WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Okapia johnstoni LVCL000000000.1 (LVCL01) 140 3 11 6 57 40 11 12
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Okapia johnstoni V0 trdv LVCL010015055.1 528 KGALCNQVTQSPPEQRAASGSGVTLHCTFQTTYSNPDLYWYRIRPDGVFQFVLYRDNTKSLVTNFARGRFTVQHSVSHKTFHLVISSVRPEDTATYYCALEL
Okapia johnstoni V1 trbv LVCL010044458.1 76 LVDSEVTQTPKFLTKSRKQQVILRCSPDSGHLSVYWYQQAVAQGPQFLVQYFNEKVYQRGNMSDRFSGKQFSDSRSELNLTSLELKDSAVYLCASSQ
Okapia johnstoni V2 trbv LVCL010044460.1 1431 LMDSKVTQTPKYLIKSRKQQATLRCSPVSGHLSVYWYQQALGQGPQFLVQYYRQQVRGEAHLLDRFSGKQFSDFSSELNLSSLELTDSAMYLCASSR
Okapia johnstoni V3 trgv LVCL010056144.1 2736 TQVSSNTEGEKMSITKATGSGSSVEIICDLITQTLKYIHWYKFQEGTAPQRLLYYDISYSKVVLESGVSEGKYKVYKEKSYTFAISNLQESDSGMYYCAAWE
Okapia johnstoni V4 trav LVCL010058381.1 8162 EVRAVKVEQSPLVLNLQEGANCTLRCNFSATVKTLQWFQQNPGGSLISLFFIASGMKQNERLSSTVNSKERYSTLHITASKLEDSAAYLCAVE
Okapia johnstoni V5 trav LVCL010058381.1 13710 VSLGKEVEQSPSTLSVQEGNSCFATCTYTDVTSNYLPWYKQEPGKGPQLLIDIRSNMGKNEGQRMTVLLNKMAKHLSLHISTTEVGDSAVYFCAAS
Okapia johnstoni V6 trav LVCL010058381.1 22466 VSLGNKVEQNPPTLSVQEGNSSFITCTYTDGSSNYFPWYKQEPGKGPQFLIAIRSNKGKEEDQRLTVFLNKTAKRLSLHIATTEPGDSAVYFCAAS
Okapia johnstoni V7 trav LVCL010058381.1 27736 SSIAQKVNQDQLPVSVQEKEKVTLNCTYDTSDITYNLFWYKQHSSGVMTFLIRQDSDNKQNATEGRYSLNFQKASKFITLAISASQLEDSAVYFCALRE
Okapia johnstoni V8 trav LVCL010058382.1 3896 QTHGNSVTQTDGQLTLSEETSVTINCNYSTSGYPALFWYVQYPGEGPQLLLKATKTNEKGSRKGFEATYNAETTSFHLEKASVQESDSAVYYCALS
Okapia johnstoni V9 trbv LVCL010131712.1 12891 VRAQTIHQWPSSRVQPAGSPLYLECTVKGTSNPYLYWYRQEAGGGFQLLFYSVGVNDIDPREFQNFKASRPQDGQFILSSNKLQLNNSGFYLCAWS
Okapia johnstoni V10 trav LVCL010145147.1 2252 VSSLLTVEQRPGLLPVQERESTNFTCSFPSSSFYALHWYRWEPAKSPKNLFVLSVNGDEKKQGRMRVTLNTEEGYSSMYIRGSQPEDSATYLCA
Okapia johnstoni V11 trav LVCL010145147.1 8257 MNGQQIKHFPEFLLLQEGENFTTYCNSSSTFYNLQWYKQSPGGSPVLLMILSKGGEVKTQQRLTGRFGESKQHSSLHLAAAQLSDVGTYFCAE
Okapia johnstoni V12 trdv LVCL010145148.1 3481 SGVAQKVTQDQSGIIRQVGQSVTLNCRYETSWGYYYLFWYKQLPSGQMTYLIYQYSDDDNARNGRYSVNFKKADKSISLTISALQLEDSAKYFCALRE
Okapia johnstoni V13 trav LVCL010145151.1 507 TVINAKATQPSSMDCAEGEDVNLPCNHSTIRGDEYIHWYWQNPNQSPQYVIHGLRDTVNSSMASLIIASDRKSSTLVLRQVTLRDTAVYYCVLRE
Okapia johnstoni V14 trdv LVCL010145161.1 804 SGVAQSVTQDQPDIPSEVGKAVTLNCRYETSWNMGVYYIFWYKQLPNGQMTYLIRQYSEDGNARDGRYSVNFQKAHKSISLTISALELEDSAKYFCALLD
Okapia johnstoni V15 trav LVCL010145164.1 8920 MNGQQIKHFPEFLLLQGENFTTYCNSSSILNSLQWYKQSPGGRPVLLMILSKGGEVKTQQRLTGRFGESRQHSSLHLAAAQLSDVGTYFCAEAQCSG
Okapia johnstoni V16 trdv LVCL010145164.1 15586 SGVAQKVTQDETGIIRQVGQSVTLNCQYETSWSSYNLFWYKQLPSGQMTYLIRQYSESGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALSE
Okapia johnstoni V17 trav LVCL010145167.1 7558 ETGAQLVTQLDGHINVSEGNRLELRCNCSYGGSIYLFWYVQYPSQGLKFLLKYSSGPTRVKGIKGFEAEFRKDEKSFHLMKASAHWSDSAKYFCALC
Okapia johnstoni V18 ighv LVCL010168700.1 7599 VLSQVKLEMWGSEMVTPQETLTLTCAVYGLSISTGGYAWTWIRQPPGKGLEWMGSIWYDGGTKYSPSLKSCSSISRDTSKNQFSLQLSSVTTEDMGVYYCAR
Okapia johnstoni V19 trbv LVCL010171660.1 4746 SMDTGVTQTPRNRIAKTGKSTVLECSQTKGHDYMYWYRQDPGRGLRLIYSSFYDTSDINKGDVSDGYNVSRKEKAKFFLYLEPATPNQTAIYFCASSI
Okapia johnstoni V20 trdv LVCL010196774.1 1666 SSMADQVTQAQTTVTAREGEAATIDCTYKTSYRYTLYWYRQFPSGRMEFLIYQDDNKASARRDRYSVNFQREKRFISLTISSLYLADSAKYFCALWE
Okapia johnstoni V21 trav LVCL010196778.1 169 ILGDSKTTQPNSMEGTEEEPVHLPCNHSTISGPEYIHWYRQIPHQGPEYLIHGLNNNVTNKMASMSIAKDRKSSILVLPQVTLRDTAVYYCILR
Okapia johnstoni V22 trav LVCL010196779.1 2314 VSAQQLNQSPQSMYIQEGEDISMNCNSSSTLNLLLWYKQDAGEGPILLIKLLKSGELARNGKLTAQFGGTRKDSLLNISASEPKHAGTYFCAG
Okapia johnstoni V23 trav LVCL010196779.1 8450 VKGDDHMMQSPLSLIVHEGSNATLNCSYKVTNFQSLHWYKQEEKVLTFLFMLISTGIEKKSGRLRGTLDRKELLSTLHITVSEPGDSATYLCAVE
Okapia johnstoni V24 trav LVCL010196781.1 1762 PRRADWIRSQETEVSGVEGKTVSFFCNYYISFISFISLFWYRQYPNQAPEYILYRQWGYSGKGYASFATERFYSDNTANTTNLYIKKVVSADTALYLCAME
Okapia johnstoni V25 trav LVCL010196782.1 21299 PNVAQTVTQPQPEESVQEADPVTLNCTYSTSESDYYLFWYKQPPSGEMVFIIRQNANTKQNATNGRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Okapia johnstoni V26 trav LVCL010196782.1 25361 PSVAQTVTQPQPEESVQEADPVTLNCTYSTSESDYYLFWYKQPPSGEMVFIIRQNANTKQNATNGRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Okapia johnstoni V27 trav LVCL010196792.1 49 PNDVESADVTTVHKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIYSQSKHTREGRYSVEFYKPSQMLKLTISSLTLSDSAVYLCAVRE
Okapia johnstoni V28 trbv LVCL010234159.1 7099 TVAGGVTQTPKYLLKEEGGAVTLECEQDFDYDSMYWYRQDPGLGLRQIFFSRIVKNIQKEDIAKGYNASHEKKPFFPLTVTSAQKNQTALYLCAASR
Okapia johnstoni V29 trbv LVCL010234160.1 1265 GSGLGAFVSQHPRRALSKSGASVTIQCHAVDFQATTMFWYRQFPKRGLVLMATSNTGANATYEQGYNKDKLPISQPNLTFSSLMVTSVDPADSSLYFCGAS
Okapia johnstoni V30 trbv LVCL010234162.1 2451 FMDTEVIQSPGHLVKGKDQKVKMDCVPRKGHVHVYWYRKKLEEAFEFWVYLQNQDIVEDTEVFKQRFSAECPQKLPCSLEIKSTEAADSALYFCASSQ
Okapia johnstoni V31 trbv LVCL010234162.1 5852 SMDTEVTQSPSHLVKGKDQKAKMGCVPRKGHINIYWYLKKLEEAFEFLVYLQKQDIVKDTEVFKQRFSAECPQNSPCSLKIKSTEAADSALYFCASNQ
Okapia johnstoni V32 trbv LVCL010234165.1 867 SMDTEVTQSPSHLIKGKDQKAKMDCVPKEGHGYIYWYRKKLEEALEFLVYLQNQDIAEDTEVFKQRFSAECPPNSPCSLEINSTEAVDSALYFCASSK
Okapia johnstoni V33 iglv LVCL010241357.1 914 SVLSYELTQPTSESVALRQTATITCSGDLLDKKYTSWYQQKPGQAPKLVIYKDSERRSGIPDRFSGSSSGKTATLTISGAQTEDEADYYCQSADSSDN
