WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Panthera pardus LQGZ00000000.1 (LQGZ01) 149 12 42 10 45 23 11 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Panthera pardus V0 igkv LQGZ01002945.1 5732 ARGAITMTQSPGSLAGSPGQQVTMNCRASQSVSSYLAWYQQKPGQRPKLLIYSASTRASGVPDRFSGSGSGTDFTLTISNLQAEDVASYYCQQYHSSP
Panthera pardus V2 trgv LQGZ01061162.1 11757 GVAAINVEQPAVVVARAGSWATLPCKTSASVSYIHWYRHQQGTAPKRILMLDMSSSYVTRDGVLTADKVHAKKGKDSTSSNLLLLKLAKSDEGMYYCAVWEEQ
Panthera pardus V3 trgv LQGZ01061164.1 4802 GVAAIRLTQQAVVVERMGGLATLSCQANVYVSYIHWYLHQEGTAPKRILMLDMSRLHVQKYGDKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Panthera pardus V4 trgv LQGZ01061165.1 48017 SWAAISLEQPSMVVAQAGRSATLWCKASTKVSYIHWYHHQEGAAPKRLLRLDMSGTFVQRDGGLKADKVNAKRGKGSNSCDLSVLKLEKSDEGVYYCSAWE
Panthera pardus V5 trgv LQGZ01061184.1 4348 GVAAISVEQPAVVVARAGSWATLPCKTSASVSYLHWYRHQEGTAPKRILMLDMSSSHVISDGVLTVDKVHAKKGKDSTSSNLLLLKLAKSDEGVYYCAVWEEQ
Panthera pardus V6 trgv LQGZ01061185.1 3565 GLAAISLTQQAVAMGRVGSSATLSCQARASISYIHWYLHQEGTDPKRILMLDMSRLHVQRYGGLEVDKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Panthera pardus V7 trgv LQGZ01061185.1 13968 GLGQGKLEQPEISISRARGKSAHISCKMSTEVINGAIHWYRQKPDQEIEHLTLVSTHPVRVSLGGKSDKLEASKNAHASTATLKINFLEQKDEAVYFCAYWDW
Panthera pardus V8 trgv LQGZ01061186.1 135 GLGQGKLEQPEISISRARGKSAHISCKMSTEVINRAIHWYRQKPDQEIEHLTLVSTHPVRVSLGGKSDKLEASKNAHASTATLKINFLEQKDEAVYFCAYWDW
Panthera pardus V9 trbv LQGZ01067219.1 312 PVDTAVTQTPKHLVAPTGSKGTLKCEQRLGHNAMYWYKQSAQRPPKLMFAYSYKELAENDSVPSRFTPECSDSSHLHLHVAALQPEDSAVYLCASSE
Panthera pardus V10 trbv LQGZ01067220.1 7780 PLDTAVSQTPKYLIAQMGTEKFLQCEQKLSHDAMYWYKQDSKKLLKIMFAYNNKELIHNETVPRRFSPESPDKARLNLRVSALETGDSAVYLCASS
Panthera pardus V11 trbv LQGZ01067221.1 654 PGDTAVTQTPKHLVAATGSKGTLKCEQRLGHNAMYWYKQSAQRPPKLMFAYSYKELAENDSVPSRFTPECSDSSHLHLHVAALQPEDSAVYLCASSE
Panthera pardus V12 trbv LQGZ01067224.1 1747 PVDSGLTQTPRHLVKARGQQVTLSCFPISGHLSLYWYQQAVGQGPQLLIQYYNREERGRGNFPERFLAQQFPDSHSELNMSSLELTDSALYLCASSP
Panthera pardus V13 trbv LQGZ01067224.1 6377 PVNAGITQTPRFQILGTGQNMTLRCEQDKDHDYMPWYRQDPGHGLRLIHYSVSAGITERGEISNGYNVSRSNTKNFPLTLASATPSQTSVYFCASSD
Panthera pardus V14 trbv LQGZ01067226.1 6286 PMEAGVTQTPRYLIKARGQQGTLRCSPISGHSSVSWYQQALNQGPQIIFEFFEYTQRTKGNFPDRFSGQQFQDYISELHVSSLEPTDSAMYLCASSL
Panthera pardus V15 trbv LQGZ01067227.1 3134 HTGAGVLQSPRHKVTKRGRDVDLRCDPISGHAGLYWYRQAVGRGPEFLISFQNKDKVDSSGMPSNDRFQVDRPEGSYSILQIQRVEPGDSAVYLCASSP
Panthera pardus V16 trbv LQGZ01067227.1 9984 PAGAGVTQSPRHLVKGSGGKAVLKCRPMSGHRSVSWYQQAPGQGPQFLIELFDQETREKGNLPSRFSVEQFSDYSSQLNMSSLELGDSASYLCASSL
Panthera pardus V17 trbv LQGZ01067228.1 3155 PMDAEITQNPRYKVTGTGKRVTLKCDQTENYDYMYWYRQDPGHGLKLIYYSNGFDSINRGDVPDGYTVSRKNMENFPLVLESATSSQTSVYFCANSY
Panthera pardus V18 trbv LQGZ01067228.1 15171 PTDAGVTQTPRHQVTTKGQTVTLRCEPISGHASLYWYRQTSGQGLKQLVYFNNQVSIDDSGMPSDRFSAKMREKSSSTLEIQRTEPGDSATYLCASSL
