSQQKVQQNPESLSVPEGAMASLNCTFSDSTSQSFWWYRQQPGKGPKALVSIFSNGEKAEGRFTVYLNKDSLHVSLHIRDSQPNDSAVYFCAV
Neotoma lepida V51 iglv LZPO01035366.1 25545 SMASYILTQPPSVSVALGQKAIITCSGDKLSDKYVHWYQQKPGQAPVLVIYGDNNRPSDIPDQFSGSNSGNTATLTISNAQAGDEADYYCQSS
Neotoma lepida V52 iglv LZPO01035366.1 42878 FVASYKLTQPPSASVTAGEIVTITCSGDQLPKYYASWYQQKPDQTILQLIYKDSELPSGIPDRFSGSSSGTTATLTISGALSEDEADYYCLSAYDDGN
Neotoma lepida V53 trbv LZPO01035434.1 19168 VNAQIIHQWPAVRVQPVGSSLSLECTIKGQSNPNLYWYWQAPGGTLQQLFYSVSADEVESVVSRNLSASRPKDGQFTLSSEKLLLSHSGFYFCAWS
Neotoma lepida V54 igkv LZPO01035936.1 4555 TSGDVVLTQTPLSLSTTIGQSASISCKSSQSLLHSDGKTYLNWLLQRPGQPPQHLIYQVSNRDTGVTDRFSGSGSGTDFTLKISRVEGEDLVVYYCLQG
Neotoma lepida V55 trav LZPO01035943.1 9819 VAGKTQVEQSPQSLAVLQGDNCVLHCNYTVSPANNLRWYRQDTGRGLVSLAVMTHTENKKSNGRYSATLDTDVKHSTLHITASQLEDTASYICVVG
Neotoma lepida V56 trav LZPO01035943.1 28175 VKGQQVKQSPVSLVLQEGESAEMQCNSSTNLYQMQWFYQSPGGHLINLLSNPSGTKQSGRLTSTTVTQERRSSLYISSSQTTDSGTYFCAMEPQCS
Neotoma lepida V57 igkv LZPO01036042.1 21717 SSGDVVMTQTPTSLPASLGDQVSISCRSSQSLVHSNGNTYLDWYLQRPGQSPQLLIYLVSNRFSGVPDRFSGSGSGTDFTLKISRVESEDLGVYYCLQR
Neotoma lepida V58 iglv LZPO01036419.1 6258 SWAEVVFTQPQSVSGSLGQKITISCTRSSGNIGSDYVHWYQQHSPNRPRLLIYQYDQRPSGVPDRFSGSKDSSSNSGILTISGLQPEDEAGYYCLSGYDSY
Neotoma lepida V59 ighv LZPO01045082.1 23470 VNSQVQLQQSGPVLGRPGASVKLSCKTSGYTFTEYYMHWVKQRPGQGLEWIGRIYPEDSDTDYVQKFQGKAKLTADKSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V60 ighv LZPO01045082.1 41862 VHSQVQLQQSVPGLGKPGASVKLSCKASGYTFTDYGMHWVKQKPGQSLEWIGVIDPASGGTAYNQKFQGKATLTADKSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V61 igkv LZPO01045284.1 3561 SRCDIQMTQSPSQTASLWDTVTIKCQASQSIGKALAWYQQKPGKSPKLLIYDASSLYSGVPSRFTGSGSGTDFTLTISSLEPEDIGTYYCQQYSSY
Neotoma lepida V62 trav LZPO01045566.1 1429 ENNGDSVTQTEGQVTLSEGTSLTVNCSYETKQYPALFWYVQYPGEGPQLLFRVSKANEKGSSRGFEATYDKESTSFHLQKASVQESDSAVYYCALR
Neotoma lepida V63 trav LZPO01045566.1 14432 VVGKTQVEQSPQSLAVLQGDNCVLHCDFTVIPTNNLKWYRQDTGRGLVSLAVMTHTGKKKSNGRYSATLDTDAQHSTLHITASQLEDTASYICVVG
Neotoma lepida V64 trav LZPO01045566.1 28320 VSSQQKVQQNPESLSVPEGAIASLNCTFSDSASDYFLWYRQHSGKGLEVLMSIVSHGEKEEGRFTVHLNKASQHISLHIRDSQPSDSADYLCAVR
Neotoma lepida V65 igkv LZPO01045716.1 1528 VKCDIQMTQSPVSLSVSLGDSVTITCQASEDISWSLAWYQQKPGKSPKLLIYSADSLENGVPSRFSGSGSGTQFSFKISGVQSEDIATYYCQQYSNVP
Neotoma lepida V67 ighv LZPO01055575.1 55733 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYGVHWVRQPPGKGLEWMGAMWYNGNTDYNSALKSRITISRDTSKSQVFLKLNNLQTEDTATYYCAR
Neotoma lepida V68 ighv LZPO01055660.1 40056 VQCEVQLVESGGGLVQPGGSLRLSCSASGFTLSDYWMNWFRQAPGKGPEWIAEINEDSSTTNYAPSLKDRLTISRDNAKNTLYLQMNTVRSEDTAMYHCVI
Neotoma lepida V69 ighv LZPO01056167.1 5150 VHSQDQLHQSGAVLGRPGASVKLSCKGSGFSITSYYMHWVKQSPGQGLEWIGWIDPANGNTKYNQKFQSKAKLTADKSSNTAYMELSSLTSEDSAVYYCT
Neotoma lepida V70 ighv LZPO01056167.1 16202 VHSQDQLHQSGAVLGRPGASVKLSCKGSGFSITSYYIHWVKQRPGQGLEWIGWIDPEDDRTKYNQKFQGKAKLTADKSSNTAYMELSSLTSEDSGVYYCA
Neotoma lepida V71 iglv LZPO01057769.1 84 AISQAVVTQESSLTTSPGGTVTLTCGSSTGAVTTSNYANWVQEKSYQMLTGLIGSTNNRAPGVPARFSGSLIGGKAALTITGAQSEDEAVYYCALWYSDY
Neotoma lepida V72 ighv LZPO01061088.1 504 VHSQVQLQQSGPGLGKPGASVKLSCKASGYTFTDYYITWVKQKPGQGLEWIGRIYPASGSTYYNQKFQGKAKLTADKSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V73 ighv LZPO01065113.1 439 VHSQVQLQQSGPELGKPGASVKLSCKASGYTFTSYWMSWVKQRPGQGLEWIGWINPASGGTGYNQKFQGKATLTADTSSSTAYMELSSLTSENSAVYYCA
Neotoma lepida V74 trav LZPO01066550.1 41932 LDTQQLSQLSQNPQFLSIQEGQDLTVYCNSSSTFPQFYWYRQVPREGPAILMTLVKSGEVKEQKRMTAKFGEARKDSSLRIIRAQPGDAGIYFCAG
Neotoma lepida V75 trav LZPO01066550.1 92252 IVGDAKSTQPSSMESTEEETVHLPCSHSTISGNEYIYWYRQVPLQGPEYIIHGLQQNTSNSMAFLAIPSDRKSSTLILPRVSLGDAAVYYCMVRE
Neotoma lepida V77 trav LZPO01066550.1 108989 VNSQVLSQSAQYISIPEGKDVSMSCNSSSTLNNFLWYKQAPGEGLVLLVALYKSGDLVRNGKVTAEFGGTRKDSVLTISASEPVDTSTYFCAG
Neotoma lepida V79 igkv LZPO01066708.1 34134 SRGDIVLTQSPATLSVTPRGRVTMTCKASQGINNNIHWYQQKPNEAPRFLLQYSSEFISVIPSRFRGGGSGTDFTLSINNVQPEDVATYYCQQT
Neotoma lepida V80 igkv LZPO01066708.1 54311 SRGDIVLTQSPATLPVTPGDRVSMTCKASQGISTSLHWYQQKPNEAPRLLIKYASGSVSGIPSRFSGSGSGTDFTLSINNVEAEDVASYYCQQSSSWP
