WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ovis aries musimon CBYI000000000.1 (CBYI01) 161 2 24 9 46 54 6 20
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ovis aries musimon V0 iglv CBYI010003625.1 2018 SLSQPLLTQPASLSASPGASARLSCTLSSGYNVGNYSIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPNRFSGSKDASTNAGLLLISEVQPEDEADYYCAVWHD
Ovis aries musimon V1 iglv CBYI010003625.1 10880 SQAQAVLTQPPSVSGSLGQRVSITCSGSSSNIGGGNYVGWYQQLPGSGLKTIIYGTSSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCATEDSSSYN
Ovis aries musimon V2 iglv CBYI010003625.1 19270 SRAQAVLTQPSSVSRSLGQRVTITCSGSSSNTGGNFVGWCQQLPGTAPKTRIYGDSNRPSGGPEWFSGSKSGNSASMTIASLQAEEEAGYYCLSWDDSLNG
Ovis aries musimon V3 trdv CBYI010090149.1 112434 KGVLCNQVTQSSPEQRVASGREVTLQCTFQTTYSNPDLYWYRKTPDAVFQFVLYRDNTRSRDADFARGRFTVQHSVRSKTFHLVISSVRPEDTATYYCALEL
Ovis aries musimon V4 trav CBYI010091592.1 4210 SAGKGVEQPTELTVMEGASAQVNCTYQTSGFNGLFWYQQHDGGAPVFLSYNVLDGLETRGHFSSFLRRSDAHSYLLLKELHMKDFASYLCAVI
Ovis aries musimon V5 trbv CBYI010097036.1 32649 VRAQTIHQWPSTRVQPAGSLLSLECTVKGTSSPNLYWYRQEAGGSLQLLFSSVGVDQIEPREFQNFEASRPQDGQFTLSSKKLQLNNSGFYLCAWS
Ovis aries musimon V6 trgv CBYI010107714.1 54735 GLGLSKVEQAQISLSTEVKKSINIHCKIESTDFESEAVYWYRQKRNQALEHLVYVISTTTAARNQVDGKNKIEARKDARMFTSTLTVNFVEKEDVGIYYCAGWS
Ovis aries musimon V7 trgv CBYI010107714.1 66133 GLGQLTLEQPELSVTGTREKSIIMTCKVFSKDFSKDYIHWYRQKPDQGLEQLLYVSTAPAQNHLGGKKNKLEARKDAPSSTSTLKISFLEKEDEATYYCAGWLS
Ovis aries musimon V8 trgv CBYI010107714.1 72894 GDIKMKISQHQLSSTRRPDRTVHISCKLSGVPLENAIVHWYQEKEGEPLKRILYGSANSYKLDKPNSRLEMDNKKNGIFYLIINNVVKSDEATYYCACWD
Ovis aries musimon V9 trgv CBYI010107716.1 6913 TQVSSNMEEDKLSVTRATGSSVVIDCDLTQNYIHWYKFQEGTVPRRLLYYDVYYSKVVLDSGISEGKYHVYKGTGKSYTFVISNLQESDSGTYYCAVWE
Ovis aries musimon V10 trgv CBYI010107716.1 20815 MQVSSNMEGEKMSITKAAVPGAFVEIICDLITQTAKYIHWYKHQEGTAPRRLLYYDISYSKVVLESGISEGKYKVYKEKSYTFAISNLQESDSGMYYCAVWE
Ovis aries musimon V12 trbv CBYI010109962.1 5163 TWGIGVFQTPKYRLTQMGTKTSLECEQKLNHDNMYWYKQDSKKLLKAMFHYNNKELVGNETVPSRFSPESPDKAHLNLYIDSLEPGDSAVYFCASS
Ovis aries musimon V13 trbv CBYI010109962.1 9629 VSADPGITQIPKYLVMGMTDKKSLKCEQHLGHNAMYWYKQSAQKPPELMFIHSYMELSGNESVPSRFWPECPDSSQCRLDLSAPKPQDSAVYLCASSR
Ovis aries musimon V14 trbv CBYI010109963.1 15625 LVDSEVTQTPKYLIKSRKEQATLRCSPESGHRSVNWYQQALGQGPRFLVQYYRGQPSGEENMPDRFSAKQFSDFRSELNLSSLELTDSAVYLCASSQ
Ovis aries musimon V15 trbv CBYI010109963.1 20481 AVHAGVTQDPRFQVVRRGQRVTLRCTQDLKYDYMYWYRQDPGHGLRLIHYSDGPSTTEKGDVPDGYNVSRPSTENFPLTLESASRSQTSVYFCASSY
Ovis aries musimon V16 trbv CBYI010109963.1 24377 LVDSEVTQTPKYLIKSRKQQATLRCSPDSGHFSVYWYQQALGQGPQFLVQYYNQKVSGEAHLPDRFSGKQFSDSRSELNLTSLELMDSAVYLCASSQ
Ovis aries musimon V17 trbv CBYI010109963.1 28275 VVHAGVTQDPRFQVVKTGQRATLNCTQDLGHNYMYWYRQDPGHGLRLIHYSAGPPTTQQGDVPEGYSISRPSKENFPLTLESANPSQTSVYFCASSY
Ovis aries musimon V18 trbv CBYI010109963.1 33953 LVDSEVTQTPKFLTKSRKQQVTLRCSPESGHRSVYWFQQALGQGPQFLVQYFDGKVYQRGNMSDRFSGQQSGSELNLTSLELMDSALYLCASSP
Ovis aries musimon V19 trbv CBYI010109963.1 37976 LVDSEVTQMPKYLIKSRKQHGILRCSPESGHRYVSWYQQALGQGPQFLVQYYDGKVRTKGNMPGRFSGEQFSDSRSQMNLSSLELSDSAVYLCASSQ