Panthera pardus V19 trbv LQGZ01067229.1 2801 PTDARVTQTPRHKVAMMGQTITLRCEPISGHEVLFWYRQTSVQGLKLLIHFNNQATIDDLGMPNGGFSAKMPDRSFSTLEIQGTEPGDSATYLCASSK
Panthera pardus V20 trbv LQGZ01067229.1 9914 HTGARVIQSPRYQVTGIGKQASLSCSQNLNHDAMYWYQQKPNQAPKLLLYYYDSNLYTEKDTSDNFKASRTNSSFCSLDILLAGFEDTAVYLCASSK
Panthera pardus V21 trbv LQGZ01067229.1 26378 PMNAGVTQNPEHLVRGTGQEATLRCSPEKEHDYVYWYQQLPGEGLKFMVYLQKENIIDDSGMPTKRFSAEFPKEGPSVLKIRLAELGDSAVYFCASSL
Panthera pardus V22 trbv LQGZ01067229.1 32829 GSGLGALVSQDPRTAVCKSGTSVMIKCHSVGIQATTVFWYRQFPEQGLTLMATSNVDSKAAYEQGFSETEFSISHPNTTFSSLTVMSVKPADSSLYFCSAS
Panthera pardus V23 trbv LQGZ01067229.1 40047 SMDTQVTQSPRYLVRGKKQTAKMNCIPVKGHSYVYWYRQKLEEFKFLVYLQDENILDKIEKFEDQFLAQCPKNSPCSLEIKSTEPGDSALYFCASSE
Panthera pardus V24 trbv LQGZ01067230.1 10234 SVDAGITQTPRNGIIETGKSIVLECSQTMDHAYMYWYRQDPELRLQLVYLSYGTNNINKGEVSNGYSASRKEREKFSLFLETAIPKQTALYFCATRD
Panthera pardus V25 trbv LQGZ01067233.1 3428 LVDASVSQTPRHYVSGTGKKITLECSQTMGHENMYWYRQDPGKALQLIHYSYGINTTEEVEASSGSTVSRIRKEHFPLTLESTSPSQTSLYFCASNE
Panthera pardus V26 trbv LQGZ01067234.1 1569 LKDAVVTQFPRHKILGTGKKLILQCTQDMNHFSMYWYRQDPGSGLQLIYYSTGTEAFEKGDVPEGYHVSRNELPNFPLTLDSASANQTSVYFCASSL
Panthera pardus V27 trbv LQGZ01067234.1 10873 PMVARVTQTPRHVITGTGKQLTVRCSQDMNHDAMYWYRQDPGLGLKVIYYSRNVDFIEKGDVPDGYAVSRKEERNFPLTLESTSTSQTPLYLCASSKSS
Panthera pardus V28 trbv LQGZ01067235.1 9416 FVDTQGTQTPRYLIEKVGMKVLMECLQNMDHERTYWYRQDPGLGLQLLHRSYNIDSTEKGDAPDGYRVSRKKKNTFPLTLDSASTNQTSVYLCASSK
Panthera pardus V29 trbv LQGZ01067235.1 17007 TVFSALLSRKPHRDICQRGTSVTIHCEVDIQFTLMFWYHQLPGQSLVLMATTNQGLEATYEHGFTKDKFPISRPTLVFSTMTISNVSLEDSSFYFCSAG
Panthera pardus V30 iglv LQGZ01118921.1 8824 SWAQSVLIQPPSVSGALGQTVTISCAGGANNIGIVGVIWYQQLPGKAPKFLISANSIQPSEVSGRFSGSMSGNTGSLTITGLQAEDEADYYCQSIDMTQGA
Panthera pardus V31 iglv LQGZ01118922.1 6134 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGSNYVSWYQQLPGTTPKTIIYRDNSRPSGVPERFSGSKSGSTGTLTITGLQAEDEADYYCSAWDDSLR
Panthera pardus V32 iglv LQGZ01118922.1 48168 ATSQEVVTQETSLSTTPGGTVTLTCGSSTGAVTTSNYATWVQQKPYQRFQGLRGETSYRNPGVPARFSGSLVGQKAVLTITGAQSEDEAEYYCVLWFSNH
Panthera pardus V34 iglv LQGZ01118928.1 3504 SWAQSALNQPPSVSGDLGRTVTISCAGTSNDIGRYNYVSWYQQLEGTSPKLLIYNVNSRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYASSNT
Panthera pardus V35 iglv LQGZ01118928.1 11393 SMASYMLTQPPSVSMNLGKTARITCGGNNIGSKYAYWYQQKPGRAPMMIIYDDSKRSSRTPDRFSGTNSGNTATLTISGAQAEDEANYYCQVWGGSSD
Panthera pardus V36 iglv LQGZ01118929.1 499 SMASYMLTQPPSVSMNLGKTARITCGGNNIGSKYAYWYQQKPGRAPMMIIYDDSKRSSRTPDRFSGTNSGNTATLTISGAQAEDEANYYCQVWGGSSD
Panthera pardus V37 iglv LQGZ01118931.1 27919 SVASYVLTQPPSVSVNLGQTARITCGGNNIGNKYAYWHQQKSGQAPVLIIYKDSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCEVWDSDN
Panthera pardus V38 iglv LQGZ01118931.1 47934 CPDSVSLSVWALGQTITISCSGSNNDIQGYKDVPWYQQLSATSPKLLFYHVHSQASGIPDRFSGSKSGNTATLTISGLQAEDKADYYCCLYTDS