Neotoma lepida V81 igkv LZPO01066708.1 54821 SRGDIVLTQTPATLPVTPGDRVSMTCKASQGISTSLHWYQQKPNEAPRLLIKYASQSISGIPSRFSGSGSGTDFTLSISNVEPEDVASYYCQQSSSWP
Neotoma lepida V82 igkv LZPO01066718.1 3032 TSGDIVLTQSPASLAVSLGQRVTISCKASQSVSDSVYTYMHWYQQKPGQSPKRLICRASNLDSGIPARFSGSGSGTDFTLTMHPVEADDTATYFCLQSKEVP
Neotoma lepida V83 igkv LZPO01066718.1 35227 VTGDIVLTQSPAFLAMSLGQRVTISCKSSQSVSGSVYTYMHWYQQKPGQSPKLLIHRVSNLASGVPARFSGSGSGTDFTLTIHPMEADDAATYFCQQSWEDP
Neotoma lepida V84 igkv LZPO01066800.1 23877 AICDIQMTQTPTSLSASLGEKVTITCKASQGISNYLNWYQQKPGEAPKLLIYYTNRLADGVPSRFSGSGSGTDYSLNIGSLESGDMGIYYCQQHAQYP
Neotoma lepida V85 igkv LZPO01066800.1 31441 ARCDIQMTQTPSSLSASLGDRVTLRCQASEDISKYLSWYQQKPGEAPKPLIYYTNRLEDGVPSRFSGSGSGTDYSLTISNLESEDIADYYCLQYYKLP
Neotoma lepida V86 igkv LZPO01066800.1 54094 SRCDIQMTQTPSQTTSLRDTVTIKCQASQSIGTALAWYQQKPGKSLKLLIYAASSLYSGVPSRFSGSGSGTDFTLAISSLEPEDIGTYYCQHYSSY
Neotoma lepida V87 igkv LZPO01067025.1 5802 ARCDIQMTQSPSSLSASLGERVTITCLASEDISNSLNWFQQKPGKAPKLLIYGASSLEDGVPSRFSGSGSGTDFSLTISSLESEDIADYFCLQHDELP
Neotoma lepida V88 igkv LZPO01067025.1 31149 TNGDIVMTQTPLSLSVTIGQSASISCQSSQSLLYSDGKTYLNWFLQRPGQSPQRLIYQVSKLNPGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCMQGSYPP
Neotoma lepida V89 igkv LZPO01067025.1 46407 TRCDIQMTQSPSSLSASLGDRVTITCRASQGISYALNWFQQKPGKAPKLLIYGADSLEDGVPSRFSGSGSGTDFSLTISSLEPEDIATYYCLQVYNTP
Neotoma lepida V90 iglv LZPO01067535.1 1483 SCAAVVFTQPQSVSGSLGQKITISCTHSSGNIGINYVHWYQQRSANAPCLLIYQYDQRPSGVPDRFAGSKDSSSNSGILTISELQPEDETDYYCLSSYDSY
Neotoma lepida V91 ighv LZPO01070056.1 759 ALSQVQLKESGPGLVQPSQILSLTCTVSGFSLTGYDVCWVRQPPGKGLEWMGAMWRGGGTEYNPALKSRITISRDTSKSQVFLKLNNLQTEDTATYYCA
Neotoma lepida V92 igkv LZPO01076836.1 20733 ASGDIVMTQAALSGPVTLGESASFSCRSSQSLLHSNGNTYLHWHHQRPGQSPQLLIYRVSNLASGVPSRFSGIGSGTDFTLKISKVEAEDVGVYYCLQ
Neotoma lepida V93 igkv LZPO01076836.1 23273 ASGDIVMTQAALSGPVTLGESASFSCRSSQSLLHSNGNTYLDWYHQRPGHSPQLLIYRVSNLASGVSNRFSGSGSGTDFALKISKVEAEDVGVYYCLQRLEYP
Neotoma lepida V94 igkv LZPO01076882.1 5660 SIGDVVMTQTPLFLPVSLGDQVSISCRSSQSLAHSSGYTLLYWYLQRPGQSPQPLIYFVSNRFSGVSDRFSGSGSGTDFTLKISRVESDDLGVYYCFQG
Neotoma lepida V95 ighv LZPO01077053.1 4215 VQCEVQLVESGGGLVQPGNSLKLSCSASGFPFSTYFMNWIRQAPGKGLEWVAQIRSKTFSYEAYYAESVKGRFTISRDDSQSRVYLQMSSLRAEDTAIYYCTR
Neotoma lepida V96 ighv LZPO01077053.1 13352 VHSQVQLQQSGAELVRPGASVKLSCKASGLTFAYTYITWVKQRPGQGLEWIGLIIPGSSGTEYNQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V97 trav LZPO01077226.1 376 VSSQQKVQQNPESLSVPEGATASLNCTFSDSTSNYFSWYRQHSGKGPELLLSVISSGKEEGRFTVHLNKASLHVSLHIRGSQPSDSAVYFCAVR
Neotoma lepida V99 igkv LZPO01087230.1 52329 ACADIVMTQSPSSLAVSAGEKVTISCKSSQSLYLSQNNYLAWYQQKPGQSPKLLIYLASTRNTGVPDRFTGSGSRTDFTLTISSVQAEDLADYYCQQHYDTP
Neotoma lepida V100 igkv LZPO01087230.1 71115 ACADTVLTQSPSSLAVSAGEKVTISCKSSQNLLYSENQKNYLAWYQQKPGQSPNLLISWASTWNTGVPDRFIGSGSGTDFTLTISSVQAEDLGDYYCMQDYYLP
Neotoma lepida V101 igkv LZPO01087230.1 112340 STADNVLTQSPPSLTVSLGQRATISCRSSQSVTIGSTHRMHWYQQKPGQPGKLLIYYASNLASGVPARFSGSGSGTDFTLTINPVEADDAATYYCQQSKEFP
Neotoma lepida V102 igkv LZPO01087230.1 122203 ICADILMTQSPSSLAVSAGEEVTINCKSTQNLFGSKSKKNRLVWYQQKPGQSPKLLIYWASTRDTGVPDRFIGSGSGTDYTLTISSVQAEDLADYYCMQDHSYP
Neotoma lepida V103 igkv LZPO01087230.1 165420 TCADIVMTQSPSSLAVSAGEKVTISCKSSQSLLYNENKKNYLAWYQQKPGQSPKLLISWASTRYTGVPDRFIGSGSGTDFTLTISSVQAEDLTDYYCQQYYSYP
Neotoma lepida V104 igkv LZPO01087230.1 208079 STGDIVLTQSPPSLTVSLGQQATISCRSSQSVTIGSIHFMQWYQQKPGQPPKLLIYAASNLESGVPARFSGSGSGTDFTLTIHPVEADDAATYFCQQIKDYP
Neotoma lepida V105 igkv LZPO01087230.1 219907 ICGDTVMTQSQSSLSVSAGEKVTINCKSSQSLFSSYTNKYHLIWYQQKPGQSPKCLIYWASTRDTGVPDRFTGSGSGTDFTLTISNVQAEDLADYYCQQHYSTP
Neotoma lepida V106 igkv LZPO01087230.1 223259 VCADILMTQTPSSLAVSAGDKVTMSCRSSQSLLYSNQYYFVWYQQKPGQFPKRLIYWASTRDTGVPDSFTGSGSETDFTLTISSVQAEDLADYYCMQHYSDP
Neotoma lepida V107 igkv LZPO01087230.1 236273 ICGDILMTQSPSSLSVSAGDKVTINCKSSQSLFYSYSEKNHLAWYQQKPGQAPKLLIYYASTGDTGVPDCCKGSGSETDFTLTISNVQADDLADYYCLQDHSTP
Neotoma lepida V108 igkv LZPO01087230.1 300938 VCADILMTQSPSSLAVSAGEKATISCKSSQSLLYSGNQKNYLAWYQQKPGQSPKLLIYLASTRNTGVPDRFVGSGSRTDFTLTISSVQAEDFADYYCVQHYDTP
