WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Phodopus sungorus MCBN000000000.1 (MCBN01) 89 25 1 25 12 19 3 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Phodopus sungorus V0 trbv MCBN010342858.1 28 HTDAGVIQTPRHEVAEKGQTVTLRCEPISGHNDLFWYRQTKGLELLSYFRSQSLMEGDKTRKDRFTAEMPNSSVSTLKIQPTEPQDSAVYLCASSL
Phodopus sungorus V1 trav MCBN010459049.1 127 RVRGVEVEQSPSILILHEGTSSTLTCKFSTAMNTVQWFQQNPRGSFTNLFYLAQETKKNGRLTAAFNFKERNSTLHIRDAQLEDSGTYLCAGD
Phodopus sungorus V2 trdv MCBN010489291.1 121 SSLCKKVTQVQLMTSTQEGEEVNLNCSYETSQKVYHLFWYKQLLSGEMIFLIRQISSSTQTERSNLYSVIFQKSAKSFSLVISASQIEDSVTYFCVLWER
Phodopus sungorus V3 igkv MCBN010628165.1 155 SRADIVLTQSPATKAVSQGEKITITCSASSSVSTNRLHWYQQKPGDAPKLLIYGTSNLASGVPTRFSGSGSGTSYSLTISSIEAEDVATYYCQQTNSYPY
Phodopus sungorus V5 trbv MCBN010813309.1 53 PTNAGVIQTPRYKVTEKEQAATLKCEPIKGHDSVFWYKQTTVRGMEFLISFRNQAPIDDREMPKERFSATMPNETLSILKIQTTQPQDSAVYLCASSL
Phodopus sungorus V6 igkv MCBN010882839.1 735 SRGEIALTQSPASKAASQGEKVTITCSASSSAGTSYLHWYQQKPGDAPKLLIYGTSSLASGVPSRFSGSGSGTSYFLTISSMVANDVATYYCQQRYIFP
Phodopus sungorus V7 trbv MCBN010887670.1 327 SLDGQVIQTPRHLFKGKGEKAKMSCSPGNGHTFVYWYQQKQNKELKFLISFQRQEVRERTDLVKERFLAECPSDLPCSLEIQSPNTGDSALYLCASSL
Phodopus sungorus V8 ighv MCBN010947672.1 899 VHSQVQLQQSGAELVKPGSSVKLSCKASGYSFSSYYMNWVKQKHGQGLEWIGRIDPGDDDTDYNQRFKGKATLTADKSSSTAYMELNRLTSEDSAVYYCA
Phodopus sungorus V9 trbv MCBN011026036.1 786 SMDTGVIQNPRYLVKGKQQKAKMNCTRIKGHIYTYWYYKKLGEELRFLVYFQNADIVDKTDKIDKNISAKCPPDFPCTLEIQSSELADSAVYFCASSL
Phodopus sungorus V10 igkv MCBN011057589.1 1115 TRCDIQVTQSPSLLSASPGDKVTITCLASQDISYYLSWYQQKPGQSPTLLIYGGNDLQSGVPSRFSGQYSGRSFTLSISSLEPEDAGTYYCLQYKST
Phodopus sungorus V11 ighv MCBN011067462.1 341 VLCQVKLEESGGGLVQPGRSLRLSCAASGFTFSDYWMSWFRQTPEMALKWIGEIKYDGSTTNYAPSLKDRFTISRDNAKNTLYLQMNNLKSEDTATYYCAR
Phodopus sungorus V12 ighv MCBN011105756.1 1347 VQCEVQLVESGGGLVQPGKSLKLSCAASGFTFSDFDMIWVRQAPGKGLEWVAYISNSGYTIHYAEAVKGRFTISTENSKNTLYLQMNNLKSEDSATYYCAR