Panthera pardus V39 iglv LQGZ01118931.1 62430 SWAQSALNQPPSVSGDLGRTVTISCAGTSNDIGRYNDISWYQQLEGTSPRLLVYSVNSRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYHCSSYAGSSI
Panthera pardus V40 iglv LQGZ01118932.1 6770 SVAASELTQPPAVSVALGQTARITCEAGSFESSIINWYQQKPGQAPVLVIYEDSEQPTGIPNRFSGSSSGDAATLTITGAQAEDEADYYCQSYDNSGD
Panthera pardus V41 iglv LQGZ01118933.1 3171 SVASYELTQPPSVSVNLGQTARITCGGNNIGSKYAYWYQQKSGQAPVLIIYKDSERPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCQSYESNYD
Panthera pardus V42 iglv LQGZ01118936.1 4343 SVASYVLTQPPSVSVNLGQTARITCGGNNIGNKYAYWHQQKSGQAPVLIIYKDSERPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDDSDN
Panthera pardus V43 iglv LQGZ01118936.1 14440 SVASYELTQPPSVSVNLAQTARITCGGNNIGSNYAYWYQQKSGQAPVLIIYNDSNRPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCQSYESNYD
Panthera pardus V44 iglv LQGZ01118936.1 29868 SVASYVLTQPPSVSVSLGQTARITCGGNNIESKSVQWYQQKSGQTPVLIIYKDSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDSSSD
Panthera pardus V45 iglv LQGZ01118937.1 12745 SVTSNRLTQPPSISVALGEMARITCEGNNIGNTYVSWYQQKPNQVPLMIIYWDSNRPSGIPDRFSGSNSGNTATLTVSGARAEDEADYYCLSADSSSN
Panthera pardus V46 iglv LQGZ01118937.1 22410 SMASYMLTQSPSILVTLTQTARITCRGNNSGSKSVYWCQQKPGQAPMLVICYGRNRPSRTPDRFSGTNSGNTATLIISGAQTEDEADYYCQVWDSGN
Panthera pardus V47 iglv LQGZ01118939.1 13030 SMASYVLTQPPSVSVNLGQTARITCGGNNIGSKNAYWYQQKPGQAPMLVIYYSSNRPSGIPDRFSDTNSGNTATLTISGAQAEDEADYYCKVWDGSSD
Panthera pardus V48 trav LQGZ01189933.1 8710 GTRAQSVTQPDVHITVSEGAPLELRCNYSSSVQVYLFWYVQHPNQGLRLLLKYISGDILVKGTKGFEAEFRKSEKAFHLRKPAVQWSDAAKYFCAVS
Panthera pardus V49 trav LQGZ01189933.1 13956 TLGLAKITQPVFIESYEGQEVNIPCNHTNIATSEYIYWYRQFLNQGPQFVIQGFKTNVENEVASLFISADRTSSTLSLPQAALRDTAVYYCTVSD
Panthera pardus V50 trav LQGZ01189933.1 15685 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVNNVQWFRQNPGGGSLTRLFYIVSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Panthera pardus V51 trav LQGZ01189933.1 22202 MSRGEEVKQHPSFLSVWEGDSFVINCTYTNSASTYFFWYKQEPGKGLQSLIYTLSSMDKKQEQRLTVLLNKKDKHLSLQVTRTHPGDSATYFCAVR
Panthera pardus V52 trav LQGZ01189934.1 1428 VSSQKMEQSPRSLNIQEGEKAVLTCNCTNFSPVVFQWYRQDPGRGLVFLLLIRENESKKQTGRLKATFDKTIKQSSFYITEPQSADSATYLCAA
Panthera pardus V53 trav LQGZ01189936.1 5874 DTSAQSVTQLDGHVTVSEKAHLELRCNYSYGATPNLFWYVQYPNQGLQLLLKYFSGPPNVLVQGIKGFQAEFRKNETSFHLRKHSAHWSDSAKYFCAAS
Panthera pardus V54 trav LQGZ01189936.1 10575 GSKGDSVTQMEGQMTLSERASLTVNCSYETTQYPALFWCVQYPGEGPQLLLKASKANEKGSSKGFEATYHKEPNSFHLKKSSVQVSDSAVYYCALR
Panthera pardus V55 trav LQGZ01189936.1 17303 DTGAQSVTQPDVHVTVSEGAPLELRCNYSYSGTPDLFWYMQHPNQGLQVLLKYFSGDTLVKGIKGFEAEFKNHETTFHLRKSRALGSDAAKYFCAVH
Panthera pardus V56 trav LQGZ01189938.1 1909 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVTNVQWFRQNPGGGGLTRLFYIVSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Panthera pardus V57 trav LQGZ01189938.1 8153 LSRGENVEQSPSTLSVQEGNSSVITCSYSDSVSDYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAAAQPADSAVYFCAAS
Panthera pardus V58 trav LQGZ01189940.1 6481 QTHGDSVTQMEGPVTLSEGESLTINCTYSTAVSPTLFWYVQYPGEGPQLLLKAFRDKEKGSHKGFEATYDGKSKSFHLEKSSVQASDSAVYYCALS
Panthera pardus V59 trav LQGZ01189940.1 31784 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVNNVQWFRQNPGGGGLTRLFYIVSGMKQDGRLNCTVNTKDRQSSLHIRASQQEDSATYLCAVQ
Panthera pardus V60 trav LQGZ01189941.1 13484 QTHGDSVTQMEGPVTLSEGEYLTINCTYSTTGTPTLFWYVQYPREGPQLLLKAFRDTEKGSHKGFEATYNRKSKSFHLEKSSVQVSDSAVYYCALM
Panthera pardus V61 trav LQGZ01189942.1 4688 DTGAQSVTQPDVHVTVSEGAPLELRCNYSYSGTPYLFWYMQHPNQGLQVLLKYFSGDTLVKGIKGFEAEFKNHETTFHLRKSRALGSDEAKYFCAVR
Panthera pardus V62 trav LQGZ01189942.1 14485 GVRGMDVEQTPAALSLQERASSTLKCNFSSSVNNVQWFRQNPGGGGLTRLFYIVSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Panthera pardus V63 trav LQGZ01189942.1 19952 LSRGENVEQSPSTLSVQEGNTSVITCSYSDSASNYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAAAQPADSAVYFCAAS
Panthera pardus V64 trav LQGZ01189942.1 30274 QTHGDSVTQMQGPVTLSEGEPLTINCTYSATGYPNLFWYVQYPGEGPQLLLKALTDKEKGSHKGFEATYDAKSKTFHLVKSLVQASDSAVYYCALS
Panthera pardus V65 trav LQGZ01189942.1 42436 GVRGMDVEQTPAALSLQEGASSTLRCNFSRSVNNVQWFRQNPGGGSLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Panthera pardus V66 trav LQGZ01189942.1 50935 LSRGERVEQSPSTLSVQEGNTSVITCSYSDSASNYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAATQPADSAVYFCAAS
Panthera pardus V67 trav LQGZ01189942.1 55537 SSISQKVTQAPPAMLVQEKEAVILECTYDTSDPNYSLLWYKQPSRGEMIFLVRQDSHNQQNATEGRYSLNFQKARKSIHLVISASQLEDSAVYFCALGS
Panthera pardus V68 trav LQGZ01189943.1 437 RTHGDGDSVTQMQGPVTIPERKSLTINCTYSTTWTPTLFWYVQYPRESPQLLLKALRDKETGSHKGFEATYDSKSKSFHLEKSSVQASDSAVYYCALS
Panthera pardus V69 trav LQGZ01189945.1 1376 VSGKNQVEQHPPSQIIQEGENCTFHCNYTVSPFSHLKWYKQGTGRSPAFLIIMTYDDSKNPSGRYTGTLDATSKHSSLHITAAQLSDSAVYICVVS
Panthera pardus V70 trav LQGZ01189945.1 13560 MRRSHQNEVKQSPVPLTVLEGLTAFLNCSYTDSASQYFVWYRQYSGKGPEFLMHMYSNGEKEEGRFIGLLNKASRYLSLFIRDSQLSDSATYFCAV
Panthera pardus V71 trav LQGZ01189945.1 17514 GTGAQSVTQPDAQVLVSEGARLELKCNYSSSATTYVFWYMQYPNRGLQLLLKYISGDTLVKGINGFEAEFKKSETSFHLRKSPALGSDAAKYFCSVS
Panthera pardus V72 trav LQGZ01189945.1 23114 GTRAQTVTQSEDHLSVFKGDPVQVKCNYSYSGSPVLFWYVQYPKQGLQLLLKHISGGSVKGFTASLNQGEMSFHLKKPSAQEEDSAMYYCALG
Panthera pardus V73 trav LQGZ01189945.1 28194 VNSQQEQDHQTLSIQEGENTTMNCSYKTTINYLQWYKQDSGRGLVLLILIRLNEREKTNGRLRVTLNTSLKSSSLSITASQTADTATYFCATD
Panthera pardus V74 trav LQGZ01189945.1 34425 GINGDSVTQTEGSVTLFEGTPLTLNCTYQSSYTVFVFWYVQHQNKAPQLLLKGLSENQRAEHHGFHASLVKSDSSFHLQKRSVRMSDSAVYYCVLG
Panthera pardus V75 trav LQGZ01189945.1 49450 ASMAQKVTQAQPAISMPEKEAVTLDCVYEASGYTYYLFWYKQPPSGEMILLIYQDSYSEQNATEGRYSLNFQKPDRSISLTITGLQLRDSAVYFCALR
Panthera pardus V76 trav LQGZ01189945.1 63422 LHGEDRVKQSPQTLRLREGDNVSLNCSYTISLFTGLQWLRQNPGKGPELLFLLYSVNEEKQKERLKATVLKQGSSLHITASKPEDSATYLCAVE