Neotoma lepida V109 ighv LZPO01087336.1 296 VHCEVQLVESGGGLVQPTGSLKLSCAASGFTFSDYAMSWVRQAPGKGLEWVAVIGTKSYNYVTYYADSVKDRFTISRDDSQSMVYLQMNNLKTEDTAMYYCTR
Neotoma lepida V110 ighv LZPO01087336.1 30700 VHSQDQLQQSGAELGKPGSSVKLSCKASGYTFTNYWMSWVKQKPGQGLEWIGRIHLGSGDTNYNQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCA
Neotoma lepida V111 ighv LZPO01087336.1 44080 IHSQVQLQQSGVELGRPGASMKLSCKASGYTFNSYGMHWVTQRPGQSLEWIGYINPGNGYTEYNQKFQGKAKLTTDSSSSTAYLEFSSLTSGDSAVYYCV
Neotoma lepida V112 ighv LZPO01087336.1 70657 VHSQVQLQQSGPGLGKPGASVKLSCKASGYTFSNHYITWVKQKPGQGLEWIGWIYPGSGSTNYNQKFQNKAKLTADKSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V113 ighv LZPO01087336.1 90838 VHSQIQRQQSGPGLGKPGASVKLSCKASGYTFTSYWVHWVKQRPGQGLEWIGRIYPGDGDTRYAQKFQGKAKLTADKSSNTAYLELSSLTSEDTAVYYCAR
Neotoma lepida V114 ighv LZPO01087336.1 119155 VHSQVQLQQSGAELGRPGSSVKLSCKASGYTFTDYVISWVKQKPGQGLEWIGYIAPWNGGTNYNKKFQGKATLTADKSSSTAYMELSSLTSEDSALYYCA
Neotoma lepida V115 ighv LZPO01087336.1 126977 VHSQVQLQQSGAELARPGSSVKLSCKASGYTFTDYWVNWVKQRPGQGLEWIGGIDPEYDSTGYNQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCV
Neotoma lepida V116 ighv LZPO01087336.1 156506 VHCEVQLVESGGGLVQPTGSLKLSCAASGFTFSDYAMSWVRQAPGKGLEWVARIRTKNNNYATYYADSVKDRFTISRDDSQSMVYLQMNNLRTEDTAMYYCTR
Neotoma lepida V117 ighv LZPO01087515.1 19571 VQGEVQLVESEGGLVQPGNFLKLSCAASGFTFRDYWMNWVRQAPGKRLESVALIMDKANDYATRYAESVKDRFTISRDDSKSSVYLQMSSLRAEDTAIYYCTK
Neotoma lepida V118 ighv LZPO01087515.1 36459 VHSQVQLQQSGPGLGKPGASVKLSCKASGYTFTDYYMIWVKQKPGQGLEYIGYINPASGNTNYNQKFQGKATLTADTSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V119 ighv LZPO01087515.1 51520 VHSQVQLQQSGTELVRPGASVKLSCKASGYTFTSYAMSWVKQRPGQGLEWIGYFYPWSSGTDYNQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V120 trgv LZPO01087595.1 12051 GESWISQDQLSFTRRPNKTVHISCKLSGVPLQNTIVHWYQLKEGEPLKRIFYGSAKTYKQDKPNSRLETDEKNDGTFYLIINNVITADEATYYCACWD
Neotoma lepida V121 iglv LZPO01087756.1 41023 SVASYELTQPPSASVTVGETVTITCSGDQLPKKYAYWYQQKPDQTILQLIYEDTKRPSGIPDRFSGSSSGTTATLTISGALSEDEADYYCLSAYGDDN
Neotoma lepida V123 iglv LZPO01088441.1 24558 AISQAVVTQESSLTTSPGGTVILTCGSSTGAVTTSNYANWVQEKSYQVPTGLIGGTSNRAPGVPVRFSGSLLGNKAALTITGAQPEDEAVYYCGLWYGDQ
Neotoma lepida V124 igkv LZPO01088685.1 17526 SRSDTVMTQSPATLSVTPGDRVTMTCRASQGISNYLHWYQQKPNEAPRLLIKYASESISGIPSRFSGSGSGTDFTLSINNVEAEDIANYYCQQG
Neotoma lepida V125 trav LZPO01089003.1 7516 VKGQQVKQSPVSLVLQEGESAEMKCNSSTVLNNVQWFYQSPGGHLISLFYNPSGTKQNGRLTSTTVAKEYRSSLYISSSQTTDSGTYFCAMEPQCS
Neotoma lepida V126 ighv LZPO01090773.1 541 VHSQVQLQQSGLELVRPGASVKLSCKASSYTFTNYWVNLVKQRPGQGLEWIGSIYPDYGSTYYNQKFQDKAKLTVDKSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V127 ighv LZPO01095311.1 2034 VHSQVQLQQSGAVLGKPGASVKLSCKASGYTFTGYWMNWVKQKPGQGLEWIGYINPASGYTNHNQKFQGKAKLTADTSSSTAYMELSSLTSDDSAVYYCAR
Neotoma lepida V128 igkv LZPO01097411.1 21593 ARCDIQMTQSPSSISASLGDTVKLTCRSSQGISNSLSWYQQKPEEAPKCVIYAASSLDNRFPSRFSGSRSGTDFSLTISSVESEDTATYFCLQTYQSP
Neotoma lepida V129 igkv LZPO01097411.1 29467 ARCDIQMTQSPSSLSASLGDRVTITCRASQGINSNLNWLQQKPGKAPKRLIYAASNLDNGIPSRFSGSGSGTDYSLTINSVESEDTAFYYCVQYAQYP
Neotoma lepida V130 igkv LZPO01097411.1 39341 SRCDIQMTQSPSQTASLGDTVTIKCQASQNIGNALNWYQQNPGKSPKLLIYAASSLEDGVPSRFSGSGSGTDFTLTISSLEPEDTGTYYCQQSYDY
Neotoma lepida V131 igkv LZPO01097411.1 51183 ARCDIQMTQSPSSISASLGDTVKLTCRASQGIGNYLSWYQQKPEEAPKRVIYAASSLDNRFPSRFSGSGSGTDFSFTISSVESEDMATYFCLQTNQYP
Neotoma lepida V132 igkv LZPO01097411.1 58085 ARCDIQMIQAPSSLSASLGDRVTLSCRSSEDISNYLSWYQQKPGEAPKLLIYHASNLANGVPSRFSGSGSGTDFTLTISSVESEDMAIYYCLQYYKLP
Neotoma lepida V133 igkv LZPO01097411.1 74477 ARCDSQMTQSPSSLSSSLGDRVTITCWDTQGISNYLNWYQQKPGKAPKLLIYYTNRLADGIPSRFSGSGSGTDYSLSISSLESEDITTYYCLQSVQSP
Neotoma lepida V134 igkv LZPO01097411.1 97007 ARCDIQVTQSPSFLSASLGDKVTISCLASQSISNELNWYQQKSGQAPTLLIYNANSLQSGVPSRFSGQYSGKSFTLTISSLELDDVSAYYCLQHYNA
Neotoma lepida V135 trav LZPO01097496.1 6360 GVRGAEVEQSPSALSLHEGTSSALRCSFSETMTTVQWFRQNPGSSLISLFFMAPGTKENGRLKSTFDSKERYSTLHIRDAQLEDSGTYLCAVQ