Phodopus sungorus V13 trdv MCBN011179029.1 801 ASMAQKVTQAQTSISVMEKKTVTLDCVYETRESTYYLFWYKQTASEKMVFLIRQESYKKENATEGRYSLNFQNTESSIRLIITAAEIEDSAVYFCAMRE
Phodopus sungorus V14 ighv MCBN011182432.1 1718 VHSQVQLMQSGPHLVKSGSSVKLSCKMSGYTFTDFEMYWVKQKPGQGLEWIGWIDPENGDSKYSQKFQGKATFTEDTSSSTVYMELSGLTSEDSAVYYCAR
Phodopus sungorus V16 ighv MCBN011243926.1 1684 GQCEVKLVESGGGLVQPGASLKLSCAASGFTFSDFYMNWIRQPPGKGLEWIAVSRNKDNSYTAEYSASVNGRFTISRDNSKSILYLQMDSMKHDDTATYYCAKV
Phodopus sungorus V17 igkv MCBN011273683.1 1213 SYSENILTQSPASMATSQGEKVTITCSAGSSVSSNYFYWYQQKPGASPKLLVYSTSKLASGVPARFSGSGSETTYTLTISSMEAEDAAIYYCLQKSS
Phodopus sungorus V18 trdv MCBN011282553.1 194 SNFGQKVTQVQSMANAQEGEEVNMDCSYETSQNFYHLFWYKQLLSGEMVFLVRQISSSTQTERSDRYSVIFQKAAKSFTLVISASQIQDSVMYFCALWEG
Phodopus sungorus V19 ighv MCBN011292600.1 1642 VQCEGYLVYSGGGLVQPGGSLKLSCAASGFTFTKGWMKWVRQSLGKGLEWVADINGDSSASRYVPSVKGRFTISRDDAKNTLYLQMNNLKSEDTAVYYCAS
Phodopus sungorus V20 igkv MCBN011303578.1 2081 SRGDVVMTQTPLSLPVNLGDQASISCKSSQSVVHSNGHTYLEWYLQKPGQPPQLLIYGVSNRLSGVPDRFSGSGAKTDFTLKISRVEPEDLGIYYCFQG
Phodopus sungorus V21 igkv MCBN011307412.1 2563 TRCDIQMTQSPSSLSASLGDRVTITCKASQGINIYLMWLQQKPGKVHKNLIYGASNLEDGVPSRFSGSWSGTDYSLTISNLEPEDAAIYYCLQYDKVP
Phodopus sungorus V22 ighv MCBN011330994.1 1925 IQTQIQLVQSGAELRQPRQSVKISCKASGYNFTEHGMQWVKQAPGQGLKWMGRIYTNTGNPTYAEEFKGQTDFSLDTSVSTTFLQISSLKSEDTAMYYCAR
Phodopus sungorus V23 igkv MCBN011339426.1 2926 SLGQILLTQPAASLHVSPGERVSITCRASQSLLYTDGKHYLSWYQQRQGQTIRTFLYHASVRIDGVPARFIGSGSGTEFTLTIEDPQPEDFAVYYCLQ
Phodopus sungorus V24 igkv MCBN011352261.1 2564 SKGEVKLTQSPVYMTASKGEKVTITCRASSSISSNYLHWYQQKPGASPSLLIYSTSYLADGVHGSFIGSGSETSYSLTISCVQDEYAATYYCQQGSSS
Phodopus sungorus V25 trgv MCBN011353790.1 1068 GLGNLEQPAISISRTKDESVQISCKASINSFKSVAIHWYRQKPNQGLEFLLYVIATPTHILLDEKYKKMEASKNSSASTSTLTIYSLEEDDEAIYYCSYG
Phodopus sungorus V27 igkv MCBN011369729.1 2323 CRCDIRMTQTPSSLSASLGDRVSITCKASEDIYTVLSWYQQKPGKAPQLLIYGANNLEDGVPSRFSGSGSGTQYSLTISSLEAEDIGIYYCLQSYDTP