Okapia johnstoni V34 iglv LVCL010241359.1 4793 SVLSYELTQPTSESVALRQTATITCSGDLLDEQYTQWYQQKPGQAPKLVIYKDSERPSGIPDRFSGSSSGKTATLTISGAQTEDEADYYCQSADSSDN
Okapia johnstoni V35 iglv LVCL010274857.1 112 SWAQAVLTQPSSVSGTLGQRVSITCSGSSSNIGRSSYYVGWYQQIPGSAPRTLIYGGTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCASADSSGYN
Okapia johnstoni V36 iglv LVCL010274862.1 274 SWAQAVLTQPSSVSGTPGQSVSITCSGSSSNIGSSYSYVGWYQQIPGSAPKTLIYGTTSRASGVPNRFSGSKSGNTATLTISSLQAEDEADYYCATYDSSSYN
Okapia johnstoni V37 trav LVCL010279664.1 133 GTDGDSVNQTEGPVTVSEGARMTLNCTFQTAGSAPYLFWYVQHLNKAPQLLLKGSMTNQRPKQKGFEATLIKSDSSFHLQKEAVQTSDSAVYYCALS
Okapia johnstoni V38 trav LVCL010279664.1 7095 GTNGDSVNQTEGPVTVLEGARVTLNCTYQTTYSNSYLFWYVQHLSKAPQLLLNSLTKNKEEEHEGFQATLVKSDSSFHLQKRAVQTSDSAVYYCALS
Okapia johnstoni V39 trdv LVCL010279664.1 9302 SIMGQKVTQNQSEIPALEKEDVTLNCAYEAKSYSYYLFWYKQPPSGEMIFLIHKESYNELNTTKGQYFLNFQKATSSISLTITDLQLRDSAVYFCALR
Okapia johnstoni V40 trav LVCL010279666.1 7302 VSGQDQVEQSPQTLKIQEGKSLSLNCSYAVSNFRGLQWYRQDPRKGPELLFLLNSVGDEKQKERLTATLLKKGSSLHIEASKAKDSATYLCAVE
Okapia johnstoni V41 trav LVCL010279667.1 3500 VSSKQDVSQSPEARSVREGDSLVLNCSYTDSALFFVQWFRQDPGKGLASLLSIQANQKQQTSGRITVSLDKSSRHSALHIATSQHSDSTTYLCAV
Okapia johnstoni V42 trav LVCL010279667.1 6963 GAGAQSVTQPDDHIIVSEGAHLELKCNYSSSVSPYLFWYVQYPNQGLQFLLKYVSGDNLVSDLKGFEAEFRKNEKSFHLRKVPAHWKDSAKYFCALS
Okapia johnstoni V43 trdv LVCL010279667.1 23001 SGVAQTVTQDQPYVTSNIGQSVILNCRYTVSWSGYTHYLYWYKQLPSGEMIFLLRQESSGRNARSGRYSVNFQKAQNSISLTISALQLEDSAKYFCAVWE
Okapia johnstoni V44 trav LVCL010279667.1 32236 VNGQQISQIPQFLLLQEGENFTTYCNSSSILSSLQWYKQSPGGRPVLLMILSKVGEVKTQQRLTGRFGESRQHSSLHLAAAEPSDVGTYFCA
Okapia johnstoni V45 trav LVCL010279667.1 40902 TVIDAKTTQPNSMDCAEGENVNLPCNHSTIGGDEYIHWYRQNPNQNPQYVIHGLRGTVNSSIASLIIASDRKSSTLVLRQVTLRDTAVYYCVLRE
Okapia johnstoni V46 trav LVCL010279668.1 2662 VRGVDVKQSPPALSLQEGASYTLLCNFSTPPQSVNWYLQNPGGRLTHLVYVPSGTKQDGRLNATTVPKERRSSLHIASSQTTDSGTYFCAVQHSAPQ
Okapia johnstoni V47 trdv LVCL010279668.1 8137 SGVAQKVTQDQPDITTQVGQSVTLNCQYEVSWYRISYSIFWYKQLPSGQMTYLIRQYSENGNARDGRYSVNFQKADNSISLTISALQLEDTAKYFCA
Okapia johnstoni V48 trav LVCL010279668.1 18299 VQGLEVEQSPPALSLQEGASHMLSCNFSASVTNVQWYLQNPSGRLIHIPSGTKQDGRLNATTVLKERRSSLHISSSQTTDSGTYFCAVQHSAPQ
Okapia johnstoni V49 iglv LVCL010285990.1 739 SWAQAVLTQPSSVSGTLGQRVSITCSGSSSNIGYSSYYVGWYQQIPGSAPRTLIYGGTSRASWVPDRFSGSSSGNTATLTISSLQAEDEADYYCASADSSSYN
Okapia johnstoni V50 trgv LVCL010295199.1 15224 IQQELRLGQRSVMVGHAGGSITVSCRVTRSVDYVHWFRQLEGQAPERLLYVALSKRDVQWDSVLKGDKVNAARSGDGKSCTMSLMKLAKSDEGLYYCAAWEL
Okapia johnstoni V51 trgv LVCL010295200.1 1289 IQQELRLGQRSVMVGHAGGSITVSCRVTRSVDYVHWFRQLEGQAPERLLYVALSKRDVQWDSVLKGDKVNAARSGDGKSCTMSLMKLAKSDEGLYYCAAWEL