Ovis aries musimon V20 trbv CBYI010109964.1 358 LVDSGVTQTPKYLIKSRKQQAMLRCSPESGHRSVYWYQQALGQGLQFLIQYYNSAENEKGNIPDRFSGKQFSDSSSELNLTSLELTDSAVYFCASSQ
Ovis aries musimon V21 trbv CBYI010109964.1 2162 AVHAGVTQDPRFQVVTTGQSTTLRCTQDLSFSYMYWYRQDPGHGLRLIHYSVIPPATEKGAVPEGYSVSRSSTENFPLTLESANPSQTSVYFCSCGY
Ovis aries musimon V22 trbv CBYI010109964.1 6692 VVQAGVTQDPRFQVVRTTQSATLTCTQDLGHNSMYWYQQDAGHRLRLIHYSAGPPTTEKGDMPEGYSISRPSTEDFPLMLKSANRSQTSVYFCASSYSRM
Ovis aries musimon V23 trbv CBYI010109966.1 2566 VVHAGVIQDPRFQVVRTGQRVTVTCTQDLDHNSMYWYRQDLGPGMRLIHYSAGPPTTEKGDVPDGYRVSRPSRENIPLTLESASHSQTSVYFCASSYSMA
Ovis aries musimon V24 trbv CBYI010109968.1 10987 VVHAGVTQDPRFQVVRTGQRMTLRCTQDLSHDYMYWYRQDLGHGLRLIHYSAAYPNTEKGDVPEGYSVSRPSTEDFPLTLKSANRSQTSVYFCASSYSRV
Ovis aries musimon V25 trbv CBYI010109969.1 10412 LVDSGVTQTPKYLIRSRKQQATLRCSPESGHRYVSWCQQALGQGPQFLVQYYDGKVHIKGNMPGRFVGEQFSDSRSQMNLSSLELTDSAVYLCASSQ
Ovis aries musimon V26 trbv CBYI010109969.1 15135 LVESEVTQTPKYLIKSRKEQVTLRCSPKSGHRSVYWYQQALGQGPQFLVQYYDGKVHQKENISDRFSGKQFSDARSELSLTPLELTDSAVYLCASSQ
Ovis aries musimon V27 trbv CBYI010109969.1 16793 AVHAGVSQDPRFQVVRTGQRETVTCTQDLGHNSVYWYRLDPGHGLRLIHYSAAYPTTEKGDMPEGYSVSRPSTEDFPLTLKSANRSQTSVYFCASSYSRV
Ovis aries musimon V28 trbv CBYI010109969.1 19021 LVDSGVTQTPRYLIKARRQRGTLRCSPVSGHLSVYWYQQALGQGPQFLIEYYNQDVRGETNLPERFSGEQFSDSSSELNLTSLELTDLAVYLCASSQ
Ovis aries musimon V29 trbv CBYI010109969.1 20814 AVHAGVTQDPRFQVVRTGQKATLKCTQDLGHNSMYWYRQDPGHGLRLIHYSTGPPTTVKGDVPDGYNVSRSSKENFPLTLESANPSQTSVYFCASSY
Ovis aries musimon V30 trbv CBYI010109970.1 6100 VVHAGVTQDPGFQVMRTGESATLRCTQDLSFSYMYWYQQDPGHGLRLIHHSVIPPSTEKGAVPEGYSVSRPSTENFPLTLESANRSQTSVYFCSCGY
Ovis aries musimon V31 trbv CBYI010109970.1 11951 LVVSGVTQTPRYMIKARGQRGTLGCSPVSGHLSVYWYQQVLGQGPQFLVQYYSQDVYGEAQLPDRFSGEQFSDSSSELNLTSLELTDSAVYLCASSQ
Ovis aries musimon V32 trbv CBYI010109970.1 18801 LVDSGLTVTPKYLIESRKEQLTLRCSSDSEHCSVYWYQQALGQSPRFLFQYYHGKVYQKGNISDKVSGKQFSDDARFELSLTSLELTDSAMYLCASSQ
Ovis aries musimon V33 trbv CBYI010109970.1 22940 LVDSGVTQTPKYLIRSRKQQATLRCSPESGHRYVSWYQQALGQGPQFLVQYYDGKVHTKGNMPDRFSGEQFSDSRSQMNLSSLELTDSAVYLCASRQ
Ovis aries musimon V34 trbv CBYI010109973.1 734 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQALGQGPQFLVQYYRQQVRGEAQLPDRFSGTQFSDSSSELNLTSLELTDSAVYLCASSQ
Ovis aries musimon V35 trdv CBYI010118993.1 1725 SGVAQKVTQDQSDVSGQVGQSVTLNCRYETSWGAYYLFWYKQLPSGQMTYLIQQYSGNSNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALRE
Ovis aries musimon V36 trav CBYI010118994.1 2364 NVIDAKTTQPSSMDYAEEEDVTLTCSHSTIGGDVYIHWCQQNPSQSPQYVIHGLRGTGNSSMASLTIDSDRKSSTLVLPQVTLRDAAVYYCIVRE
Ovis aries musimon V37 trdv CBYI010119401.1 4429 SGVAQSVTQDQPDILSEVGKTVTLNCRYETSWDMFYYHIFWYKQLPSGQMTYLIRQHSDDGNARDGRYSVNFQKAHKSISLTISALELEDSAMYFCVLRV
Ovis aries musimon V38 trav CBYI010119404.1 4021 TVIDAKTTQPSSMDCAEEEDVTLPCNHSTISGNEYIHWYRHNPNQSPQYIIHGLRGTVNSSMASLQIASDRKSSTLVLPQVTLRDAAVYYCIVRE
Ovis aries musimon V39 trav CBYI010119405.1 818 TVIDAKTIQPSSMDCAEEEDVNLPCNHSTISGNEHIHWYRHNPNQSPQYVIHGLRGTVNSSMASLHIASDRKSSTLVLPQVTLRDTAVYYCILRE