Neotoma lepida V136 trav LZPO01097496.1 8825 VSQGEQVEQHPSTLRVQEGASAVINCTYGDSVSSYFLWYKQGRGAHPQLIIDIRSPTERKQDQRLIVLLDKKAKHFSLQVTDTQLGDSAMYFCAAS
Neotoma lepida V137 trav LZPO01097496.1 10430 RSNGDSVTQTEGLVTVTEGLSVMMNCTYQTTYSGSFLFWYVQYPNKGPRLLLKSSTDNKRMEHQGFHATLHKSRSSFHLHKSSVQLADSALYYCAVS
Neotoma lepida V138 trav LZPO01097496.1 29954 VRGVEVVQSPLALSLHEGTSSALRCSFSETMTTMQWFQQNPGGSLINLFYLTPGTKENGRLKSTFNSKERYSTLHIRDAQLEDSGTYLCAVQAQCSQQ
Neotoma lepida V139 trav LZPO01097496.1 52284 RTQGDSVTQTEGQVVLSEEDFLTIHCNYSASGYPALFWYVQYPGEGPELLLKVTTADNKGSSRGFEATYDKESTSFHLQKASVQESDSAVYYCALS
Neotoma lepida V140 trav LZPO01098067.1 16358 VSSQQKVQQNPESLSVPEGAMASLNCTFSDRASQSFWWYRQQPGKGPKALVSIFSNGEKEEGRFTVHLNKDSLHVSLHIRDSQPSDSAVYFCAV
Neotoma lepida V141 ighv LZPO01098166.1 21384 VHSQVQLQQSGAELGRPGASVKLSCKASGYTFTDYEMHWVKQKPGQGLKWIGAIDPESGGTAYGQNFKGKAKLTADKSSSTAYMELSTLTPDDSAVYYCT
Neotoma lepida V142 igkv LZPO01098672.1 17054 ARCDIQMTQSPASLSASLGESVTITCQASQDIDGWLAWYQQKPVEPPKLLIYGANSLADGIPSRFSGSGSGTQYSLKISSLQPEDVATYYCQQSSSYP
Neotoma lepida V143 igkv LZPO01105181.1 875 TRCDIQMTQSPSSLSASLGDKITISCQASQGISNYLIWLQQKPGKAPKRLIYYTNRLAEGVPSRFSGSGSGTDYSLSISSLESEDVATYYCLQYDKRP
Neotoma lepida V144 igkv LZPO01108687.1 35893 ARCDIQMTQYPSSLSASLGDRVTITCSASQGISSYLSWLQQKPGSAPKRLIYGASNLDNGVPSRFSGSGTGTDYSLTISSMESDDAGIYFCVQYVQYP
Neotoma lepida V145 trav LZPO01108965.1 1621 MSQGEQVEQRPSTVSVQEGASAVINCTYVDSALYYFLWYKQEHGEHPKLIIDIRSTMERKQNQRLIVLLDKKAKHFSLHITDTQPGDSAMYFCGAS
Neotoma lepida V146 trav LZPO01108965.1 8609 RTHGDSVTQTEGQVILSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQLLFRVSKANEKGSSRGFEATYDKESTSFHLQKVSVRESDSAVYYCALD
Neotoma lepida V147 trav LZPO01108965.1 15731 VNSQLGEENAWALSIQEGENVTVNCSYKTSITALQWYKQDSGRGPAMLILILSNEREKRSGRLRATLNTSTKSSSLSITAAQAADTAVYFCATD
Neotoma lepida V148 ighv LZPO01109145.1 13954 HLVQSGGGFIQPGGSLRLYCEGSGFTFSDYYIHWHRQAPGKSLEWVGFIRSKPRGHTTEYAASVKQRFTISRDDSKNAAYLHMSSLRDEDTAMYYCAREA
Neotoma lepida V149 trav LZPO01115377.1 922 ESRGEQVEQHPSTLSVLEGDSIVINCTYTDSASVYFLWYKQEPGKHPEFIIDIRSNVERKQNQRLTLLLDKKAKHLSLYITDTQPGDSAIYFCAVD
Neotoma lepida V150 trav LZPO01115876.1 3199 GNRAQSVAQPDAQLTVSEGASLELKCSYSYGATPYLFWYVQYPGQSLQLLLKYVAGDTLVKGINGFEAEFTKSNSSFNLRKSPAHWRDSAKYFCALS
Neotoma lepida V152 trdv LZPO01117353.1 997 TSMAQKVTQAQTSISAMEKKTVTLDCAYETQESTYCLFWYKQTASGEMVFLIRQESYKRENATEGHYSLNFQNSESSIGLIITDVQIKDSAVYFCAMSK
Neotoma lepida V153 trav LZPO01117353.1 20161 VKGQQVKQSPVSLVLQEGESAELQCNFSTTATQMQWFYQSPGGHLISLFYNPSGTKWSGRLTSTTVSQERRSSLYISSSQTTDSGTYFCAMDPQCS
Neotoma lepida V154 trav LZPO01117353.1 56677 VSRGEQLEQQPSLLSVQEGDSAVINCIYTGTNYYFYWYKQEPGAGLQFLISISSSVDRKEEQGLVGLLKKNDKHFSLNITAAHPEDSATYFCAAS
Neotoma lepida V155 trav LZPO01117353.1 57933 KSGGDSITQTEGPVTLTVGAPLLLNCTYQTLYLEPLLLWYVQYLNKAPRLLLKSSTDNKRTEHQGFHATLHKGSSSFHLHKSSVQLADSALYYCCVR
Neotoma lepida V156 igkv LZPO01117943.1 14401 ACADIVMTQSPSSLAVSVGEEVTISCRSSQSLLYSKDQKNYLNWYQQKPGQSPKLLIYYASTRNSGVPDRFIGSGSGTDFTLTISSVQPEDLADYYCMQSSSTP
Neotoma lepida V157 igkv LZPO01117943.1 26351 AYADILMTQSPSSLAVSAGEKVTISCKSSQSLYSSTYQVNYLAWYQQKPGQSPKLLIYYASTRNSGVPDRFIGSGSGTDFTLTISSVQPEDLADYYCMQSSSTP
Neotoma lepida V159 igkv LZPO01005308.1 3035 ARCDIQMTQSPSSLSASLGERVTITCRASQDISYRLNWFQQKPGKAPKLLIYGASNLEDGVPSRFSGSGSGTDFSLTISSLESEDIADYFCIQHDELP
Neotoma lepida V162 igkv LZPO01008419.1 53153 VIGETTTQSPASLNFSPGETATLACRSSQSVGSYLAWYQQKPGRVPRLLIYGASTRASDVPVRFSGSGSGTDFTLTISSLEPEDVATYYCQPMSSWS
Neotoma lepida V163 igkv LZPO01008419.1 45087 TSGDVVLTQTPLSLSTTIGQSASISCKSSQSLLHSDGKTYLYWFLQRPGQSPQRLIYWVSNWGTGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCMQGTYAP
Neotoma lepida V164 igkv LZPO01008447.1 64516 SRSDTVMTQSPATLSVTPGDRVTMTCRASQGISNYLHWYQQKPNEAPRLLIKYASESISGIPSRFSGSGSGTDFTLSINNVEAEDIANYYCQQG
Neotoma lepida V165 igkv LZPO01008447.1 39495 SNGEIVLTQSPASMAASQGEKVTITCSASASISSSSLNWYQQKPGASPKHLIDRTSSLAPGVPDRFSGSGSGTSYSLTINSIEAEDVATYYCLYWTSIQP
Neotoma lepida V166 igkv LZPO01008447.1 1733 AKCDIQMTQSPASLSASLGESVTITCLASQNIYSGLAWYQQKPAEPPKLLIYGANSLADGVPSSFIGSGSGTQYSLKISSLQPEDVATYYCQQVSS
Neotoma lepida V167 ighv LZPO01009086.1 20843 VHSQVQLQQSGPELVRPGASVKLSCKASGYTFTDYYMYWVKQMPGQGLEWIGWIYPGNGNTKYNQKFQDKAKLTADTSSSTAYMELSSLTSEDTAVYFCA