Panthera pardus V77 trav LQGZ01189945.1 75791 VGSKQEVMQSPEALNVQEGDSVVLNCSYTGSTFYSLQWFRQDPGEGLTVLLLIQSAQREETSGRIKASLDKPSKHSALYIAASQPSDSATYLCAIR
Panthera pardus V78 trav LQGZ01189947.1 3019 GTGAQSLTQPDGHITVSEGARLELSCNYSSSGTTYLFWYVQHPNQGLQLLLKYSSGPSDALVQGIKGFEAEFKKSEKAFHLRKHSAHWSDSAKYFCAVS
Panthera pardus V79 trav LQGZ01189947.1 8915 VTGLMVKQSPPDLSLQEGLSCTLQCNFSTSVNRVQWFRQNPGGHLIHLFYIPSGTKQNGRLRSTTVVEDRRSLLYISSSSTTDSAIYFCAGAE
Panthera pardus V80 trav LQGZ01189947.1 13904 KSGQEQVKQGPPSLIVQEGAFSTLNCTYENTAFDYFVWYRQYPGQGPALLLAVFSVKHTKEDGRFTVFVSESAKQFSLHIMASQPGDSATYFCAAS
Panthera pardus V81 trav LQGZ01189947.1 28602 VCSVLDVNQYPLSLHVHEGENTNFTCHFPTSSFYSLQWYRWEPAKSPKFLFTIALNGDEKEEGRVKVTLDTKKGSSSLYIKGSQPEDAATYICALT
Panthera pardus V82 trav LQGZ01189947.1 36688 VNGQEIKQIPQFLLLQEGENFTIYCNSSRTLNSLQWYKQRPGGSPVLLITLVKSGDVKQKRLTAWFGDTRKNSLLHMVATETADSGVYFCTGAQCSQ
Panthera pardus V83 trav LQGZ01189947.1 39061 GMGAQSVTQPDAQVLVSEGARLELKCNYSSRGTTYVFWYVQYPNRGLQLLLKYISGDTLVKGLNGFEAEFKKSETSFHLRKSPALGSDAAEYFCAVS
Panthera pardus V84 trav LQGZ01189950.1 777 KSTQQLEQSPRFLSIQEGENFTAYCNSTSTFTSFQWYRQKPGEGPVHLMTLSRRGEIKKQKSLVAQFGEARKDSSLFIIAAQAEDAAIYICAG
Panthera pardus V85 trav LQGZ01189951.1 2062 VNSQQNADQQQVKQTPSLSVQEREISILNCDYNNNMFDYFIWYKKYPAKSLEFVISIRSIVDKKEDERFTVYLNESAKHLSLHIAASQPGDSALYFCAAN
Panthera pardus V86 trav LQGZ01189951.1 23396 IMSDAKTTQPNAMESTEEEPLRLPCNHSTISGSEYIYWYRQIPHHGPEYLIHGLKDNVTNGMASLTIAKDRKSSTLILPRVTLRDAAVYYCITR
Panthera pardus V87 trav LQGZ01189952.1 5334 VSSQELEQSPRSLIIQEGEDFTINCSSSKTLYTLGWYRQKNGEGLSSLMMLQKSGEEKSHEKITAKLDEKKQQTSLHITASQPSHSGIYLCAGD
Panthera pardus V89 trav LQGZ01189953.1 345 VSSEDKVIQSPPSLVVQEEDSATLNCSYQVTNFQSLLWFQQQENAPTFLFRQISNGIQKSGRLKGTLDKKALLSTLHITATQLRDSATYLCAVE
Panthera pardus V90 trav LQGZ01189954.1 14414 SSMAQKVTQTQPEMSVHEAETVTLDCTFDTRVSNYYLSWYKQPPSGEMVLIIRQEANKQENATNNRFSVNFQKADKSFSLRISAAQLGDAAMYLCALME
Panthera pardus V91 trav LQGZ01189954.1 21822 SSMAQKVTQTQPEMSVHEAETVTLDCTFDTSDSNYYLFWYKQPPSREMVLIIRQEANKQENATNNRFSVNFQKADKSFSLRISAAQLGDAAMYLCALME
Panthera pardus V92 trav LQGZ01189957.1 601 ASGKNGVEQSPQSLTAQEGNFVTINCSFSVGMTALHWLQQNPGGGIVSLFILSLEMKKKGRIRATINTEELHSSLYITASQPRDSAIYLCAVE
Panthera pardus V93 trdv LQGZ01189960.1 7023 SSNTQSVTQTPGTVNKQEGESVTLHCSFTLSYTYYVMSWFRQLPNGKMTEIINLYSTSTNTKKGRYSVSHQKGNKALSLTITGLMPTDSGVYFCAVGEA
Panthera pardus V94 trdv LQGZ01189960.1 21856 SSNTQSITQSPSSVQEKEGESVTLDCRFTLNFDYYVMSWYQQLSNGKMTEIIYLVSTSTNTRKGRYSVSHWARDKTLRLTITGLMPTDSGIYFCAVREA
Panthera pardus V95 trdv LQGZ01189960.1 34425 SSNTQSITQSPSSVHKQEGESANLFCRFTLSYTYYVMSWFQQPSNGKMTEIIYLYSDSTNTKKGRYSVSYQARDKALRLTITGLMPTDSGVYFCAVGEA
Panthera pardus V96 trdv LQGZ01189961.1 342 SSNTQSITQSPSSVHKQEGESANLFCRFTLSYTYYVMSWFQQPSNGKMTEIIYLYSDSTNTKKGRYSVSYQARDKALRLTITGLMPTDSGVYFCAVGEA
Panthera pardus V97 trdv LQGZ01189963.1 5293 SSNTQGITQSPSLVQEKEGESVTLNCRFTLSYTYYVMKWYQQLSNRKMTEIIYLYSASTNTRTGRYSVSHQKGNKAVSLTITGLMPTDSGIYFCAVAEA