Ovis aries musimon V40 trdv CBYI010119412.1 8182 SGVAQKVTQDQPDIASQVGESAAMNCQYETSRNSYNIFWYKQLPSGEMIYLIGQNSYSPNARDGRYSINFLRSLKAISLIISALKLEDSAKYFCALWE
Ovis aries musimon V41 iglv CBYI010120023.1 1494 SRAQAVLTQPFSVSGSLGQRVTITCSGSSSNTGGNFVGWCQQLPGTAPKTPIYGTNSRPSGGPEWFSGSKSGNSASMTIASLQAEEEAGYYCLSWMTA
Ovis aries musimon V42 iglv CBYI010120025.1 904 SWAQAVLTQPSSVSGSLGQRVSITCSGSNIGSSGVGWFQQLPGSGLRTVIYYNSNRPSGVPDRFSGSKSGNTATLTISSLQAEDEADYFCGSYAGSSSN
Ovis aries musimon V43 iglv CBYI010120027.1 6429 SWAQAVLTQPPSVSGSLGKTVTISCSGSSSNIGLLGVSWYQQLPGSAPKTLIYGSNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASADLSLKS
Ovis aries musimon V44 iglv CBYI010120027.1 9211 SLSQPLLTQPASLSASPGASARLSCTLSSGYNVGNYSIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPNRFSGSKDALTNAGLLLISEVQPEDEAEYYCAVSHD
Ovis aries musimon V45 iglv CBYI010120027.1 18363 SWAQAVPTQPPSVSGSPGQRVTITCSGSSSNIGSYGVCWYQQLPGSAPKLICCTTSGALESSDRFSCSRSGNTATLTISSLQAEDEADYYCAAGDSSSYT
Ovis aries musimon V46 iglv CBYI010120028.1 2002 SWAQAVLTQPPSMSGYPGQTVTISCTASSSNMRLGDVDWYQQLPGSAPRTVIYDTNDRPSAIPDRFSGSRSDSTVTLTITSLQAEDEADYHCSAYDSSISA
Ovis aries musimon V47 trdv CBYI010120605.1 10623 SGVAQEVTQNRPDISSQVGQPIALNCRYETSWSYYYLVWYKQLPSGQITYLIQQYSGYSNARNGRYSVNFKKADKSISLIISSLQLEDSAKYFCALCD
Ovis aries musimon V49 trav CBYI010120608.1 1715 GTGAQLVTQTDGHINVSEGNRLELRCNYSYSGSISLFWYVQYSSQGLQFLLKYLSGPTRVKGIKGFEAEFKNDENSFHLMKASAHWSDSAKYFCALC
Ovis aries musimon V50 trdv CBYI010120612.1 943 SGVAQRVIQDQPDISGQLGQSVTLNCRYATTWSSYYLFWYKLLPSGEMIYLIHQVSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Ovis aries musimon V51 trdv CBYI010122453.1 4629 SSVAQKVTQYQPDVTSQVPNVVILNCRYETSWNVYTYWIFRYKQLPSGEMTYLIHQYSEDGNERDGHYAVNFQKAPKFISLTVSSLKLEHSGKYFCALWE
Ovis aries musimon V52 trdv CBYI010122453.1 18184 SGVAQSVTQDQPVIISEVGKTITLNCRYETSWDMYTYWIFWYKQLSSGQMTYLIRQYSEGGNARDGRYSVNFQEAHKSISLTISALELEDSAMYFCVLRA
Ovis aries musimon V53 trav CBYI010123146.1 1066 VSVGNKVEQSPSTLSVQQGNNCFINCTYTDVTTSYFPWYKQEPGKGPQLLIDIRSNMGKNEGQRLTVLLNKTTKHLSLHITTTEAGDSAVYFCAAS
Ovis aries musimon V54 trav CBYI010123147.1 6624 SIVAQKVTQDPQPILVQEKEAVTLDCTYDTSDSSYSLFWYKQPNSGAMIFLLSQDSYGKENAAEGRYSLNFQKASKSITLVISASQLEDSAVYFCALRE
Ovis aries musimon V55 iglv CBYI010123225.1 579 SWAQAVLTQPSSVSRSLGQSVSITCSGSSSNVGYGNYVGWFQQVPGSAPKLLIYGATSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYYCASYDSSSYT
Ovis aries musimon V56 iglv CBYI010123225.1 9300 SWARAMQTQPPSVSGSLGKRVTITCSGSSSNIGGNFVGWCQQLPGTALKTPIYGDSNRPSGGPEWFSGSKSGNSASMTIASLQAEEEAGYYCLSWDDSLNG
Ovis aries musimon V58 trav CBYI010123315.1 1903 GTNGDSVNQTEGPVTVSEGALMTLNCTYQTANPAPYLFWYIQRLNKAPRLLLKGSMSDPKPKSEGFQATLVKSDRSFHLQKRAVQASDSAVYYCALS
Ovis aries musimon V59 trav CBYI010123484.1 8545 GTNGDSVDQTEGPVTVSEGALMTLNCTYQATYSTVYLFWYVQHLSKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Ovis aries musimon V60 trav CBYI010123491.1 5567 SIIAQKVTQDAQPMLIQEKKAVTLDCTYDTRDSSYSLFWYKQPSSGAMIFLLRQDSYGKQNASEGCCSLNFQKASKSITLVISASQLEDSAVYFCALRE
Ovis aries musimon V61 trav CBYI010123498.1 1221 VSSKQDVSQSPEALSVREGDSLVLNCSYTDSALYFLQWFRQDPRKGLTSLLSIQANQKEKASGRITVSLDKSSRHSALYIATSQHSDSTAYLCAV