Phodopus sungorus V28 ighv MCBN011393198.1 310 VLSQVQLKESGPGLGQPSQTLSLTCTVSGFSLTINAVHWVRQSPVKGLEWIGAIGKSGNLYYNSILKPRISISRDTSKRQVYLKLNNLQTEDTAIYYCAR
Phodopus sungorus V29 ighv MCBN011410297.1 2797 VKCELQLVESGGSLVEPGNSLQLSCTTSGFTFSDHSISWICQAPEKGLEWVAQIRDKANNYATYYGESVKGRFTISRYDSKSSVYLQMNSLRDEDSAVYYCA
Phodopus sungorus V30 trav MCBN011411017.1 4262 VSRGEHVKQETSVLSVQEGSSALINCFYTDSTNYYFSWYKQERGAGLQLLINILSNEDRKEEQGLIVLLNNKDKHLSLNITAAYPGDSATYFCAVS
Phodopus sungorus V31 iglv MCBN011413897.1 3678 AYGNIVMSQTPKTLPASVGDRVSMSCKSSQNVATNIQWYQQKPGQAPKLLVYWSYNRYTGVPDQFIGSGSGTVFTLTISSVQDEDLGDYYCMQDDDTS
Phodopus sungorus V32 ighv MCBN011419094.1 2535 VHSQVQLQQPGAQLGSPGSSMKLSCKTSGYMFTDYYSITWVKHKPGQVMEWIGKIYPGDGDATYNERFQGKATLTVDKSSTTAYMVISSLTSEDSAVYYCARQ
Phodopus sungorus V33 ighv MCBN011424885.1 2933 VHSQAHLQQSGAELKAPGASVKVTCKDFDSYVFPIAYMNWMRQKPGHGLEWIGNILPSIGRTNYGQTFEGRVILSSDTGSNTAYMELRSLMSEDTATYYCV
Phodopus sungorus V34 trbv MCBN011427769.1 981 PLETAVFQTPQYLVTRVGNQASLKCEQDLGHDAMYWYKQDSKQLLKVMFSFNNKQLIVNESVPSRFSPQSPDKAHLELHVKSVEPDDSAVYFCASS
Phodopus sungorus V35 trbv MCBN011427769.1 4607 PVNSKTIQTPRYLIMGRANNKSLKCGQHLGNNAMYWYKQKAGEPLELMFLYNLKELILNETVPSRFLPECPDTSTLFLHLSALEPEDSAVYFCASSK
Phodopus sungorus V36 trgv MCBN011430335.1 682 RQTSPNVEERITSITRPMGSSIIITCDIHTTSSYIYWYLFQKGKAPQHLLYYNLLSSTIVVDSGFSSEKYYVYEGTDKTYKFVLRSVEESDSGLYYCASWG
Phodopus sungorus V37 trav MCBN011439115.1 520 GNRAQTVVQPDAHLTVSEGASLELKCSYSYGATPYLFWYVQYPGQSLQLLLRHFGGDTLVKGIKGFEAEFMKSNSSFNLRKNPAHWSDSAKYFCALS
Phodopus sungorus V38 igkv MCBN011444206.1 6122 TNCDIQLTQSPSSLSVSPGDKVTITCKASQNINNYLNWYQQKPREAPKLLIYTTSNLQTGIPSRFSGGGSGTDYSLTISSLEPEDVATYYCQQHY
Phodopus sungorus V39 trdv MCBN011453140.1 7307 KDAWSITLTQSSPDKTVASGSQLTLLCVYNENFHNPDLFWYRKRQDLSFQFILYRDDTSFHYADFVQGRFFVKHSKVGRTFRLVISPVKLEDSGTYYCASN