Panthera pardus V98 trav LQGZ01189969.1 5253 GSCKTEIIQSSNITAIIGTDVEFPCQYNIPDKNFESVYWYLQRADQRFTYIGHTSQGTVELEHYQLFVNRKLLSSTLTIKHVQPRDKAIYYCAV
Panthera pardus V99 ighv LQGZ01213592.1 8672 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMHWVRQAPGKGLQWVASIYSDGSSTYYADSVKGRFTISRDNAKNTLYLQMNNLKTEDTATYYCAK
Panthera pardus V100 ighv LQGZ01213593.1 7554 VLSQLTLRESGPGLVKPSQSLSLTCIVSGGSVTSSYYWNWIRQRPGRGLEWLGYWSGSTSYNPAFQGRISITADTAQNQFSLQLSSMTTEDTAVYYCAR
Panthera pardus V101 iglv LQGZ01214041.1 20600 SWTQSVVTQPSEVSKPVNKSVTISCTGSSSNVGAGGVSWYQQLPGSVPKVLIYGSSARPAGVPSRFTGSRSGNVASLSISSLQAEDEADYYCSVW
Panthera pardus V102 iglv LQGZ01214042.1 19138 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGSNYVNWYQQLSGTVPKLLIYRNSNRPSGIPDRFSGSKSGSTGTLTITGLQAEDEADYYCSTWDNSLS
Panthera pardus V103 iglv LQGZ01214043.1 465 SLSQPVVTQPASLSTSLGATARFTCTLSRDINVGSYYIYWYQQNPGSPPRYLLYYYSDSSTQLGPGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Panthera pardus V104 iglv LQGZ01214295.1 17840 SWARPTLTQEASMSGSVGQKVTLTCTGNSNNVGSYYVGWYQQISHGVPKTVMLRNTRPSGIPARFSGSDSGNTASLIISGLQPEDEADYYCSTWDKSIKA
Panthera pardus V105 iglv LQGZ01214317.1 12202 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVGWYQQIPGMAPKAIIYDNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDNSVK
Panthera pardus V106 iglv LQGZ01214317.1 16541 SWAQSGLNQPFSVSGALGQRVTISCTGVGSYVGWYQQIPGMAPKAIIDGNNNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDSSLSA
Panthera pardus V107 iglv LQGZ01214317.1 21979 IWAQSGLTQPSSVSGALGQRVTISCTGVGSYVYWYQQIPGMAPRTIIYGNRNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDSSLSA
Panthera pardus V108 iglv LQGZ01214400.1 2016 CADSATLSVWGLGQKVTISCTGSRSNIGIAGVNWYQQLPGKAPKLLMYGSSDRLSGVPDRFSGSTSGNTGSLTITGLQAEDEADYYCLSVDVTQGA
Panthera pardus V109 iglv LQGZ01214401.1 9329 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGGNYVNWYQQLSGTAPKLLIYRNSNRPSGVSDRFSGSTSGSTGTLTITGLQAEDEADYYCLSADIIQRT
Panthera pardus V110 iglv LQGZ01214402.1 6228 SWAQSLLTQPSSVSGSLGQRVTISCTGSSSNIGSNYVSWYQQLPGTTPKTIIYWDNSRPSGVPERFSGSKSGITGTLTITGLQAEDEADYYCSAWDGGLK
Panthera pardus V111 ighv LQGZ01214521.1 677 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYAMGWVRQAPGKGLQWVAEISSGGSTYYADSVKGRFTISRDNAKNTLYLQMNNLKTDDTATYYCAK
Panthera pardus V112 ighv LQGZ01214546.1 1177 VQCDVQLVESGGDLVQPGGSLRLTCVASGFTFSSYAMGWVRQAPGKGLQWVAGIYTDGSSTNYADSVKGRFTISRDNAKNTLYLQMNNLKTEDTATYYCAK
Panthera pardus V113 iglv LQGZ01214726.1 5442 SWAQSVLTQPPSVSGALGQTVIISCAGSANIGIAGVNWYQQLPGKAPKLLIYDSSDRPSGVPDRFSGSSSGNTGFLTITGLQAEDEADYYCQSVDITQGA
Panthera pardus V114 ighv LQGZ01214921.1 2863 VHSQVLLVQSGAELRKPGASVKIFCKVSGYSFTDYYIHWVRQAPAQGLEWMGSIDPEDDSTSYAQKFQGRLTLTADTSTNTAYMELSSQRSADTAMYYCAR
Panthera pardus V115 ighv LQGZ01214921.1 15126 VLCDEQLVESGGDLVKPGGSLRLTCVASGFTFSSYAMSWVRQAPGKGLQWVAYIYDDGSSTDYADSVKGRFTISIDNAKNTLYLQMNSLKTEDTATYYCAR