Ovis aries musimon V62 iglv CBYI010123617.1 24 SLSQPLLTQPASLSASPGASARLTCTLSSGYSVGSYTIYWYQQKAGSPPRYLLRFKSDSDKHQGSGVPSHFSGSKDASTNTGLLLISGLQPEDEADYHCAVWHG
Ovis aries musimon V63 iglv CBYI010123618.1 3948 SWAQAVLTQPSSVSGSLGQRVSITCSGSSSNVGTYGVGWYQQLPGSGLRTIIYGTSSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCAAEDSSSYN
Ovis aries musimon V64 trdv CBYI010123860.1 1979 SGVAQKVTQDQSHVSSQVGQSVTLNCRYETSWSYYNLFWYKQLPSGQMTYVIRQGSQATNARKDRYSVNFKKADKSISLTISALQLEDSAKYFCALC
Ovis aries musimon V65 trdv CBYI010124112.1 541 SGVAQSVTQDQPDILSEVGKTITLNCRYETSWDMLSYYIFWYKQLPSGKMTYLIRQHSDDGNARDGRYSVNFQKAHKSISLTISALELEDSAKYFCVLRV
Ovis aries musimon V66 ighv CBYI010124159.1 1215 VLSQVQLQESGPSLVKPSQTLSLTCTVSGFSLTSNAVGWVRQAPGKVPEWLGGISSGGSTYYNPALKSRLSITRDTSKSQVSLSLSSVTTEDTAVYYCAR
Ovis aries musimon V67 iglv CBYI010124167.1 895 SWAQAVLTQPSSVSGSPGQRVSITCSGSNIGSSGVGWFQQLPGSGLRTVIYYNSNRPSGVPDRFSGSKSGNTATLTISSLQAEDEADYFCGSYDSSSYN
Ovis aries musimon V68 trav CBYI010124190.1 848 VRGVDVEQSPPALTPQEGASSTLWCNFSTLADTVRWYLQKPGGRLIHLIYIPSGTRQEGRLNATAVPKERRSSLHISSLRTTDSGTYFCAVRHSAPQ
Ovis aries musimon V69 trav CBYI010124265.1 919 TVINAKTTQPSSMDCAEGEDVNLPCNHSTVGGNDYIHWYRQNPNQSPQYVIHGFRGTVNSSMASLHIASDRKSSTLVLPQVTLRDAAVYYCLLRE
Ovis aries musimon V70 trav CBYI010124456.1 368 GTSGDSVTQTEGVVILPEKASLTLKCTYQSSYSDFLFWYVQYKNKELELLLKSSLGDQKVTSRGFEATHISSDSSFHLQKSSVKTSDSAVYYCALS
Ovis aries musimon V71 trav CBYI010124749.1 992 VRGMDVVQSPPALSLQEGASSTLRCNFSTLADNVQWYLQNPGGRLIHLFYIPSGTKQDGRLNATTVPKERHSSLHISSSQTTDSGTYFCAAQHSAPQ
Ovis aries musimon V72 trav CBYI010125062.1 466 GVRGVQVEQSPSILSLQEGANSTLWCNSSDTVSTVQWFQQNPGGSLTRLFFIASGTKQNERLSSTVNSKERYSTLHITASQLEDTATYLCAVE
Ovis aries musimon V73 trbv CBYI010127929.1 653 SMDTEVTQSPSHLVKGKGQKAKMDCIPIKGHINVYWYRRKLEEALEFLVYLQKQDIEEDTEVFKEQFSAQCPPNSPCSLEIKSTKAADSALYFCASSQ
Ovis aries musimon V74 igkv CBYI010002057.1 85755 ASGEAVLYQTPAYIAVPLGESISITCRANQSISDYLSWHKQKPGQAPMILIYDADNRLNGVPERFTATQSGTEFVFTISQVEADDAAMYYCQQSYVLP
Ovis aries musimon V75 igkv CBYI010002057.1 77308 DIQVTQSPSSLSASLADKVSITCQASQNTDTKLAWYQQKPRKAPKLLIYAVSRSPSWFPSQFSGSGFGIDFTLTISSLKADDIAAYYCQQDHGLP
Ovis aries musimon V76 igkv CBYI010002058.1 7180 ARCDIQVTQSPSSLSASLTERVSITCRTSQSVSNYLNWYQQKPGQAPKLLIYYATRLHTDVPSRFSGSGSGTDYTLTISSLEANDTATYYCLQYDS
Ovis aries musimon V77 igkv CBYI010002061.1 23966 SIGDVVLTQTPLSLSVTPGGTVSISCKSSQSLKYSDGKTYLYWFQHKPGQSPQLLIYQVSNCYTGVPDRFTGSGAETDFTLTISSVQAEDAGVYYCFQATYIDP
Ovis aries musimon V78 igkv CBYI010002061.1 9296 SSGDVVLTQTPLSLSVIPGETASISCKSSQSLVHSDGNTYLNWIQHKPGQSPQGLIYQVSNRYSGVSDRLTGSGSGTDFTFTISSVQAEDAGIYYCYQGTEAP
Ovis aries musimon V79 igkv CBYI010002065.1 6090 SSGDVVLTQTPLSLSVIPGGTASISCKSSQSLKYSDGNTYLYWFQHKPGQSPQLLIYQVSNCYTGVPDRFTGSGAETDFTLTISSVQAEDAGVYYCFQAINYP
Ovis aries musimon V80 igkv CBYI010002068.1 33114 SSGDTADPDSTLPVYHPWRMASISCKSRRSLLYSDGNTYLYWFQHKPGQSPQRLIYQISSRDTGVSDRFTGSGSGTDFTLAVCRVQAEDAGVYYCFQD
Ovis aries musimon V81 igkv CBYI010002068.1 19691 SNGAIVLTQTPRSLSVIPGETASISCRASQSVQNRYGDNFLHWYVQKPSQSPQLLIYAASNRASGVSDRFTGSGSGTDFTLKISRVEAEDAGVYYCQQSKETP