Phodopus sungorus V40 ighv MCBN010741929.1 665 VQCEVKLVESGGGLVQPGKSLKLSCAASGFTFSNYYMHWIRQAPGKGLEWITYISGDSSDIKYANTVNGRFTISRDNSKNTLYLQMNNLKSEDTATYYCAR
Phodopus sungorus V41 trbv MCBN010769220.1 619 FFDAAVTQTPRYLIKTEGQTATMTCHPEKGHTAVFWYQQRQDEELKFLIYFQGELPVDQTDMVKKRFSAKCPSGLHCSLNITTSGVGDSALYFCASSQ
Phodopus sungorus V42 ighv MCBN010907172.1 930 VLSQVTLKESGPGLLPPSQDLSLTCSFYGFSLSTSGMGVGWVRQSSGKGLEGLAIIWWDDDKRYNPSLRSRLTIYKDTSNNRVFLKIASVDTADTARYYCARR
Phodopus sungorus V43 trav MCBN010907338.1 949 VIQGEQVEQLPSTLIVQEGASAAINCTYTDSASSYFPWYKQGHGEHPKLIIDIRSTMERKQDRRLIVLQDKKTKHFSLHITNTQPGDSAMYFCAAS
Phodopus sungorus V44 trav MCBN010910389.1 685 KNGGQQVKQNSPSLTVQEGEISILNCDYNNNLFDYFAWYKKYPSKSPTFLISLRSNVNKKEDRRYTIFFNKSSQHFSMHIASSQPGDSAVYFCAAG
Phodopus sungorus V45 igkv MCBN010935579.1 605 AKCDIKMTQSPASLSVSMGETVTITCLASENIQGYLAWYQQKPEKPPKLLIYGANNLEDGVPSRFSGSGSGTKYSLKISSLQPEDAATYFCQQSWNYP
Phodopus sungorus V46 trbv MCBN010954086.1 699 SFDAKVTQTPRHLVKERGQKASMSCNPEKGHTAFYWYQQNQKGELKLLINFRNEEIIEQTDLVERRFSAKCPSNSPCSLDILSSEAGDSALYLCASSQ
Phodopus sungorus V48 igkv MCBN011028516.1 1197 AKCDIQVIQSLASLSVSVGDSVTITCQASQDIGWSLAWYQQKPVKPPKLLIYAADVLQDGVPSRFSGSRSGTQYSLKINSLKSEDVATYYCQQSNSFP
Phodopus sungorus V49 trav MCBN011039882.1 590 VAGQGAEQPAMQISVEGTSVQVNCTYSTSGFNGLSWYQQHEGQAPVFLSYDILDGLKDTFLSCRDGHSYLLDGHSYLLLTELQVKDSDSYLCAVREPLQ
Phodopus sungorus V50 trbv MCBN011082516.1 1047 STDDQVTQTPRHLITEPGKKLIISCSQNMNHNSMFWYRQDLGLGLKLIYYSVNVNITDKGEVSGGYSVSRKQKSTFPLTLESTRISQTSLYFCASS
Phodopus sungorus V51 ighv MCBN011143294.1 1711 VHCQVQLQQSGAELVKPGSSVKVSCKASGYTFTNSYINWVKQEPGQNLEWIGNIYGNGGANYNKKFQSKASLTADKSVNTAYMELSSLTSEDSAVYYCAR
Phodopus sungorus V52 trbv MCBN011146647.1 1903 LVDMEVSQMPRYLVKRVGEELFLECVQDMGHDRMYWYRQDPGLELRLIYLSYDVDSISEGDISKGYRVSRKKQESFSLILESAKANQTSVYLCSSSL
Phodopus sungorus V53 igkv MCBN011175828.1 1835 ACADIVVTQSPSSMAVSLGEKVTISCKASQSLLYSKDQKNYMNWYQQKSGQAPKLLIFHASTGETGVPDRFTGSGSGTDFTLTVSSVQGEDLGDYYCQQFYSTP