Okapia johnstoni V52 trbv LVCL010297690.1 2294 FMDADVYQTPRHCVIGTGKKITLECSQTMGHDNMYWYQQDPGMELQLIHYSYGVNTTEKGERSSRSTVSRISKEHFPLTLETASSSQTSSYFCASSD
Okapia johnstoni V53 trbv LVCL010303990.1 516 PVDSGVTQTPKFLTKSRKQQVTLRCSSDSGHRSVYWYQQAVCQGPQFLIQYYDEKVYQKGNMSDRFSGKQFSDSRSELNLTSLELKDSAVYLCASS
Okapia johnstoni V54 trbv LVCL010303991.1 696 AVHAGVTQDPRFQVVRTAQSATLKCTQDLSFSYMYWYWQDLGHGLRLIHYSVIPPTTQKGNVPDGYSISRPSTENFPLTRESASHSQTSVYFCATGY
Okapia johnstoni V55 trbv LVCL010325081.1 230 LVDSGVTQTPKYLIKSRKQQVTLRCSPEFGHLYLSWYQQALGQGPQFLVQYYDEKVYQKGNISDQFSGKQFNHSSSELSLTPLELTDSALYLCASSQ
Okapia johnstoni V56 trbv LVCL010325083.1 845 VVHAGVTQDPRFQVVRTGQKATLKCTQHLGHNYMCWYRQDLGHGLRLIHYSTGPPSVEQGDAPEGYTVSRSKKEDFPLTLESANRSQTSVYFCASSY
Okapia johnstoni V57 trbv LVCL010325083.1 5668 AVHAGVTQDPRFQVVRTGQSVTLKCTQDMNHDSMYWYRQDLEHGLRLIHYSSFTDTTYKGDVPDGYNVSRSSTENFPLTLESANHSQTSVYFCASNY
Okapia johnstoni V58 trbv LVCL010325083.1 8592 HTGAGVVSQSPRHRVTGRGQTVNLTCDPIPGHQALYWYRQTLGQGPEYLTYFQGKEEPDKLGMPKNRFSAERPESTYSYLKIQPAEPGDSAVYLCASSP
Okapia johnstoni V59 trav LVCL010329724.1 1560 GTNGDSVKQTEGPVTVSEGAHMTLNCTYQATYSTVYLFWYVQHLNKAPQLLLKGSMGDPKPKKEGFQAALVKSDSSFHLQKQAVETSDSAVYYCALS
Okapia johnstoni V60 ighv LVCL010351652.1 225 VLSQVKLQESGPSLVKPSQTLSLTCTVSGFSLSSYSVNWVRQAPGKALEWVGEMGYSGSTYYNPALKSRLSITRDTSKSQVSLSVSSVTTEDTAVYYCAR
Okapia johnstoni V61 trbv LVCL010359929.1 2127 HTGAGVVSQSARHRVAGRGQTVNLTCDPIPGHQALYWYRQTLGQGPEYLTYFQGKEEPDKLGMRKNRFSAERPESTYSYLKIQPAEPGDSAVYLCASSP
Okapia johnstoni V62 trav LVCL010364954.1 39 ESTQQLEQNPRFLRIQEGGNVTVYCNSSSTFTFFQWYRQKPEEGPVLLMTLTKPKEMKEQKRIKAQFGETRKDSSLLITAAQPGDAGTYFCAG
Okapia johnstoni V63 trgv LVCL010366802.1 11970 HLEQPQISSTKKLSKTARLECMVSGVTIPTTSVYWYQERPGQAIQHLLHIFSNNTIKRESGILLSKFEADMIPETSTSTLTIHNVREQDSAIYYCALWD
Okapia johnstoni V64 trgv LVCL010366807.1 3212 GLGLSKVDQAQISLSTQVKKSIDILCKIESTNFESETVYWYRQKRNQALEHLVYVTSTRTVAQSQVGGKNNKIEARKDAQKFTSTLTVNFVEKEDVGIYYCAGWS
Okapia johnstoni V65 trgv LVCL010366808.1 3640 GHGLSKVDQAQISLSTQVKKSIDILCKIESTDFGSEAIHWYRLKLNQVLEHLVYVTSTTTAARNHVAGKNKIEARKDAQKFTSTLTVNFVEKEDVGIYYCAG
Okapia johnstoni V66 trgv LVCL010366808.1 9514 GLGQLTLEQPEVSVTGTREKSVIMYCKVFSKDFSKDYIHWYRQKPDQGLEQLLYVSGDSALNHLGGKKNKLEARKDAPSSTSTLKISFLEKEDEAMYYCAGWLY
Okapia johnstoni V67 trgv LVCL010366809.1 3036 IPITERITSVTKKKGNTAFLECQIKTDKLKKNVYMHWYRQKPEQPLKRILYISSNENVVHEQGISEERYEARKWPSNSLVSLRIHQATEEDAGLYYCACWV
Okapia johnstoni V68 trgv LVCL010366809.1 5473 GDIKMKISQHQLSSTRRPDRTVHISCKLSGVPLENAIVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEMDNKKNGIFYLIINNVVKSDEATYYCACWD