Neotoma lepida V168 ighv LZPO01009898.1 7880 VHSQVQFQQSGAVLGRPGASVKLSCKASGYTFTSAYYITWVKQRPGQGLEWIGRILPITGSTDYNQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V169 ighv LZPO01016927.1 2177 VHSQVQLQQSGPVLGKPGASVKLSCKASGYTFTDYTMHWMKQRPRQGLEWIGYNVPGSSSTNYNQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCA
Neotoma lepida V170 igkv LZPO01017484.1 164213 ACADILMTQSPSSLAVSAGEKVTISCKSSQSLLYSNKNRLAWYQQKPGQAPKLLIYWASTRDTGVPDRFIGSGSGTDFTLTISSVQAEDLADYYCMQDHSTP
Neotoma lepida V171 igkv LZPO01017484.1 156960 STGNIVLTQSPASMPVSLGQRATISCRASKSVTSPAYSYIHWYQQKSGQPPKLLISLASTLAFEVPARFSGSGSGTDFTLTIHPVEADDAATYFCQQSYEYP
Neotoma lepida V172 igkv LZPO01017484.1 147979 ISADILTTQSPSSLAVSAGEKVTISCRSSQSLLYSKDQKNYLNWYQQKPGQSPKLLIYYASTRNTGVPDRFIGSGSGTDFTLTISRVQAEDLADYYCVQSYSEP
Neotoma lepida V173 igkv LZPO01017484.1 134994 ACADIVMTQSPSSLALSAGEKVTISCKSSQSLYSSYYQVNYLAWHQQKPGQSPKLLIYHASTRNSGVPDRFIGSGSGTDFTLTISSVQPEDLADYYCMQSSGT
Neotoma lepida V174 igkv LZPO01017484.1 107267 ACADIVMTQSPSSLAVSAGEEVTISCRSSQSIFNSNTKKNHLNWYQQKPGQAPKLLLYYASTRYTGVPDRFTGSGSGTDFTLTISSVQAEDLADYFCQQHYSTP
Neotoma lepida V175 igkv LZPO01017484.1 73743 ICGDIVMTQSPSSLAVSAGEEVTISCRSSQSIFNSNNKKNYLNWYQQKPGQAPKLLLYYASTRYTGVPDRFTGSGSGTDFTLTISSVQTEDLADYFCQQDYSYP
Neotoma lepida V176 igkv LZPO01017484.1 61953 ICGDIVMTQSPSSLAVSAGEEVTISCRSSQSIFNSNNKKNYLNWYQQKPGQAPKLLLYYASTRYTGVPDRFTGSGSGTDFTLTISSVQTEDLADYFCQQDYSYP
Neotoma lepida V177 igkv LZPO01017484.1 15647 AHGNIVMTQSPKSLSVLLEDKVIMSCKSSQNVGSSIAWYQQKPGQAPKLLIYSASTRYSGVPDRFIGSGSGTDFTLTISSVQAEDMADYYCMQYYSYP
Neotoma lepida V178 igkv LZPO01018011.1 17108 ASCDIQLTQSPSSLSTSPGDKVTITCKASQNINKYLAWYQQKPGEAPKLLIYDASSLQTGVSSRFSGSGSGTDFSLTISTLEPEDIATYYCQQG
Neotoma lepida V179 ighv LZPO01018135.1 31132 VHSQVQLQQSGPELGKPGASVKLSCKASGYTFTSYDMSWVKQKPGQGLEWIGWIIPGSGSTNYNQKFQGKAKLTADKSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V180 ighv LZPO01018135.1 18903 VHSQVQLQQSGPELVRPGTSVKLSCKASGYTVSYITWVKQRPGQGLEWIGWIDVRDSETKYAQKFQGKAKLTADKSSSTAYMELSSLTSEDSAVYFCAR
Neotoma lepida V181 ighv LZPO01018135.1 9799 VHSQVQLQQSGPGLVKPGASVKLSCKASGYTFTGNWVNWVKQRPGQGLEWIGSIYPGDGDTNYNQKFQGKAKLTADKSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V182 trbv LZPO01026357.1 1669 HTRAGVSQSPTHRITKKGQNVSFRCDPISGHNRLYWYRQSLGQGPEFLTYFQNEVAPDKSGLPGDHFSVERPNGSYSVLKIQPVKQKDSAVYLCASSL
Neotoma lepida V183 trav LZPO01027793.1 47873 MSQGEQVEQHPSTVSVQKGDSAVINCTYVDSTSYYFPWYKQEHGEHPKLITDIRSPTERKQDQRLIVLLDKKAKHFSLHIIDTQPGDSAMYFCAAS
Neotoma lepida V184 trav LZPO01027793.1 41407 RTSGDSVTQTEGQVVLSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQLLFRVSKANEKGSSRGFEATYDKGSTSFHLQKASVQESDSAVYYCALS
Neotoma lepida V185 trav LZPO01027793.1 20421 VSSQQKVQQNPESLSVLEGAMATLNCTFSDRNSDYFWWYKQHPGKGPKALMSVFSNGEKEEGRFTVYLNKASLHVSLHIKDFQPNDSAVYLCAV
Neotoma lepida V186 igkv LZPO01028163.1 38522 ASGDIVMTQAALSSPVTLGESASISCRSSKSLLHSNGNTYLYWLRQRSGQSPQLLIYRVSNLASGVPSRFSGSGSGTDFTLKISKVEAEDVGVYYCLQ
Neotoma lepida V187 igkv LZPO01028163.1 27928 ASGDIVMTQPALSSPVTLGESASISCKSSKSLLHSNGNTYLNWLRQRPGHSPQLLIYRVSNLASGVPNKFSGSGSGTDFTLKISKVEAEDVGVYYCQQWLENP
Neotoma lepida V188 igkv LZPO01028163.1 13828 ASGDIVMTQAALSSPVTLGKSASISCKSGKSLLHCNGNTYLNWFHQRPGHSPQLLIYQVSNLASGVPNKFSGSGSGTDFTLKISKVEAEDVGVYYCLQ
Neotoma lepida V189 trav LZPO01028737.1 16300 VKGQQVKQSPVSLVLQEGESAEIQCNFSISATQMQWFYQSSGGHLISLFSNPSGTKQNGKLKSTTVTQERRSSLYISSSQTTDSGTYFCAMNAQCS
Neotoma lepida V190 trav LZPO01028737.1 9900 VNSQQGEENPLALSIQEGENVTMNCSYKTSSTVLQWYKQDSGRGPALLIIMRSNEREKHSRRLRVTLNTSTQSSSLSITDAKTADTAVYFCATD
Neotoma lepida V191 trbv LZPO01029748.1 5042 HMEAVVTQDPRNKVTVSGRKVELSCHQTYNHDYMYWYRQDLGHGLRLIHYSYGAGSTEKGDVPDGYNVTRPNKEKFFLILEMASPSQTAVYFCASSD
Neotoma lepida V192 igkv LZPO01032901.1 1273 TSGDAMLTQTPLSLSVTIGQTASISCQSSQSLLHSDGNTYLYWFLQRPGQSPQRLIYHVSKLISGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCYQG
Neotoma lepida V195 iglv LZPO01035661.1 41153 SMASYILTQPPSVSVALNQKATITCSGDKLSDKYVHWYQQKPGQAPVLVIYEDNNRPSGIPDKFSGSNSGNTATLTISRAQAGDEADYYCQSWDRTDS