Phodopus sungorus V54 igkv MCBN011176667.1 713 AVGDIVMTQTALSSPVTLGESASISCRSSKSLLYSNGITYLHWYLQKPGQSPQLLIYRMSNLASGVPNRFSGSGSGTDFTLKINRIEAEDVGVYYCQQGLEYP
Phodopus sungorus V55 trbv MCBN011186045.1 1526 LTDAGITQTPKYWITQTDRKMVLECSQDMDHYWMFWYRQDAGQGLRLIYYSGDVGSTTKGDVPEGYSVSRNKSEHFLLTLDSTRLSQTSMYFCASS
Phodopus sungorus V56 igkv MCBN011202471.1 1365 SNGEIILSQSPESLGVSQGETVTITCRGSSSGIPDNFHWYQQKPGSPPKLLVYGTSKLAPGVPDRFSGSDSGTSYYLKISSMQAEDAATYYCLQKSSVP
Phodopus sungorus V58 ighv MCBN011266260.1 843 VQCKVKLVESGGGLVQPGRSLILSCAASGFAFSHYWMNWMRQAPGKGLEWVGEINKDSSNTDYTPSFKDRFTISRDNTKNSLYLQMNSVTSEDTAIYYCVR
Phodopus sungorus V59 igkv MCBN011273477.1 2653 SKCDIQMTQSPSQTTSLGDTVAIKCQASQSIGNELNWYQQKPGESPKLLIYGASSLYPGVPSKFSGSGSGRDFTLTISSVEPEDIATYYCKQDLSY
Phodopus sungorus V60 ighv MCBN011286582.1 383 VQSEVQLVESGGGLVQPGSSRKLSCETSGFTFSNAWMNWVRQAPGKGLEWVAQVRNKNDNYATYYAESVKGIFTISRDDSKSTMYLQMNNLRAEDTAIYYCT
Phodopus sungorus V61 trbv MCBN011299353.1 2241 SVFSVLLYQEPKQDICQSGISVKILCVVDSQLVELFWYRQFQGQSLVLMAAANQDSEATYESGFTKDKFPISRPNVRFSTLTVNNARPEDSSFYFCSSG
Phodopus sungorus V62 trbv MCBN011303274.1 653 PSKAGVTQSPRHAIIQERQEVSFWCDPVSGHAVLYWYQQLRDQGPQLLVYFQNEAVMDDSKLPKDRFSAARTAGVNSTLKIQSAKLGDSATYLCASSV
Phodopus sungorus V63 trav MCBN011309054.1 1177 IVGYAKTTQPSSMESTEEETVHLPCSHSTISGNEYIYWYRQVPLRGPEYVIHGLQQNTSNRMAFLAIPSDRKSSTLILPRVSLRDAAVYHCILRV
Phodopus sungorus V64 trav MCBN011318557.1 638 VNGQVLSQSVQYISVLEGKDVSMSCNSSSTLNNVLWYKQDPEGGLVLLVAVYKTGESVRNGKVTAEFGGTRKDSVLTISALEPADTSAYFCAG
Phodopus sungorus V65 trbv MCBN011326126.1 1337 VGAQIIRQWPAAKVQPVGSPLSLECSIKGQSNPNLYWYWQTPGGPLQQLFYSISAGQVESTVSRNLSASRPQDGQFTLSSEKALLSHSGFYFCAWS
Phodopus sungorus V66 ighv MCBN011327247.1 2429 VQTQIQLVQSGTELKQPGQSVKISCKASGYTFTDNAMHWVKQAPGQGLNWMWINTYTGKPKYADEFKGQIVLSLDTSVRTAYLQISSLKNDDMAMYYCAR
Phodopus sungorus V68 trbv MCBN011357863.1 1985 HSKAGVSQSPTHRLIKNGQNVSFWCDPISGHNRLYWYRQRSWQGLEFLAYFQNEVAPDKSGLPRDRFSVERPKGSRSVLKIQPVKQEDSAVYLCASSL