Okapia johnstoni V69 trdv LVCL010382956.1 4162 VMSAVVLVSEDQVKTVPVGKSVTLSCSMKGDSISKYYIFWYRKTPGNTMTFIHREGGAYGPGFEDNFRGKIDGLTNQAVLEVLKASERDEGFYYCASD
Okapia johnstoni V70 trbv LVCL010406766.1 811 PTGAEIYQIRFLLAGAGRDVTLECKQNLGYNAMYWYRQDPGQGLKLIYYSTIEKDIQRGDLSEGYSVSREKKELFPLTVKSAHTNQTAVYLCSGS
Okapia johnstoni V71 trbv LVCL010415500.1 169 SMDTGVTQTPRNRIAKTGKSTVLECSQTKGHDSMYWYRQDPGRGLRLIYSSSYDTSDINKGDVFDGYNVSRKEKAKFFLYLEPATPNQTAIYFCASSI
Okapia johnstoni V72 trdv LVCL010437318.1 728 SCVAQKVTQVQTAVSSQVGQTVTLNCKYELTWTTDYYYIFWYKQLPSGGMTFLIQQYSGYGNARNGRYSVNFQKAYKSISLIISALQLQDSAKYFCALWK
Okapia johnstoni V73 trav LVCL010453778.1 1379 ESTQQLEQNPRFLCIQEGGNVTVHCNSSSTFTFFQWYRQKPEEGPVLLMTLTKPKEMKEQKRIKAQFGETRKDSSLLITAAQPGDAGTYFCAG
Okapia johnstoni V74 trav LVCL011157461.1 345 GTDGDSVNQTEGPVTVSEGARITLNCTYQTTYTTPYSFWYVQHLNKAPQLLLQGLTAGKEVEGKGFRATPVKSDSSFHLQKEAAETSDSAVYYCALS
Okapia johnstoni V75 trgv LVCL011188896.1 466 TQVISNMEEDKLSVMRATGSSIVIDCDLTQNYIHWYKFQEGTIPRRLLYYDVSNSRIVLDSGISKGKYNVYKGTGKGYTIVISNLQESDSGTYYCTVWE
Okapia johnstoni V76 trgv LVCL011188911.1 466 TQVSSNTEEDKLSVMRATGSSVVIDCDLTQNYIHWYKFQERAVPRRLLYYDVSNSKVVLDSGISEGKYYVYKGTGKGYTIVISNLQESDSGTYYCAVWE
Okapia johnstoni V77 trav LVCL010113442.1 686 GLRAQSVTQPEDQIPVAEGDPVTVNCTYSVSGSPYLFWYVQHRNQGLQFLLKYITGNNLVKGDYGFEAEFNESQTSFHLKKPSVVGSDSALYFCAVS
Okapia johnstoni V78 trav LVCL010116924.1 3200 SAGKGVEEPTELMAMEGASAQVNCTYQTSGFNGLFWYQQRDGGAPVFLSYNVLDGLERRGHFSSFLRRSDAHSYLLLKELHMKDFASYLCAVI
Okapia johnstoni V79 trav LVCL010134794.1 2006 ETHGDSVNQTEAPVTVSEGAHMTLNCTYQTADLAPYLFWYVQHLNKAPQLLLKGSKRDQRPKNEGFQAALVTSDSSFHLQKRAVQTSDSAVYYCALS
Okapia johnstoni V80 trav LVCL010134795.1 26200 VSSQQNTVEQGPASLPVPEGANASLGCNYSDSASQYFAWYRQYPGKGPEFLLYVYTDNEEGKFTAQASKANKHVSLHIRDSEPSDSATYLCAVR
Okapia johnstoni V81 trav LVCL010134795.1 15397 GTTAQTVTQPESHISVFKGDPVQVKCNYSYSGSPVLFWYVQYPRQRLQLLLKHISRESIQGFTADLNQAETSFHLKKPSAQEEDSAVYYCALG
Okapia johnstoni V82 trav LVCL010134795.1 10902 VSSQQGEQNLQTLSIQEGENVTMNCSYKSISFTTLQWYRQDSRRGFVHLISIPSNERQKYSGRLHFTLDNSIKISSLSITASQAEDTATYFCAP
Okapia johnstoni V83 trav LVCL010134795.1 3954 GASGDSVIQTEGLVTLPEKASLTLNCTYQSSYSVFLFWYVQYHTGLELELLLKSSSENQKVTSRGFEAIPISSNSSFNLQKSSVRTSDSAVYYCALS
Okapia johnstoni V84 trav LVCL010134798.1 9711 QTLGDSVTQLGGQVTLPEKAAVTINCTYSATGYPTLFWYVQYSRAGPQLLLKAMKDKTKGISKEFEARYRRKSKSFHLKKASVQESDSVVYYCALS
Okapia johnstoni V85 trav LVCL010134798.1 4625 VSCKNQVEQSPPSLLVLEGENCTFQCNYTVSPFNSLRWYTQDTGRGPVSLITVTYSDNKKSNGRYTATVDTTAKHSSLHLTAARLSDPAFYICVVG
Okapia johnstoni V86 trav LVCL010134799.1 4003 VSLGNEVKQSPSTLSVQEGNSFVITCTYTDTASEYFPWYKQEPEKGPQLLTAIRSNMGEKKDQRLTVLLNKTAKHLSLRIAAIQPGDSAVYFCAAS