Panthera pardus V116 iglv LQGZ01215009.1 810 IWAQSGLTQPSSVSGALGQRVTISCTGVGSYVYWYQQIPGMAPKTIIYRNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWYSSGSA
Panthera pardus V117 ighv LQGZ01215055.1 2935 VHSQVLLVQSGAELRKPGASVKIFCKVSGYSFTDYYIHWVRQAPAQGLEWMGSIDPEDGATSYAQKFQGRLTLTADTSTNTAYMELSSLRSADTAMYYCAR
Panthera pardus V118 iglv LQGZ01215745.1 111 SWAQSVLTQPSSVSGSLGQRVTISCTGSSSHISSNFVSWYQKLLGKTPKTIILWDDSRPSGVPERFSGSKSGSTGTLTITRLQAEDEADYYCSAWDDSLR
Panthera pardus V119 iglv LQGZ01218823.1 215 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVGWYQQIPGMAPKTIIYEDSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCLSWYSSGS
Panthera pardus V120 ighv LQGZ01220588.1 543 VLCDEQLEESGGDLVKPGGSLRLTCVASGFTFSIYSMHWVRQAPGKGLQWVARIYADGSSTNYADSVKGRFTISRDNAKNTLYLQMKNLKPEDMATYYCAR
Panthera pardus V121 trgv LQGZ01221365.1 47 GVAAIRLTQQAVVVERMGGLATLSCQANVYVSYIHWYLHQEGTAPKRILMLDMSRLHVQKYGDKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Panthera pardus V122 trbv LQGZ01225327.1 231 HTGAGVLQSPRHKVTKRGRDVDLRCDPISGHAGLYWYRQAVGRGPEFLISFQNKDKVDSSGMPSNDRFQVDRPEGSYSILQIQRVEPGDSAVYLCASSP
Panthera pardus V123 igkv LQGZ01002948.1 6622 SSGDVVMTQSPLSLPITPGEPASISCRASQSLLHSNGNTYLSWYLQKPGQSPRLLIYKVSNRDSGVPDRFSGSGSGTDFTLRISRVEADDIGVYYCYQS
Panthera pardus V124 igkv LQGZ01002951.1 29356 ASCEIQMTQSPSSLSASPGDRVTITCRASQNVNTWLAWYQQKPGKVPKLLIYHASTLQTGVPPRFSGSGSGTDFTLTISSLEPEDAATYYCQQHNSG
Panthera pardus V125 igkv LQGZ01002951.1 24456 SSGDVVMTQSPLSLPITPGEPASISCRASQSLLHSNGNTYLSWYLQKPGQSPRLLIYRVSNRASGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCLQG
Panthera pardus V126 igkv LQGZ01002951.1 10381 SSGEVVLTQSPAFLSRTLKEKATITCRANQGISTNLHWYQQKPNQAPKLLVKYASQSISGVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQSNNLP
Panthera pardus V127 igkv LQGZ01002952.1 19493 SGADVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLHWYLQKPGQSPRLLIYKVSNRASGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQSTKKP
Panthera pardus V128 igkv LQGZ01002952.1 7095 SSGDIVMTQTPLSLPITPGEPASISCRASQSLLHSNGNTYLSWYLQKPGQSPRLLIYKVSNRASGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCGQALQYP
Panthera pardus V129 igkv LQGZ01002954.1 2581 AGGTAELTQSPTHLSVSLKDSVSIICRANESVSDYLSWYQQKPGQPPKLIIYDADNLESGVSDRFSGIQSGTEFILKISTVEADDTAAYYCQHDYALP
Panthera pardus V130 igkv LQGZ01002958.1 9715 SGGWHVLTQAPETLAASRDSFVSITCRSSTEVGTSMAWYQQKPNEAPRLLIFGASARAAGTPSRFRGSGSGSDFSLTIHGVEAEDIGIYYCQ
Panthera pardus V131 igkv LQGZ01002958.1 1278 ASCEIQMTQSPSSLSASPGGRVTITCRASQNVNTWLAWYQQKPGKVPKLLIYRASTLQTGVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQSNNFP
Panthera pardus V132 trgv LQGZ01061172.1 1649 GLAETRLEQPALIMKRTGSSAILSCRARTKVSYIHWYRHQEGKAVQRLLIVALYRSYVQTDSILKGDKVTAKRGTDGSSCNLLLQKLEKSDEGVYYCAAWE
Panthera pardus V133 trgv LQGZ01061178.1 11495 TNGGIFITQFIPSITKKKGNTAFLECQVKTGVLKKNVNIHWYRQRPDQPLKRILYISSNENVVHEQGVSEEKYEARKRQRDLPASLRIHKISEDDAGLYYCACWD