Ovis aries musimon V82 igkv CBYI010002068.1 8227 SIGDVVLTQTPLSLSVIPGGTVSISCKSSQSLKYSDGKTYLYWFQHKPGQSPQLLIYQMSNRNTGVPDRFTGSGAETDFTLTISSVQAEDAGVYYCFQATYIDP
Ovis aries musimon V83 iglv CBYI010069075.1 35306 SVISYELTQPTSVSVALGQTAKVTCQGDNIGSSYANWYQQKPGQAPVTVIYQDSKRPSGIPDRFSGSNSGNTATLTISGARTEDEADYYCLSADSSYN
Ovis aries musimon V84 iglv CBYI010069075.1 29207 SVISYELTQPTSVSVALGQMAKVTCSGDLLDENFAHWYQQKPGQAPVLVIYLNSERASGIPDRFSGSSSGSTATLTISGVQAEDEADYFCQSYGSSYN
Ovis aries musimon V85 iglv CBYI010069075.1 16274 SVISYELTQPTSVSVALGQTAKVTCQGDLLDEKYTAWYQQKPGQAPVNIICKDSERPSGILDRFSGSSSGKTATLTISGARTEDEADYYCLSADSSNN
Ovis aries musimon V86 iglv CBYI010069075.1 7875 SVVSYELTQPTSVSVILGQTAKVTCSGDLLDEQYTQWHQQKPGQAPELVIYEDSKRPSGIPDRFSGSSSSKTAILTISGVRAEDEADYYCVSWDSGSYN
Ovis aries musimon V87 iglv CBYI010069075.1 3141 HLASSQLTQQPAVSVSLGQTASITCQGGDLAFASANWYQLKPGQAPVTVIYGGSDRASGIPDRFSGSKSDTTATLTIRGAQAEDEADYYCQLGGIGVD
Ovis aries musimon V88 iglv CBYI010069078.1 2838 SWAQSALTQPASVSGNPGQTVTISCTGTSSDIGGYSYVGWYQQLPGSAPKTLIYNVNKRPSGIPARFSGSKSGNTATLTISGLQAEDEADYYCGSYKSGGT
Ovis aries musimon V89 iglv CBYI010069085.1 3583 SWAQSGLTQPASVSGNPGQTVTISCAGTSSHIGGYNEVGWYQQLPGTAPRTLTYYLNKRPSGIPARFSGSKSGNTATLTISGLQAEDEAYYYCS
Ovis aries musimon V90 iglv CBYI010069094.1 3839 SWAQAVLTQPPSVSGSLGQTVTISCSGSSSNIGLLGVSWYQQLPGSAPKTLIYDSNKRPSGVPDRFSGTKSGNTGTLTITSLQAEDEADYYCASADLSLKS
Ovis aries musimon V91 trdv CBYI010090156.1 18892 VMSAVVLVPQDQEKTVPVGKSVTLSCSMKGAMFISKHYIFWYRKTPGNTMTFIYREEGVYGPGFEDNFRGKIDNSTNQAMLELLKASERDEGFYYCASD
Ovis aries musimon V92 trav CBYI010090160.1 40921 VSGKNGVEQSPRYLSAQEGDLITINCNYLEGMTTLQWLQQNPGGSIISLLTLSLEMKKKGRVSATINRKERYSSLNITAPQPTDSAIYFCAVE
Ovis aries musimon V93 trdv CBYI010090160.1 11286 SDNVESADVPTVYKKEGESVTVECKFSVSYTYYMMYWYRQPSSGEMIYMINIYSQSKQTREGRYSVEFYKPNQMLKLTISALTLSDSAVYFCGVRE
Ovis aries musimon V94 trdv CBYI010090164.1 6512 PSVAQTVTQPQPEESVQEADTVTLDCTYTTSESDCYLFWYKQPPSGEMVFIIHQYAYEQQNSTNDRYSVNFQKEAKAFSLRISDSQLEDAAIYFCAYSG
Ovis aries musimon V95 trav CBYI010090164.1 3601 RSVAQTVTQPQPEESVQETGTVTLDCTYTTSESNYYLFWYKQPPSGEMVFIIRQNAYEQQNATNDRYSVNFQKEAKAFSLRISDSQLEDAAMYFCAYSG
Ovis aries musimon V96 trav CBYI010090166.1 11082 VKSDDNVMQSPSSLIVLEGSNATLSCSYKVTNFQSLHWYKQEEKVPTFLFVLISTGIEKTSGRLKGTLDRKELLSTLYITVTKPGDSATYLCAVE
Ovis aries musimon V97 trav CBYI010090166.1 4915 PRRADWIRSQESEVSGTEGKTVSLSCNYYTSSRSFVSLFWYRQYPNQAPEYILYRQWGSSGKGYASFATERFYSDNTANTTNLYIKKVVPADTALYLCALE
Ovis aries musimon V98 trav CBYI010090167.1 5052 VSAQQLNQSPQSMSIQEGEDLSMNCNSSSTLNLLLWYKQDAGEGLILLIKLLKGGELARNGKLTAQFGGTRKDSLLNNSAFEPKDGGTYFCAG
Ovis aries musimon V99 trav CBYI010090171.1 13980 LRVQMKVEQSPGVLTLQEGRNSSLICNYSISIRSVQWFQQNPDGRLISLFYIASGMQQKGRLKSTINSKERYSQLYIRDSQPGDSATYFCAVE
Ovis aries musimon V100 trdv CBYI010090171.1 3422 SSMADKVTQAQTTVTGQEREAVTIGCTYETSQTYYTLFWYRQFPGGRMEFLIYQDSNQANARRDRYSVNFQKGKKIISLTISSLHLADSAKYFCALWE
Ovis aries musimon V101 trav CBYI010090176.1 4510 ESTQQLEQNPKFLRIQEGGNVTVYCNSSSTFTFFQWYRQKPEEGPVLLVTLTKPKEVKEQKRIRAEFGEARKDSSLLITAAQPGDAGTYLCAG
Ovis aries musimon V102 trav CBYI010090180.1 4643 IMVDVEITQLSSMDCAEGEDVNLPCNHSTIDALDYIHWYRQTPNQSPQYVIHGFRDTVNSSMGSLNIASDRKSSTLVLSQVTLRDTAVYYCVLRE