Okapia johnstoni V87 trav LVCL010134799.1 400 SIIAQKVTQDPQPMLVQEKEAVTLDCKYDTRETRYSLFWYKQPSNGGMILLIHQDSYNQQNATEGRYSLNFQRARKSITLVISASQLEDSAVYFCALSE
Okapia johnstoni V88 trav LVCL010134800.1 7263 QTRGDSVSQMDGQVTLLEGATLTVNCTYSATRYPTLFWYVQYPGEGPELLLKAMKANEKGTNKGFEATYNTETTSFHLEKASVQESDSAVYYCALS
Okapia johnstoni V89 trav LVCL010134800.1 2942 GVRGVKVEQSPSILKLQEGANSTLRCNFSAAVNSVQWFRQNPGGSLTRLFFVASGTKQNERLSSTVNSKERYSTLHITASKLEDSATYLCAVE
Okapia johnstoni V90 trdv LVCL010134803.1 2234 SSIAQKVNQDQPPTSVQEKENVTLDCTYDTSDTTYSLFWYKQHSSGVTTSLIRQDSFNKQNAIEGRYSLNFQKESKFIKLTISASQLEDSALYFCALRE
Okapia johnstoni V91 iglv LVCL010151768.1 2628 SWAQGVLTQPSSVSGSPGQSVSITCSGSSSNIGGYTSSVDWYQQIPGSAPKTIIHGTTSRPSGVPDRFSGSRSGNTATLTISSLQAEDEGDYYCSGYQSDNS
Okapia johnstoni V92 iglv LVCL010151770.1 2370 SWAQAVLTQPSSVSGSLGQRVSISCSGSSRDVGRSNVGWYQQIPGSAPRTLIYDGTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCAGYDSSSYN
Okapia johnstoni V93 igkv LVCL010155475.1 10378 TMGEIVLTQSPASLALTPRETATLTCRASQSVSSYLAWYQQKPGQAPRLLIYAASSRDSGIPDRFSGSGSETSFTLTISSLEPEDAAVYYCYQYYSS
Okapia johnstoni V94 igkv LVCL010155476.1 9272 ASGEAALYQTPAYISVPLGERISITCRANQSISDYLSWYKQKPGQAPVILICDADNRYSGVPERFTATQSDTEFVFTISQVEADDAAMYYCQQDYVFP
Okapia johnstoni V95 trav LVCL010181691.1 418 VSLGNKVKQSPPTLSVQEGNSSFITCTYTDGNSDYFPWYKQKPGKGPQFLIAIRSNKDKEEEQRLTVFLNKTAKRLSLHIATAEPGDSAVYFCAAS
Okapia johnstoni V96 trav LVCL010186023.1 1380 DSRGQSVTQPDDPVLVSEGNSLELKCNYSYGATPYLFWYVQYPRQGPQLLLKYFSGNTMVQGIRGFVAEFKRSDFSFNLRKFSAHWNDSAEYFCALS
Okapia johnstoni V97 trav LVCL010186026.1 3410 GSNGDSVTQPKGQVTLLEGESLTVNCFYETKQYPALFWYVQYPGEGPELLLKAMKANEKGTNKGFEATYNTETTSFHLEKALVQESDSAVYYCALS
Okapia johnstoni V98 trav LVCL010186028.1 2016 TLSLAKTSQPIFIDSYEGQEVNISCNHTKIATNDYIFWYRQFPNQGPQFIIQGYKTNVENEVASLLIPTDRKFSTLSLPPASLRDTAVYYCIVR
Okapia johnstoni V99 trav LVCL010186030.1 4271 GLRAQSVTQPEDQIPVAEGDPVTVNCTYSVSGSPYLFWYVQHRNQGLQFLLKYITGNNLVKGDYGFEAEFNESQTSFHLKKPSVVGSDSALYFCAVS
Okapia johnstoni V100 trbv LVCL010259726.1 8632 LVDAQVTQTPRYLVKRRGEKVVIECIQNMDHEGMFWYRQDPALGLRLLHFSINVGLVEEGDVPQGYNVSRKKKESFPLTLESATTNQTSVYLCASSE
Okapia johnstoni V101 trbv LVCL010259726.1 2341 SVFGALLSQKPSRAIRQRGTSVTIECQVDSQLTFMYWYRQLPGQSLALMATANQGSKATYNSGFTEDKFPISRPNLAFSTLTVSNASSEDSSSYFCSAG
Okapia johnstoni V102 trbv LVCL010259728.1 1506 LKDAAVTQFPRRRILETEKEFTLQCSQKMNHYVMYWYRQDPGFGLRLIYYSTDLNTFKKGDVPEGYHVSRDELERFSLTLKSASPNQTSVYFCA
Okapia johnstoni V103 iglv LVCL010265095.1 8603 RVVTSQLTQPPVVSVSLGQTASITCQGDDIESYFAHWYQQKPGQAPVVVIYESSERPSGIPDRFSGSSSGNTATLTISGAQAEDEADYYCQSADSSGD
Okapia johnstoni V104 iglv LVCL010265098.1 626 SVLSYELTQPTAVSVALGQMAKITCSGDLLDEQYTQWYQQKPGQAPRLVIYKDSKRRSGIPDRFSGSSSGKTAILTISGVRAEDEADYYCLSLDSGSYN