Panthera pardus V134 trgv LQGZ01061181.1 367 GLGQGKLEQPEISISRARGKSAHISCKMSTEVINGDIHWYRQKPDQEIEHLTLVSTHPVQVSLGGKSDKLEASKNAHTSTATLKINFLEQEDEAVYFCACWDW
Panthera pardus V135 trbv LQGZ01067242.1 15077 VSAQTIHQWPPVKVQLVGSPLSLECIVKGESNPYLYWYRQAEGGPPQLLFRSLNIGQVDPEAPRNFTASRPQDGQFILSSQKLLLSDSGFYLCAWS
Panthera pardus V138 trdv LQGZ01189977.1 1535 RGVLCDQVTQSPPYQTVASGSKVTLFCTYHTTYSNPDLYWYRIRPDRSFQFILYRDNTRSKDADFTQGRFWVWHSQSQKTFHLVISVEPEDSATYYCAIY
Panthera pardus V139 iglv LQGZ01214383.1 23573 SQSQPVVTQPASLSASLGATARFTCTLSRDINVGGYYIYWYQQNPGSPPRYLLYYYSDSSTQLGPGVPSRFSGSKDASANSGLLLISGLQPEDEADYYCAI
Panthera pardus V140 iglv LQGZ01214384.1 12527 SRAQSELTQPPSVSGDLGQIVTISCAGSANNIGIVGVNWYQQLPGKAPKLLISANSNKPSGVSGRFSGSASGNTASLTITGLQAEDEADYYCMSADSVESA
Panthera pardus V141 iglv LQGZ01214489.1 36353 SWAQSVLTQPPSVSGGLGQTVTISCIGSANNIGIVGVNWFQQLPGKAPKLIYANDRRPSSVLDKFSGSTSGNTGSLTITGLQAKDEADYYCMSADSVESA
Panthera pardus V142 iglv LQGZ01214489.1 19287 SWAQSVLTQPPSVSGALGQTVTISCAGSANNIGRIGVNWYQQLPGKAPKLLIYANNRRPSSVPDRFSGSKSGNTGSLTITGLQAEDEADYYCLSADITQGA
Panthera pardus V143 iglv LQGZ01214489.1 8563 SWAQSLLTQPSSVSGSLGQRVTISCTGSSSNIGSNYVSWYQQLPGTTPKTIIYWDNSRPSGVPERFSGSKSGITGTLTITGLQAEDEADYYCSAWDGGLK
Panthera pardus V144 iglv LQGZ01214731.1 11947 SWAQSGLTQPSPVSGALGQRVTISCTGVGSYVDWYQQIPGMTPKTIIYGNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDNSLN
Panthera pardus V145 iglv LQGZ01214737.1 7284 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVGWYQQIPGMAPKTIIYNNNNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWYSSGSA
Panthera pardus V146 iglv LQGZ01214737.1 1443 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVDWYQQIPGMAPKTIIYSNSNRPSGVPDRFSGSKSGSTGTLTITRLQAEDEADYYCSSWDSSGSA
Panthera pardus V147 ighv LQGZ01214844.1 9731 VHSQVLLVQSGAEVRKPGASVKIFCKASGYSFIDYYMHWVRQAPAQGFEWMGRIDPEDGSTSYAQKFQGRLTLTADTSTNTAYMELSSLRSADTAMYYCAR
Panthera pardus V148 ighv LQGZ01214844.1 560 VQCDEQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMHWVRQAPGKGLQRVAYIRYDGSSTSYTDSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Panthera pardus V149 iglv LQGZ01215031.1 3652 SWAQSVLTQLPSVSGALGQTVTISCAASANNIGIVGVNWYQQIPGKAPKLLIYANNRRPSSVPDRFSGSKSGNTGSLTITGLQAEDEADYYCQPLDITQGA
Panthera pardus V150 iglv LQGZ01215070.1 1508 IWAQSGPNQTSSVSGALGQRVTISCTGVGSDVGWYQQIPGMAPKTIIYRNSNRPSGVPDRFSGSKSGSTGTLTINGLQAEDEADYYCSSWYSSGSA
Panthera pardus V151 ighv LQGZ01215318.1 4388 VHSQVLLVESGAEVRKPGASVKIFCKASGHSFTDYYMYWVRQAPAQGPEWMGSIDPEDGATSYAQKFQGRLTLTADTSTNTAYMELSSLRSADTAMYYCAR
Panthera pardus V152 iglv LQGZ01215340.1 2505 SWAQSVLTQPPSVSGALGQTVTISCAGSANNIGIAGVNWYQQLPGKAPKLPIYDSSDRPSGVPDRFSGSSSGNTGFLTITGLQAEDEADYYCQSVDITQGA
Panthera pardus V153 ighv LQGZ01215783.1 1474 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSRYWMYWIRQAPGKGLQWVAYIKYDGSSTDYTDSVKGRFTISRDNAKNTLYLQMNNLKTEDTATYYCAK