Ovis aries musimon V103 trav CBYI010090181.1 775 MNGQQIKHFPEFLLLQEGENFTTYCNFSSTFYNLQWYKQRPGGSPVLLMILAKGGEVKTQQRLTVRFGESRQHSSLHLTATQPSDVGTYFCAT
Ovis aries musimon V104 trbv CBYI010097038.1 17570 PLEADVTQSPKHCITETRKRVTLTCSQNMNHDVMYWYRQDPGLGPKLIYFSRNVGFVEKGDISDGYTASQEEKPNFPLILELTSTNQTSLYLCASSE
Ovis aries musimon V105 trbv CBYI010097038.1 11475 LMDAQVTQTPRYLVKRRGEKVVIECIQNMDHERMFWYQQDPALGLRLLHFSINVDLLEEGDVPYGYSVSRTKKKSFPLTLESATTNQTSMYLCASSE
Ovis aries musimon V106 trbv CBYI010097038.1 3924 SVFGALLSQKPSRAIRQRGTSMMIECQVDSQLTLMYWYRQLPGQSLVLMATANQGSKATYESGFTEDKFPISRPNLTFSTLAVSNASSEDSSSYFCSAG
Ovis aries musimon V107 trbv CBYI010097039.1 22599 SMDTEVTQRPSHLIKGKDQKAKMDCVPKEGHAYVYWYRKKPEGAFEFLVYLQNQDTMEDTAEFKQRFSAECPQNSPCSLEIKSTKAVDSALYFCASSQ
Ovis aries musimon V108 trbv CBYI010097039.1 18028 PTDAEIYQVRFLPAEAGQDVTLECKQNLGYSAMYWYRQDTGQGLKLIYYSTVEKDIQRGDLSEGYSVSREKKELFPLTVKSAQTKQTAVYLCSRA
Ovis aries musimon V109 trbv CBYI010097039.1 14288 SMDTGVTQTPRNRIAITGNSTVLECSQTKGHEYMYWYRQDPGQGLRLVYSSYDINGINKGDVSAGYNVSRKEKAKFSLYLEPATPNQTAIYFCASSI
Ovis aries musimon V110 trbv CBYI010097039.1 7950 FTDADVYQTPRHCVTGTGRKITLQCSQTMGHDNMYWYQQDPGMELQLIHYSYGVNTTEKGERSSRSTVSRISKEHFPLTLETASSSQTSSYFCASSD
Ovis aries musimon V111 trbv CBYI010097039.1 6024 LEDAAVIQFPRHRILEAEKEFTLQCSQKMNHYAMYWYRQDPGLGLQLIYYSTGPDTFNKGDVPEGYHVSRDELEHFPLTLKSASPNQTSVYFCASAE
Ovis aries musimon V112 trbv CBYI010097042.1 21758 GSGLGAVISQQPRRAVSKSGASVTIECRAVDFQATTVFWYRQFPKRGLVLMATSNAGTNATYEQGYNKDKLPISQPNLTFSSLMVTNVDPADSSLYFCGAR
Ovis aries musimon V113 trbv CBYI010097042.1 15054 SMDTEVIQSPSHLVKGKDQKATMDCVPIKGHSYVYWYRKKPEGAFEFLVYLQNQDVVEDTAMFKQQFSAECPQNSPCSLEIKSTKAADSALYFCASSQ
Ovis aries musimon V114 trbv CBYI010097042.1 9825 SMDTGVTQSPSHLVKGKDQRAKMDCVPIKGHPYVYWYRKKLEAFEFLVYLWNGKITEDTAMFKQRFSADCPQNSPCSLEIKSTEAPDSALYICASS
Ovis aries musimon V115 trbv CBYI010097042.1 824 SMDTEVTQSPSHLVKGKDQRAKMDCVPKKGHSYVYWYRRKLEEAFEFLVYLQDEKIIEDTDMFKQRFSAECPQTSPCSLGIKSTKASDSALYFCASSQ
Ovis aries musimon V116 trbv CBYI010097043.1 2981 TVAGEVTQTPKYLLKKEGGAVTLECEQDFDYDSMYWYRQDPGLGLRRIFFSQVVMDVQEEDIAKGYSASREKKPFFPLTVTSAQKNQTALYLCAASR
Ovis aries musimon V117 trbv CBYI010097044.1 11867 PTDAGVTQTPRHEVTEKGQAVTLSCEPIKSHAALFWYRQTSVRGLELLIYFNNQSPIDESGMPKDRFLAKMPNASFSTLKIQPTDPGDSATYLCASSK
Ovis aries musimon V118 trbv CBYI010097044.1 9320 YISAEVAQSPSHRVIEKKQAVNLSCDPISGHNSLFWYYHAVGTEMKLLVYFLRESVQDNSGMPKGRFTAERTEGTSSTLRVHSAELGDSGVYFCASSR
Ovis aries musimon V119 trbv CBYI010097044.1 6981 HVGAMVIQNPRYLVTGLGKPVTLSCSQNMKHDAMYWYQQKPSQAPKLLLYYYDKEITREKNTSENFQSSRPNTSLCSLDIRSAGLGDSAVYLCASSR
Ovis aries musimon V120 trbv CBYI010097044.1 1959 FLEAEVTQTPGHLVQGKGLEVEMYCVPKKGHIYVFWYQQILAKEFKFLISFQNDKVLDDKEMPKKRFSAECPSNSPCSLKIQPAEPQDSAMYFCASSD
Ovis aries musimon V121 trbv CBYI010097045.1 28516 PLEAEVTQTPRHLIKTKGQTATLRCSPMSGHSSVSWYQQARSQGPQFLFEFYETLQRDKGNFSNRFSAKQFRDFSSELNVNFLELTDSALYLCASSL
Ovis aries musimon V122 trbv CBYI010097045.1 23535 HTRAGVVSQSPGYRVAGRGQNVTLRCDPIPGHQVLYWYRQMLGQGPEYLTYFQGKEESDKSGMPKNRFSAERPESTYSYLKIQPVEPKDSAVYLCASSP