Okapia johnstoni V105 trbv LVCL010280379.1 1224 HTGAGVVSQSPRHRVTGRGQAVNLRCDPIPGHQALYWYQQTLGQGPEFLTYFQNEKELDKSGMPKNRFSAERPESTYSYLKIQPAEPGDSAMYLCASSP
Okapia johnstoni V106 trav LVCL010280862.1 444 VRGVDVEQSPPALTRQEGASSTLWCNFSTLADSVQWYLQNPGGHLIHLTSGTKQEGRLNATTVPKDRRSSLHISPLQTTDSGTYFCAVQHSARQ
Okapia johnstoni V107 trav LVCL010286641.1 476 GTDGDSVNQTEGPVTVSEGARITLNCTYQTTYTTPYPFWYVQHLNKAPQLLLQGLTAGKEVEGKGFRATPVKSDSSFHLQKEAAETSDSAVYYCALS
Okapia johnstoni V108 trav LVCL010286649.1 624 GTDGDSVNQTEGTVTVSEGARMTLNCTYQTADSAPYLFWYVQHLNKAPQLLLKGSIGDPKPKKEGFQAALVKSDSTFHLQKQAVQTSDSAVYYCALS
Okapia johnstoni V109 trbv LVCL010294865.1 10395 LVDSEVTQTPKYLIKSRKQQATLRCSPDSGHLSVYWYQQALGQGPQFLVQYYNQNVRGEAHLPDRFSGKQFSDSHSELNLSSLALTDSAVYLCASSQ
Okapia johnstoni V110 trbv LVCL010294865.1 1804 AVHAGVSQDPRFQVVRTGQSATLKCTQDLSFSYMYWYRQDLGQGLRLIHYSVIPSATQKGNVPDGYSVSRPSTENFPLTLESASHSQTSVYFCATGY
Okapia johnstoni V111 trbv LVCL010294867.1 768 LVDSEVIQTPKYLIKSRKQQVTLRCSPESGHRSVSWYQQALGQGPQFLIQYYRGQVSGKENMPDRFSAKQFSDFRSELNLNSLELTDSALYLCASSQ
Okapia johnstoni V112 trbv LVCL010294869.1 13038 ISADPGITQIPKYLVMGMTDKKSLKCEQHLGHNAMYWYKQNAQKPPELMFVHNYKKLSENESVPSRFWPECSDSSQCRLDLNALKPQDSAVYFCASSR
Okapia johnstoni V113 iglv LVCL010304488.1 3980 SWAQAVLTQPSSVSGTLGQRVSITCSGSSSNIGYGSYNAGWYQQIPGSAPRTLIYDGTSRASGVPDRFSGSKSGNTATLTISSLQAEDEADYYCASYDSSSYN
Okapia johnstoni V114 igkv LVCL010307177.1 7179 SSGDAVLTQTPPSLSVIPGETASISCKSSQSLVHSDGKTCLSWIQHKPGQSSQGLIYQVSNRYSGFPDRFTGSGSGTDFTLIISRVQAEDAGVYYCYQGTEDP
Okapia johnstoni V115 igkv LVCL010307177.1 378 SSGDIVLTQTPLSLSVVPGETASISCKSSQSLLYSDGKTYQYWFLQKPGQSPQLLIYQVSNRDTGVPDRFTGSGSGTDFTLTISRVQAEDAGVYYCYQGLQNP
Okapia johnstoni V116 igkv LVCL010307183.1 3389 SSGDIVLTQTPLSLSVIPGETASISCKSTQSLKYSDGKTYLRWFQHKPGQSPQLLIYQVSNRYTGVPDRFTGSGSETDFTLTISRVQAEDAGVYYCYQDSYNP
Okapia johnstoni V117 igkv LVCL010307186.1 4960 SNGAIVLTQTPSSLSVIPEETASISCRASQSLEDSCGNSPLHWYVQKPGQSPQLLIYGASNRASGVSDRFTGSGSGTDFTLQISRVEAKDTGVYYCQQSKETP
Okapia johnstoni V118 ighv LVCL010321577.1 5508 VLSQVKLQESGPSLVKPSQTLSLTCTVSGFSLSSYAVSWVRQAPGKALEWVGGIGSGGSTYYNPALKSRLSITRDTSKSQVSLSVSSVTTEDTAVYYCAG
Okapia johnstoni V119 trbv LVCL010341603.1 11185 VVHAGVTQDPRFQIMRAGQKATLKCTQDLDHNFMYWYRQDMGHGLRLIHYSAGPSTKEKGDVPEGYSVSRSNKEDFPVTLESANRSQTSVYFCASSY
Okapia johnstoni V120 trbv LVCL010341603.1 8651 PVDSGVTQTPKFLTKSRKQQVTLRCSSDSGHRSVYWYQQAVCQGPQFLIQYYDEKVYQKGNMSDRFSGKQFSDSRSELNLTSLELKDSAVYLCASS
Okapia johnstoni V121 trbv LVCL010341603.1 6998 AVHAGVTQDPRFQVVRTAQSATLKCTQDLSFSYMYWYWQDLGHGLRLIHYSVIPPTTQKGNVPDGYSISRPSTENFPLTRESASHSQTSVYFCATGY