Phodopus sungorus V69 igkv MCBN011370547.1 1810 ARCDIQVTQSPSLLSASLGDKVTITCLASQDIGYYLSWYQQKPGQSLTLLIYYGNHLQSGVPSRFSGQYSGRSFTLSISNLEPKDAGAYYCLQYNSI
Phodopus sungorus V70 trav MCBN011376722.1 567 VSGQANTVIQTPSIPDIWENETAVINCTYTNAAYNYFLWYKKDGRKGLTLLADIRSNVNRRAEGRFTVILDKNAKLVSLHITAARAEDSALYLCAS
Phodopus sungorus V71 ighv MCBN011389164.1 4163 VLCQVQLKESGPALMQPSQTLSLTCTVSGFSLTSYGVGWVRQLPGKGLEWIGIIWGGGSTNYNSALQSRISIRRDTSKSQVFLKLNNLHTQDTAMYYCAR
Phodopus sungorus V72 igkv MCBN011390625.1 4062 VRCDILMTQSPLFLSASLGDKVTITCRASQNINSWLAWYQQKPGNAPKLLIYKASILQTGVPSRFSGSGSGTDFSLTISSLESEDVATYYCLQYDTL
Phodopus sungorus V73 trav MCBN011396927.1 3475 KTHGDSVTQKQGHVTLSEGDFLFINCTYSTTSYPTLFWYAQYPGEGPELLLKVTTANNKGSSRGFEATYDKGSTSFHLQKASVKESDLAVYYCALS
Phodopus sungorus V74 trbv MCBN011397610.1 2440 PVDSRIDQTPKHLVTVTGNERTLKCEQYLSHNVMYWYRQSAKNPLELMFYYNYQKLIENQTVPHRFQPHNPEKSYLDLQISALEPDDSATYFCASSR
Phodopus sungorus V75 trbv MCBN011397610.1 768 HTGSGVIQIPSHRVTHVGQMVILSCDPLSNHQYFSWYKLPLGQQMEFLVSFYNGKALEKSELFKEARFSVERQKESYFTLKIQATTMEDSAVYFCASSL
Phodopus sungorus V76 ighv MCBN011398500.1 2526 AAGEVGMGGVAWNFPKVSCADSGFIFTNAWMNWVHLAPGRGLEWVTQIRDKVNYYATCYGESIKGRFTMSGKDTKSSTQLHMTSLREEDTAVYFCAA
Phodopus sungorus V77 igkv MCBN011399669.1 2281 ARCDIQVTQSPSFLSASLGDKVTIMCRTNPGINGWLAWFQQKPGEMPKSLIHGASDLADGVPSRFSGSGSGTDYSLTISSLESEDIASYYCLQYNEYP
Phodopus sungorus V79 ighv MCBN011409776.1 1951 VLSQVTLKESGPGLLQPSQDLSLTCSFSGFSLNTYGIAVSWIRQPSGRGLEWLALIYWDDDKRYSPSMKNRLTISKDTSNNQVFLKITSVNMADTATYYCARR
Phodopus sungorus V80 igkv MCBN011409993.1 3768 VTGETTTQSPAFLSLSLGETATLTCRSSQNVGSYLAWYQQKPGQVPRLLIYDASTRVSDVPARFSGSGSGTDFALTISSLEPEDVAVYYCETYKSWS
Phodopus sungorus V81 igkv MCBN011409993.1 1327 IQCDTHMNQSPVSLSAFVGDTVTITCRASQDISRYLGWYQQKPGKSPKFLIYYASNLLSGIPKRFSGSGFGTEYSLTINSVKPEDAATYYCQQCFSYH
Phodopus sungorus V82 ighv MCBN011410744.1 1594 VHSHVQLQKSWPELVSTVSSLKLSCKASGYTFTDNYMHWVKPKPGQSLEWMETIGCGIGNTYNAQNFKGRATLTRDTSSSTAYMEVSSLTSDDSAIYYCAR