Ovis aries musimon V123 trbv CBYI010097045.1 1300 TTDANLGVTQTPRHEVTEKGQAVTLSCEPIKSHTALYWYRQTSVQGLQLLIYFRNEAPVDESGMPKDRFSAKMPNASFSTLKIQPTDPGDSAMYLCASSK
Ovis aries musimon V124 trbv CBYI010097046.1 16621 LVDSGLSLTPKYLIKSRKEQLTLRCSPESGYRSVYWYQQALGQGPQFLVQYYDGEIYQKGNLSDRVSGKQFSDACSELSLIPLELTPSAVYLCASSQ
Ovis aries musimon V125 trbv CBYI010097046.1 14793 AVHAGVTQDPRFQVMRTGQNATLNCTQDLGHDRMYWYRQDPGHGLRLIYYSAGPLSTEKGDVPDGYRVSRSSKQNFPLTLESASRSQTSVYFCASSY
Ovis aries musimon V126 trbv CBYI010097046.1 12496 LVDSGVTQTPKYLIKSRKQEVTLRCSPESGPRYVSWYQQALGQGPQFLVQYYDGKVHIKGNMPGRFSGEQFSDSRSQMNLSSLELTDSAVYLCASRQ
Ovis aries musimon V127 trbv CBYI010097046.1 9724 AVHAGVTQDPRFQVVRTGQSLTLKCTQDLNHDSMYWYRQDLGHGLRLIHYSSFTDATYKGDMPDGYNVSRSSTENFPLTLESANRSQTSVYFCASST
Ovis aries musimon V128 trbv CBYI010097046.1 6874 HTGAGVVSQSPRHRVAGRGQNVTLRCDPISGHISLYWYRQMLGQGPEFLTYFQNEQELDKSGMPKNRFSAKRPQSTYSYLNIQPAEPGDSAVYLCASSP
Ovis aries musimon V129 trbv CBYI010097047.1 5134 LVDSGVTQTPRYLIKARGQRGTLGCSPVSGHLSVYWYQQALGQGPQFLVQYYSQNVYGETQLPDRFSGEQFSDSSSELNLTSLELTDSAVYLCASSQ
Ovis aries musimon V131 trbv CBYI010097048.1 1448 AVHAGVTQDPRFQVVRRGQSTTLYCTQDLGHDRMYWYRQDLGHGLRLIHYSVAYPTTEKGDVPEGYSVSRPSTEDFPLTLKSANHSQTSVYFCASSY
Ovis aries musimon V133 trgv CBYI010108462.1 12466 IQQEIRLSQRSVMVGSAGGAMTMPCHVSRSVDYVHWFRQLEGQAPERLLYLALSKRDVQWDSVLGGDKVSAARGGDGKSCTMSLRKLAKSDEGLYYCAAWGS
Ovis aries musimon V134 trav CBYI010118713.1 9535 KSRGEKVEQYPSFQSVQEGDNCVINCTYTDSASAYFVWYKQEPGKGLQLLIHTLSNVDKKEGQGLIVLLNKKNKHLSLNITATHPGDSATYFCAAR
Ovis aries musimon V135 trav CBYI010118716.1 1120 GVRGVKVEQSPSVLSLQEGANSTLWCNFSDIVSSVQWFQQNPEGSLISLFFIASGTKQNERLSSTVNSKERYSTLHIAASQLEDAATYLCAVE
Ovis aries musimon V136 trav CBYI010118720.1 948 TLSLAKTSQPIIIDSYEGQEVNIPCNHTTIAISEYIFWYRQFPNQGPQFIIQGYTTTVENEVASLLIPPDRKFSTLSLPRASLGDAAVYYCIVRD
Ovis aries musimon V137 trav CBYI010121261.1 8884 GSNGDSVNQTEGPVTVSEGALMTLSCTYQTTYSNPYLYWYVQHLNKAPQLLLKGLTADKKVEHEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Ovis aries musimon V138 trav CBYI010121261.1 2290 GSNGGSVNQTEGPVTLSEGALMTLNCTYEATFSDSYLFWYVQHLNKAPQLLLKGSMTNQRPEHEGFQATLVTSDRSFHLQKQAVQASDSAVYYCALS
Ovis aries musimon V139 trav CBYI010121262.1 23694 GTSGDSVTQTEGPVTVSEGALMTLNCTYQATYSNVYLFWYIQHLNKAPQLLLKGLTADKKVEHEGFQATLVKSDRSFHLQKRAVQASDSAVYYCALS
Ovis aries musimon V140 trav CBYI010121262.1 10715 GINGDSVNQTEGPVTVSEGALMTLNCTYQTAGFSPYLFWYIEHLNKAPQLLLKGLARDLKPKSEGFQATLVQSDRSFHLQKRAVQASDSAVYYCALS
Ovis aries musimon V141 trav CBYI010122026.1 362 MNGKQIKHFPEFLLLQEGENFTTYCNSSSTFYNLQWYKQRPGGSPVFLMILTKPGEAKMEQRLTGRFGESRQHSSLHLAAAQLSDAGTYFCAE
Ovis aries musimon V142 trdv CBYI010122028.1 1387 SGVAQKVTQDQPDISSQVGQSVTLNCRYEISWGLYYLFWYKQLPSGQMTYLIQQYSGYSNARDGRYSVNFQKADKSISLIISSLQLEDSAKYFCALRD
Ovis aries musimon V143 trav CBYI010122030.1 1006 VNSQQGEQNLQTLSIQEGESVTMNCSYKSVTITALQWYRQDSRRGFVHLILMRSNERQKHSGRLLFTLDSSIQSSSVSIAASQAEDTATYFCAP
Ovis aries musimon V144 trav CBYI010122035.1 1320 GTRAQTVTQPESHVPVSEGDPVQVKCSYSYSGSPVLFWYVQYPRQRLQLLLKHTSKESIQGFTAELSRAEASFHLKKPSAQEEDSAVYYCALG
Ovis aries musimon V145 trav CBYI010122040.1 668 VSSQQNTVEQSPASLPVPEGAVASLGCTYSDSNSQYFTWYRQYPGKGLEFLLYVYLDKDKEEGKFTAQSNKTNKRVSLHIRDSEPSDSATYLCAV