Okapia johnstoni V122 trbv LVCL010341603.1 5317 GLVDSEVTQTPKFPTKSRKQQGTLRCSPDSGHRFVYWYQQALGQGPQFLVQYYDGEVKEKGNIADRFSGQQFSDARSELSLSSLELMDSALYLCASSQ
Okapia johnstoni V123 trbv LVCL010341603.1 3648 VVHAGVTQDPRFQVVRTGQRATLKCTQDLDHDYMCWYRQDPGHGLRLIHYSAGPSTKEKGDVPEGYSVSRSNKEDFPLTVESANRFQTSVYFCASSY
Okapia johnstoni V124 trbv LVCL010341603.1 1126 LVDSEVIQTPKFLTKSRKQQMILRCFPESGHRSVYWYQQAVGKDPQFLIQYYDGNENQRGNMSDRFSGKQFSDSRSELNLTSLELKDSAVYLCASSQ
Okapia johnstoni V125 trbv LVCL010341604.1 1192 LMDSKVTQTPKYLIKSRKQQATLRCSPVSGHLSVYWYQQALGQGPQFLVQYYRQQVRGEAHLLDRFSGKQFSDFRSELNLSSLELTDSAVYLCASSR
Okapia johnstoni V126 trav LVCL010349749.1 1351 LSVQMKVEQSPGVLTLQEGRNSSLICNYSISMTSVQWFRQNPDGHLISLFYIASGKQQKGRLKSTINNKERYSQLYIRDSQPGDSATYFCAVE
Okapia johnstoni V127 trav LVCL010372190.1 4058 SVFDAKSIQPSSMDCAEGEDVNLPCNHSTIGGNDYIHWYRQNPNQSPQYVIHGFRDTVNSSMASLTIASDRKSSTLVLRQVTLRDTAVYYCILRE
Okapia johnstoni V128 trbv LVCL010374617.1 323 FLEAEVTQTPGHLVQGKGLEVEMYCVPKKGHIYVFWYQQILAKEFKFLISFQNDQVLDDKEMPKKRFSAKCLSNSPCSLKIQPTEPQDSAMYFCASSD
Okapia johnstoni V129 trbv LVCL010374618.1 2654 HMGAKVIQNPRYLVTRMGKPVTLSCSQNLKHDTMYWYQQKPSQAPKLLLYYYNNQITKDKNTSENFQSSRPDTSFCSLDIRSAGLGDSAMYLCASSR
Okapia johnstoni V130 trbv LVCL010374639.1 1373 PLEAEVTQTPGHLIKTMGQTATLRCSPVSGHSSVSWYQQARGQGPQFLFEFYETRQRAKGNFSNRFSAKQLSDFSSELNVNSLELTDSALYLCASSL
Okapia johnstoni V131 trav LVCL010388531.1 8046 VNGQQIKHFPEFLLLQGENFTTYCNFSSNFYNLQWYKQSPGGSPVLLMILAKGGEVKTQQRLTGRFGESRQHSSLHLTAAQPSDVGTYFCAVTQCSG
Okapia johnstoni V132 trav LVCL010388531.1 1592 IMVDAEITQLSSMDCAEGEDVNLPCNHSTIDTLDYIHWYRQNPSQSPQYIIHGLQDTVNSSKAFLTIASDRKSSTLVLRQVTLRDTAVYYCVLRE
Okapia johnstoni V133 trav LVCL010397279.1 420 GTDGDSVNQTEAPVTVSEGDRMTLNCTYQATYSTVYPLWYVQHLNKAPQLLLKGLRAGKEEEKEGFRATPVKSDSSFHLQKRAVQTSDSAVYYCALS
Okapia johnstoni V134 trdv LVCL010421208.1 1819 SGVAQKVTQDQTGIIRQVGQSVTLNCWYETSWSSYYLVWYKQLPSGQMTYLIQQYSGGSNARSGRYSVNFKKADKSISLIIASLELEDSAKYFCALSE
Okapia johnstoni V135 trav LVCL010427269.1 709 LSVQMKVEQSPGVLTLQEGRNSSLICNYSISIRSVQWFQQNPDGRLISLFYIASGKQQKGRLKSTISNKERYSQLYIRDSQPGDSATYFCAVE
Okapia johnstoni V136 iglv LVCL010435638.1 346 SWAQAVLTQPSSVSGTLGQRVSITCSGSSSNVGYGNYVGWYQQIPGSAPKTLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCSSYQSGNND
Okapia johnstoni V137 trbv LVCL010443046.1 1372 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTLQRGLELLIYFNNQASVDESGMPKERFLAKMPNASFSTLKIQPTEPGDSATYLCASSK
Okapia johnstoni V138 trbv LVCL011172978.1 645 AVHAGVTQNLRFQVMRTGQNATLKCTQDLDHDRMYWYRQDLGLGLRLIYYSAAVPTMEKGDVPEGYSVSRSNKENFPLTLESAKRSQTSVYFCASSY
Okapia johnstoni V139 trbv LVCL011193517.1 546 EVHAGVTQDPRFQVVRTGHNATLKCTQDLGHNSMYWYRQDLGHGLRLLYYSAGSDTWEKGDVPEGYSVSRPNTKDFPLTLEFANRSQTSVYFCASSY