Neotoma lepida V196 ighv LZPO01035974.1 18309 ALSQVQLKESGPGLVKPSQTLSLTCTVSGFSLTSYHISWVRQPPGKGLEWMGAMWSSGSTDYNSALKSRITITRDTSKSQVFLKLNNLQTEDTAMYYCAR
Neotoma lepida V197 trav LZPO01036217.1 12353 ESQGEQVEQHPSTLSVQEGDSTVINCTYTDSVSVYFPWYKQEPGKHPEFIIDIRSNVERKQNQRLTLLLDKKAKHLSLYITATQPGDSAIYFCAVD
Neotoma lepida V198 trav LZPO01036277.1 14011 RSNGDSVTQTEGLVTVTEGLSVMLNCTYQTTYSGSFLFWYVQYPNKAPQLLLKSSTDNKRTEHQGFHATLHKSSSSFHLHKSSVQLADSALYYCALS
Neotoma lepida V199 ighv LZPO01036517.1 4215 VQCEVQLVESEGGLVQPGSSLKLSCATSGFTFSDYWMHWVRQAPGKGLEWVGAIKHKPDNYATSYLESVKGRFTISRDDPKSSVYLQMNSLKVEDTATYYCTT
Neotoma lepida V200 trdv LZPO01044596.1 148579 SSLGQKVTQVQSTASTHEGGKVILYCSYETSWNFYHLFWYKQLLSGEMIFLIRQVSSSTQNQRSGRYSVVFQKSAKSISLVISASQLEDSVKYFCALWED
Neotoma lepida V201 trav LZPO01044596.1 95260 MSQGEQVEQHPSTLRVQEGASAVINCTYGDSASSYFPWYKQQTGEHPQLIIDIRSNVKRKQDQRLMVLLDKKAKHFSLHVTDTQPGDSAMYFCAT
Neotoma lepida V202 trav LZPO01044596.1 93549 RSNGDSVTQTEGLVTVTEGLSVMLNCTYQTTYSTTPFLWWYVQYPNKGPRLLLKSSTDNKRTEHQGFHATLHEGSSSFHLHKSSVQLADSALYYCALS
Neotoma lepida V203 trav LZPO01044596.1 83593 VKGQQVKQSPVSLVLQEGESADLQCNSSVGFNSVQWFYGSPRGHLISLFSNPSGTKKSGRLTSTTVTQERRSSLYISSSQTTDSGTYFCAVDTQCS
Neotoma lepida V204 trdv LZPO01044596.1 71610 SSLGQKVTQVQSTASTHEGSKVTLDCSYETSQNIYHLFWYKQLLSGEMIFLIRQMSSSTQTERSSHYSVVFRKSAKSISLVISASQIEDSVKYFCALWELSQ
Neotoma lepida V205 trav LZPO01044596.1 58715 VRGVEVEQSLLALSLHEGTSSALRCSFSETMTTVQWFQQNPGGSLINLFYLIPGTKENGRLKSTFNSKERYSTLHIRDAQLEDSGTYLCAVQAQCSQQ
Neotoma lepida V206 trav LZPO01044596.1 48320 MSQGEQVEQRPSTLSIQEGASAVINCTYVDSASYYFLWYKQGPGEHPQLIIDIRSNVERKQDQRLIVLLDKKAKHFSLHITDTQPGDSAMYFCAAS
Neotoma lepida V207 trav LZPO01044596.1 42076 RTHGDSVTQTEGQVVLSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQLLFRASKANEKGSSRGFEATYDKESTSFHLQKASVRESDSAVYYCALS
Neotoma lepida V208 trav LZPO01044596.1 8652 VKGQQVKQSPVSLVLQEGESAELQCNFSTSATQMQWFYQSPGGHLISLFYNPSGTKQNGRLKSTTVTQERRSSLYISSSQTTDSGTYFCAMNAQCS
Neotoma lepida V209 iglv LZPO01045901.1 4643 SWAEVVFTQPQSVSGSLGQKITISCTRSSGSIESNSVSWYLQHSGNRPRLLIYNYDLRPSSAPDKFAGSKDSSSNSGILTISELQPEDEADYYCLSSYDSY
Neotoma lepida V210 trav LZPO01045941.1 13521 VSSQQKVQQNPESLSVPEGTMASLNCTFSDSTSNYFSWYRQNSGKGPELLLSVISSGKEEGRFTVHLNKASLHVSLHIRDSQPSDSAVYFCAVR
Neotoma lepida V211 ighv LZPO01046247.1 3435 AQCEVQLVETGGGLVQPGKSLKLSCAASGFTFSSYWMSWVRQAPGKGLEWVSYINSGGGSTSYANAVKGRFTISRDNAKNNLYLEMSNLKSEDTAMYYCVR
Neotoma lepida V212 trav LZPO01046503.1 4994 MSQGEQVEQRPSTLSIQEGASAVINCTYVDSASYYFLWYKQGPGEHPQLIIDIRSNVERKQDQRLIVLLDKKAKHFSLHITDTQPGDSAMYFCAAS
Neotoma lepida V213 trdv LZPO01054712.1 52648 KDALCITLTQSPQNKTVASGSEVTLPCTYGGKNRNPDLFWYRKRQDLTFQFILYRDDTRFHDADFVQGRFFVKHNKVYRNFHLVISPVMLEDSATYYCASG
Neotoma lepida V214 igkv LZPO01055351.1 68835 ARCDIQMTQSPSSISASLGDTVKLTCRASQGISNSLSWYQQKPEDAPKRVIYAASNLDNRFPSRFSGSGSGTDYSLTISSVESEDAAIYFCLQTYQSP
Neotoma lepida V215 igkv LZPO01055351.1 42227 SRCDIQMTQSPSQTASLGDTVTIKCQSSQNIGNALIWYQQKPGKSPKLLIYAASSLEDGVPSRFSGSGSGTDFTLTISSLEPEDIGTYYCKQYYDY
Neotoma lepida V216 igkv LZPO01055351.1 15154 SRGDVVMTQTPTSLPVSLGDEVSISCRSSQSLVLSSGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEPEDLGVYYCGQD
Neotoma lepida V217 igkv LZPO01055351.1 3845 GRCDIQVTQSPAFLSASLGDKVTITCLASQGISNELNWYQQKPGQAPTLLIYNANNLQSGVPSRFSGQYSGKSFTLTISSLKHEDVGTYYCLQHYNA
Neotoma lepida V218 ighv LZPO01055642.1 37925 VQCEVQLLESGGGLVQPGKSLKLSCAASGFTFSDAWMDWVRQAPGKGLEWVAQIRNKANNYATNYVESVKGRFTISRDDSKSSVYLQMNSLRAEDTAIYYCTR
Neotoma lepida V219 ighv LZPO01055642.1 27906 VHSQVQLQQSGAELGRPGASVKLSCKASGYTFTDQYITWVKQRPGQGLEWIGYIYPENGYTNYNQKFQGKAKLTADKSSSTAYMELSSLTSEDSALYYCARQRIT
Neotoma lepida V220 ighv LZPO01055642.1 15015 VHSQDQLHQSGAVLGRPGASVKLSCKASGFSITSYFMHWVKQRPGQGLEWIGRIDPDDGSTKYNQKFQSKAKLTADKSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V221 ighv LZPO01055642.1 2015 VHSQVQLQQSGAELGRPGDSVKLSCKASGYTFTTHYITWVKHSPGQGLEWIGYINPGNGGTNYNQKFQDKATLTADTSSSTAYLELSSLTSEDSAVYYCA
Neotoma lepida V222 trav LZPO01055664.1 18436 VSMAQTLTQPQQEKSVQETESATLHCTYDTRDTNYYLFWYKQQRGQMTLVIRQEAYKQQNATEDRFSVNFQKAAKSFSLEISDLQLEDAAMYFCALMER