Ovis aries musimon V146 trav CBYI010122277.1 1437 VSSQQNTVEQSPASLPVPEGAVASLSCTYSDINSQYFAWYRQYPGKGPEFLLNVYLNKDKEEGKFTAQSNKTNKHVSLRIRDSEPSESATYLCAV
Ovis aries musimon V147 trav CBYI010122279.1 1674 VSLGNKVEQSPSTLSVQEGNSSVITCTYTDTASDYFPWYKQEPGKGPQLLIAIRSNMGEKKDQRLTVLLNKTTRHLSLHIATIQPGDSAVYFCAAR
Ovis aries musimon V148 trav CBYI010122281.1 2054 GVRGVKVEQSPSILSLQEGANSTLWCNSSDTVNSVQWFQQNPGGSLTRLFVIASGTKQNERLSSTVNSKERYSTLHITASQLEDAATYLCAVE
Ovis aries musimon V149 trdv CBYI010122665.1 7032 SGVAQKVTQDQPDITSQVGQSVTLNCKYEVSWYKISYSIFWYKQLPSGQMTYLIRQYSENANARDGRYSVNFQKADKSISLTIPALQLKDTAKYFCA
Ovis aries musimon V150 trav CBYI010122666.1 1437 VNAQQISQIPQFLLLQEGENFTTYCNSSSTFYSLQWYKQRPGESPVLLMILAKAEEVKTEQRLTGRLGETRKHGSLHLAAAQLSDAGTYFCA
Ovis aries musimon V151 trdv CBYI010122668.1 1025 FGVAQKVTQDQPYVTSQIGQSVILNCRYEVSWSGYTHYLFWYKQLPSGEMTLRIRQESSGPNARNGRYSVNFQRAQNTISLTISALQLEDSAKYFCVVWE
Ovis aries musimon V152 trdv CBYI010122948.1 2262 SGVAQRVIQDQPDISGQLGQSVTLNCRYGTTWSYYYVFWYKLLPSGEMIYLIHQVSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Ovis aries musimon V153 trav CBYI010122969.1 1099 SIIAQKVTQDQPQVLVQEKEAVTLDCKYDTSDSRYSLLWYKQPSSGGMILLIRQDSYNQQNATEGRYSLNFQKASKSITLVISAPQLEDSAVYFCALSE
Ovis aries musimon V154 ighv CBYI010123368.1 1341 VLSQVRLQESGPSLVKPSQTLSLTCTVSGFSLTSNAVGWVRQAPGKVPEWLGGISSGGSTYYNPALKSRLSITRDTSKSQVSLSLSSVTTEDTAVYYCAR
Ovis aries musimon V155 iglv CBYI010123454.1 6151 SRAQAVLTQPFSVSGSLGQRVTITCSGSSSNMGGNFVGWCQQLPGTDPKTPIYGDSNRPSGGPEWFSGSKSGNSASMTIASLQSEEEAGYYCLSWDDSLNG
Ovis aries musimon V156 trdv CBYI010123921.1 1212 SGVAQKVTQDQPDITRQVEQSVTLNCQYEVSWYMDYYSIFWYKQLPRGQMTCLIRQYSEDGNARDGHYSVNFQKADKSISLTISALQLEDTAKYFCALRE
Ovis aries musimon V157 trav CBYI010124261.1 7360 GVRGVKVEQRPSVLSLQEGANSTLWCNSSDTVNRVQWFQQNPGGSLTRLFVIASGTKQNERLSSTVNSKERYSTLHITASQLEDAATYLCAVE
Ovis aries musimon V158 trav CBYI010124341.1 913 VSGKNQVEQSPPSLAVLEGENCTFQCNYTVSPFNNLRWYTQDTGKGLVSLITMTYSDNKKSNGRYTATMDATAKHSSLHLTAAQLSDPAFYICMVG
Ovis aries musimon V159 trav CBYI010124444.1 650 VRGMDVAQSPPALSLQEGASSTLRCNFSTFTDDVQWYLQNSGGRLIHLIYIPSGTKQEGRLNATTVPTERRSSLHVSSLQTTDSGTYFCAAQHSASQ
Ovis aries musimon V160 trbv CBYI010124489.1 2697 LVDSGVTQTPKYLIKSRKQQAMLRCSPESGHRSVYWYQQALGQGLQFLIQYYNSAENEKGNIPDRFSGKQFSDSSSELNLTSLELTDSAVYFCASSQ
Ovis aries musimon V161 trbv CBYI010124489.1 892 AVHAGVTQDPGFQVVRTGESATLRCTQDLSFSYMYWYRQDSGHGLRLIHYSVMPPSTEKGAVPEGYSVSRPSTENFPLTLESANRSQTSVYFCSCGY
Ovis aries musimon V162 trav CBYI010124697.1 3063 TVIDAKTTQPNSMDCAEGEDVNLPCNHSTVSGNDYIHWYRQNPNQSPQYVIHGFRDTVNGSMASLTIASDRKSSTLVLPRVTLRDATVYYCALRE
Ovis aries musimon V163 trav CBYI010125141.1 389 VQGLDVEQSPPALSLQEGASHMLRCNFSASVSDVQWYLQNPSGRLIHLFNIPSGTKQDGRFNATTIPKERRSSLHVSSLQTTDSGTYFCAAQHSAPQ
Ovis aries musimon V164 trdv CBYI010125300.1 942 SGVAQKVIQDQPDISSQLGQSVTLNCRYATTWSSYYLFWYKLLPSGEMIYLIRQVSSGQNARNGRYSVNFQKARKSISLTISDLQLEDSAEYFCALWE
Ovis aries musimon V165 iglv CBYI010125789.1 2495 SWAQAVLTQLSSVSGSLGQRVSITCSGSSSNVGRYGVGWFQQLPGSGLRTVIYGTSSRPSGVPDRFSGSRSGNTATLTISSLQAEDEADYYCAAGDSSSYN