Phodopus sungorus V83 trgv MCBN011411155.1 4516 GDSWISQDQLSLTRRPNKTVHISCKLSGVPLQNTIVHWYQLKEGEPLKRIFYGSAKTYKQDKPYSRLETDEKNDGTFYLIINNVITADEATYYCACWD
Phodopus sungorus V84 igkv MCBN011412200.1 2825 SDGDIMLTQSPESLAASQGEKVTITCSDSSSISTNYLHWYQQKPGASPKFMVYRTSYLASEIPTCFSGSGSGTSYSFIISSLEPEDTATYYCTQGSSS
Phodopus sungorus V85 trbv MCBN011418122.1 3226 AADPRVIQSPRHLIKAKGGRSVRKCIPISGHASVSWYQQPLGREPRFLIQHYEKMEAQRGRMPNRFSAQQFSDYSSEMNMSSLQLEDSAVYLCAS
Phodopus sungorus V86 trbv MCBN011418122.1 715 HTEAAVTQSPRSKVAATGGKVALSCHQNDNHDYMYWYRQDPGHGLRLIHYSYGAGSTEKGDVPDGYKATRPNLENFSLALETASPSQTAVYFCASSD
Phodopus sungorus V88 trav MCBN011428468.1 2429 VSRGEQLEQQTSLLSVQEGGAAFINCSYTATSTSFFSWYKQEPGEGLQFLINVLSNVDRKEEQGLIVLLNKKDKHFSLNITAAYPGDSATYFCAAAS
Phodopus sungorus V90 igkv MCBN011431754.1 3800 VRCDIQMTQSPASLSVSVGETVTITCLASENIKGYLAWYQQKPEKPPKLLIYGISILADWVPSRFSGSGSGTQYSFKISSLQPEDAATYYCQQDWSAP
Phodopus sungorus V91 ighv MCBN011436785.1 2536 VHSQVQLQQSGAELVKPGSSVKVFCKASGYTFTDYSMFWVKQRPGQCLEWIGWNGTSSSNTKYAQKFQGKATLTRDTSSSTAYMELSSLTSEDSAIYYCAR
Phodopus sungorus V92 igkv MCBN011436992.1 3831 SRGDIVLTQSPATLSVTPGDKVTINCKASQSIGTSLHWYQQKPGKAPRLLIKYASESISGIPSRFSGSGSGTDFTLSINNVESEDFAIYYCQQSSNWP
Phodopus sungorus V93 trav MCBN011438285.1 4876 RIHGDSVTQKQGHVTLSEGDFLFINCTYSTTLYPTLFWYAQYSGEGPQLLFKVSKADDTESSKGFKVTYDRGSTSFHLQKASVQESDLAVYYCRGS
Phodopus sungorus V94 igkv MCBN011440981.1 1960 ARCDIQVTQSPSLLSASLGEKVTITCLASQGISNNLDWYQQKPGQSPSLLIYYATSLQSGVPSRFSGQYSGRSFTLSISSLEPEDAGTYYCLQYNSF
Phodopus sungorus V95 ighv MCBN011446660.1 1851 VHSQIQLQQSGAELVMPDSSVKLSCKASGYTFSIYTVHWMKQKPGQGLEWVGYVHPGNGGSRYAENFKGKITLTADTSSSTAYMELISLTSDDSAIYYCA
Phodopus sungorus V96 ighv MCBN011454513.1 5920 VHSQVQLQQSVAELVRPGASVNLSCKTSGYSFTSVYMSWVKQRPVQGLEWIGTIDPEDDGIDYNEKFQSKATLSADTSSNTAYMDLRSLTSDDSAVYYCA
Phodopus sungorus V97 ighv MCBN011454513.1 741 VQCEVKLVESGGGLVQPGESLRLSCVASGFDFSNSWMDWVRQTPGKGLEWVAEINGDSSDTKYAPSLKDRFTISRDNAKNTVYLQMNSVKSEDTAIYYCTW