Neotoma lepida V223 trav LZPO01055664.1 3592 ASMAQTLTQPQQEKSVQETESATLHCTYDTRDTNYYLFWYKQQRGQMTLVIRQEAYKQQNATEDRFSVNFQKAAKSFSLEISDLQLEDAATYFCA
Neotoma lepida V224 ighv LZPO01056096.1 28456 VQSQVQLQQSGAELVRPGASVKLSCKASGYTFTDYTMHWVKQRPGQGLEWIGYINTASGGTNYNQKFQGKATLTADTSSSTAYMELSSLTSEDSAVYYCA
Neotoma lepida V225 ighv LZPO01056096.1 2290 VQCEVQLVESGGGLVQAGGSLKLSCAASGFTVSAAWMNWVRQAPGKGLEWAAQIRSKTFSYEAHYAQSVKDRFTISRDDSKSRVYLQMSRLRAEDTAIYYCTT
Neotoma lepida V226 igkv LZPO01056435.1 23515 STGDIVLTQSPPSLTVSLGQRATMSCRASQSVTISRFHFMHWYQQKSGQSPKLLIYQASSLASGVPARFSGSGSGTDFTLTIHPVEADDVATYYCQQSKDYP
Neotoma lepida V227 igkv LZPO01056699.1 10375 ANGDIVMTQAAASSPVTLGESASISCRSSKSLLYSNGKTYLNWYLQRPGQSPQLLIYLVSNRASGVPDRFSGSGSGTDFTLKVSRVEAEDVGVYYCQQALENP
Neotoma lepida V228 ighv LZPO01057293.1 6172 VQCEVRVVESGGGLVKPGSSLKLSCEASGFPFSTYFMNWVRQAPGKGLEWVAQIRSKTFSYEAYYAESVKGRFTISRDDSKSSVYLQMSSLRTEDTAIYYCTR
Neotoma lepida V229 igkv LZPO01057438.1 3693 TSGDVVLTQTPLSLPVSIGQSASISCRSSQSLLDSDGDTYLDWFLQRPGQSPQLLIYEVSNWYTGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCIQGTYDP
Neotoma lepida V230 igkv LZPO01067597.1 22720 STGDIVLTQSPPSLTVSLGQQATISCRSSQSVTTGSTQLMHWYQQKPGQPPKLLIYYASNLASGVPARFSGSGSGTDFTFTIHAVEADDAATYFCHQSKGYP
Neotoma lepida V231 ighv LZPO01067742.1 18243 VHSQVQLQQSGPGLGRPGASVKLSCKASGYTFTNYWMSWVKQRPGQGLEWIAEIYPGNGNTNYNQKFQGKAKLTADKSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V232 iglv LZPO01068046.1 15025 AISQAVVTQESSFTTSPGETVTLTCGSSTGAVTTSNYARWVQEKSYQVHTGLIGSTSNIAPGVPARFSGSLIGGKAALTITGAQSEDEAVYYCALWYGGH
Neotoma lepida V233 ighv LZPO01072488.1 1000 VHSQVQLQQSGPGLGKPGASVKLSCKASGYTFTSYWMSWLKQRPGQGLEWIGNIYPEYDITNYNQKFQGKAKLTADKSSSTAYMELSSLTSEDSAVYYCA
Neotoma lepida V234 igkv LZPO01073025.1 1501 AICDIQMTQSPSTLSASLGDRVTITCQASQSISSWLAWYQQKPGKAPKLLIYYTNRLADEVPSRFSGSGSGTDYSLTISSLESDDMGIYYCQQGYTP
Neotoma lepida V235 trav LZPO01073303.1 2186 MSQGEQVEQRPSILSVQEGASAVINCTYVDSTSYNFLWYKQRTGERPQLIIDIRSNVERKQIHRLIVLLDKKAKHFSLHVTDTQPGDSAMYFCAT
Neotoma lepida V236 ighv LZPO01073314.1 820 VHSQVQLQQSVAELVRPGASVKLSCKASGYNFTSYVITWVKQKPGQGREWIGRINPGSCGTNYNQKFKGKAKLTADKSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V237 ighv LZPO01073701.1 368 VHSQVQLQQSGPGLGKPGASVKLSCKASGYTFTDYYMSWVKQKPGQGLEWIGVINTANGGTSYNQKFQSKAKLTADKSSSTAYMELSSLTSEDSAVYYCA
Neotoma lepida V238 igkv LZPO01076882.1 27931 ASCDIQLTQSPSSLSTSPGDKVTITCKASQNINKYLYWYQQKPGKAPKVLIYDASNLQTGVPSRFSGSGSGTDFSLTISSLEPEDVATYYCQQGYEP
Neotoma lepida V239 igkv LZPO01076882.1 9694 SNGEIVLTQSPASMAAFPGEKVTLSCLASSSVSSSYLHWYQQKTGGSPKPLIYGTSNLASGVPARFSGSGSGTSYSLTISSMEADDAATYYCQQRSSNP
Neotoma lepida V240 igkv LZPO01077091.1 17181 SNGQIVLTQSPASTAASPGEKVTLKCSASSSVSSSYLHWYQQKPGASPKLLIYSTSSLASGVPARFSGSGSGTSYSLTISSIEAEDVATYYCQQWSSNP
Neotoma lepida V241 igkv LZPO01077525.1 16518 TRCDIQMTQSPATLSASLGESVTITCRASEDIYSALAWYQQKPGIPPKLLIYDASSLEDGVPSRFSGSGSGTEYSLKISSLQPEDVATYYCQQGRSYP
Neotoma lepida V242 igkv LZPO01077617.1 14675 TRCDIQMTQSPTSLSASLGDTVTITCRASEDIYSALAWYQQKPGIPPKLLIYGANSLEDGVPSRFSGSGSGTEYSLKISSLQPEDMATYYCQQHSEDP
Neotoma lepida V243 igkv LZPO01087230.1 200747 CSGDNVLTQSPASFTVSLGFRATISCKASERVSLFGNSYMHWYQQKPGQPHKLLIYGTSNRESGVPARFSGSGSGTDFTLTIHPVEADDAATYYCQQTWKFP
Neotoma lepida V244 trav LZPO01087602.1 70338 GVRGDEVEQSPSALSLQEGTSSALRCNFSTTMRSVQWLRQNPEGNLISLLYLAPGTKENGRLKSTFDSKERYSTLHIRDAQLEDSGTYFCAAE
Neotoma lepida V245 trav LZPO01087602.1 62507 DVQAQSVTQPDAHVTVFEGDSVELRCNYSYSGAPYLFWYMQRCGQGLQFLLRYISGDPVVHGVNGFEAEFQKSKSSFHLKKTSVHLRDLAVYFCAVS
Neotoma lepida V246 trav LZPO01087602.1 56521 ESNGDSVTQTEGQVTLSEGTSLTVNCSYETKQYPSLFWYVQYPGEGPQLLFRVSKANAKGSSRGFEATYDKESTSFHLQKASVQESDSAVYYCAMG
Neotoma lepida V247 trav LZPO01087602.1 33613 RTHGNSVTQTGGQVTISEGGFLTINCTYSITTIAYPALFWYVRYPGESLQLLLKVSTAGAKGSSRGFEATYDKESTSFHLQKASVQESDSAVYYCALS
Neotoma lepida V248 trav LZPO01087602.1 29148 VDGKTQVEQSPQSLAVLQGESCVLHCSYTVSPANNLRWYRQDTGRGLVSLAVMTHTENKKSNGRYSATLDTDAQHSTLHITASQLEDTASYICVVG
Neotoma lepida V249 trav LZPO01087602.1 18642 VSSQQKVQQNPEFLSVPEKAMASLNCTFSDSSSDSFWWYRQHPGKGPKALMSIFSNGEKAEGRFTVHLNKASLHVSLHIRGSQPSDSAVYFCAVR
Neotoma lepida V250 trav LZPO01087609.1 70033 RSKADSVTQTEGLVTVTEGLPVMVNCTYQTASSPFLFWYVQYPNTTPRLLLKSATDNKRTEHQGFHATLHKSSSSFHLHKSSVQLADSALYYCALS
Neotoma lepida V251 trav LZPO01087609.1 3518 VRGVEVEQSPSALSLHEGTSSALRCSFSETMTTVQWFRQNPRSSLISLFFMAPGTKENGRLKSIFDSKERYSTLHIRDAQLEDSGTYLCAVQAQCSQQ
Neotoma lepida V252 ighv LZPO01088578.1 15497 GGVWGRLSAAWKVPETLLCSLWIHFSSYYMSWVRQAPGKGLEWVSSISNGGGSTYYANSVKGRFTISRDNAKNNLYLEMSNLKPEDTAMYYCAR
Neotoma lepida V253 ighv LZPO01088578.1 3893 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSNGVHWVRQPPGKGLEWMGVIRSTGSTEYNSALKSRITISRDTSKSQVFLKLNNLQTEDTAMYYCTR
Neotoma lepida V254 ighv LZPO01088601.1 19887 VHAQVQLQQSGAELVRPGASVKLSCKASGYTFTDYWVNWVKQKPGQGLEWIGGVNPKSGGTEYNQKFQGKAKLTADKSSSTAYMELSSLTSEDTAVYYCV
Neotoma lepida V255 ighv LZPO01088601.1 8091 VHSQVQLQQSGAVLGRPGASVKLSCKVSGDTFDSYAMSWVKQKPGQGLEWIGSIIPTIDHTNYNQKFQGKAKLTADTSSSTVYMELSSLTSEDSAVYYCAR
Neotoma lepida V256 trbv LZPO01088760.1 15410 PLETAVFQTPKHLVTQVGNKASLKCKQNLGHDAMFWYKQDSRQLLKIMFIYNNKEPILNESVPSRFSPQSQDKAHLDLHVKSVELDDTAVYFCASSY
Neotoma lepida V257 trbv LZPO01092796.1 1465 CVDATVMQNPRYKVARVGKPVNLSCSQNLNHNTMYWYQQKPNQGPKFLLYYYDTTLNRETDTSDNFQSSRPNTSFCSLDIRSAGLGDSAMYLCASSI
Neotoma lepida V258 igkv LZPO01096134.1 2609 ASGDIVMTQAAVSSPVTLGESASISCRSSKSLLHSNGNTYLNWYLQRPGQSPKALIYWMSNRFTGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQDLEFP
Neotoma lepida V259 ighv LZPO01097015.1 4695 VHCEVQLVESGGGLVQPEGSLKLSCAASGFTFSRAAMYWIRQAPGKGLEWVARIRTKSNNYATYYADSVKDRFIISRDDSQSIAYLQMNNLRTEDTAMYYCTR
Neotoma lepida V260 ighv LZPO01097110.1 768291 ALSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTSYHISWVRQPPGKGLEWMGIVAWNGNTNYNSALKSRITISRDTSKSQVFLKLNNLQTEDTAMYYCAR
Neotoma lepida V261 ighv LZPO01097450.1 88545 VHSQVQLQQSGPGLGKPGASVKLSCKASGYTFTSYGMHWVKQSRGQGLEWIGVINTANGGTSYNQKFQGKAKLTADKSSSTAYMELSSLTSEDSAVYYCAG
Neotoma lepida V262 ighv LZPO01097450.1 58659 VHCEVQLVESGGGLVQPKGSLKLSCAASGFTFPDYSMNWVRQTPGKGLEWVAHKSIKKYNYVTYYPDSVKGRFTISRDDSQSMAYLQMNNLKTEDTAMYYYCTR
Neotoma lepida V263 ighv LZPO01097450.1 37435 VHSQVQLQQSGPELGKPGASVKLSCKASGYTFISYAMSWVKQRPGQGLEWIGWIIPGSGSTNYNQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCA
Neotoma lepida V264 ighv LZPO01097450.1 24232 VHSQVQLQQSGAELGRPGASVKLSCRASGYTFTSYWMSWVKQRPGQGLEWIGRIDPADGETKYAQKFQGKAKLTADTSSSTAYMELSSLTSEDSAVYYCAR
Neotoma lepida V265 ighv LZPO01097450.1 3779 VHSQVQLQQSGPGLGKPGASVKLSCKASGYTFTSYYMDWVKQRPGQGLEWIGIINPGSGYIEYNQKFKNKAKLTADKSSSTAYMELSSLTPEDSAVYYCA
Neotoma lepida V266 igkv LZPO01098459.1 20223 VIGETTTQSPASLNFSPGETATLTCRSSQSVGSYLAWYQQKPGQVPRLLIYGASTRASDVPVRFSGSGSGTDFSLTISSLEPEDVATYYCQPMSSWS
Neotoma lepida V267 igkv LZPO01098459.1 11341 TSGDVVLTQTPLSLSTTIGQSASISCRSSQSLLHSDGKTYLYWFLQRPGQSPHLLIYLASTRYTGIPDRFSGSGSGTEFTLKISRVEAEDLGVYYCMQG
Neotoma lepida V268 igkv LZPO01102741.1 328 SSSDVVMTQTPISLPVNLGDQASITCRSSQSLLHNNGNTYLYWYQQRPGQSPKALIYRVSNRYSGVPDRFSGSGSGTDFTLKISRVEPEDLGIYYCMQSIQLP
Neotoma lepida V269 trbv LZPO01109211.1 5109 HTDAGVIQSPRHEVAEKGQIVTLKCEPVSGHNDLFWYRQTKIRGLELLSYFRSKSLMESDKTLKDRFKAEMLNSSVSTLKIQPTEPQDSAVYLCASSL
Neotoma lepida V270 ighv LZPO01109534.1 12713 VQCEVQLLESGGGLVQPGKSLKLSCAASGFTFSGYSMNWVRQASGKGLEWVAYISSGSGTIYYADAVKGRFTISRDNAKNNLYLEMRNLKLEDTAMYYCTR
Neotoma lepida V271 ighv LZPO01115490.1 2012 VQCEVKLVESGGGLVHPGGSLRLSCAASGFTFSRYWMNWVRQAPGKGLEWIGEINPSGGTTNYAPSLKDRFTISRDNAKNTLYLQMNSVRSEDTATYYCA
Neotoma lepida V272 ighv LZPO01116698.1 4590 VHCEVQLVESGGGLVQPGNSLKLSCATSGFPFSTYFMNWVRQAPGKGLEWVAQIRSKTFSYEAYYAESVKGRFTISRDDSKSSVYLQMSSLRTEDTAIYYCTR
Neotoma lepida V273 igkv LZPO01117387.1 57505 VKCDIVMTQSPSLLSVSMGDRVTITCHASQNINSWLAWYQQKPGKAPTPLIYKASNLQTGVPSRFSGSGSGTDFSLTIGSLESEDVATYYCQQYDEYP
Neotoma lepida V274 trbv LZPO01118036.1 30995 PINAGVNQTPRHKVTEKGQEAALRCEPISGHTGVFWYRQTTARGLEFLMYFRNQERIDETGMPKERFSAQMPNAKLSTLKIQPTQPQDSAVYLCASSL
Neotoma lepida V275 trbv LZPO01118036.1 13073 ISHGGITQTPKFLIGQQWQRLTLECEQDFNHDTMFWYRQDPGKGFRLIYYSITENDIQKGDLFEGYDVSREKKPFFPLTVTSAQKNQTAVYLCASSV
Neotoma lepida V277 igkv LZPO01118244.1 9021 SSGDVVMTQTPTSLPASLGDQVSISCRSSQSLVHSNGNTYLNWYLQRPGQSPQLLIYLVSNRFSGVSDRFSGSGSGTDFTLKISRVEPEDLGVYYCLQR