WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Rhinolophus sinicus LVEH00000000.1 (LVEH01) 142 14 29 11 49 26 5 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Rhinolophus sinicus V3 trbv LVEH01000301.1 1138825 LMDTGITQTPKHLVMGMRSKRSLKCEQHLGHNAMYWYKQSAQKPPQLMFTYNYKELSENMTVPSRFSPTCPDSSHLYLHVDTLEPEDSALYLCASSR
Rhinolophus sinicus V4 trbv LVEH01000301.1 1140698 PVDSGVSQTPRHLVKAKGQTVTLSCSPVPEHLSIYWYQQALGEGPQFLIQYYNGQEREKGNFPSRFSVQQFPNKSSELKMSSLELRDAALYLCASSL
Rhinolophus sinicus V6 trdv LVEH01000342.1 891755 NGMLCNRVIQSSPEQTVASGRDVALLCTYDTRFSNPDLYWYRIRPDHSFQFILYRDNSHVIDADFIQGRFSIQHNQIQKSFHLVISLVTTEDTATYYCAMG
Rhinolophus sinicus V8 trgv LVEH01000486.1 2459201 GCGLSKLEQSQISISTEVKKSTDIYCNITSTDFVNDIIHWYRQKPNQALEHLIYVSSTTTPARRQKHGNKKFEARKNPRILTSILTIHFIEKEDVAIYYCAGWFI
Rhinolophus sinicus V9 trgv LVEH01000486.1 2466029 GFGQLKLEQPVVSICRTRDKSAYISCKMSTENINTDYIHWYRQKPDLAIEHLLYVDSRTTVSNNFGGKKNKLQASKSSLTSILTINFLEQEDEAIYYCSCWID
Rhinolophus sinicus V10 trgv LVEH01000486.1 2473105 TGGDIRITQVITSITKKIGNTAFLECQIKRDILTKSRYIHWYRQKPDQPLKRILYISSNENVVHERDISEERYEARKQKSDLLASLRIHRVNEADAGLYYCACWD
Rhinolophus sinicus V11 trgv LVEH01000486.1 2474894 GDSKMRISQYQLSLTRTPDKTVHISCKLSGVPLENAIVHWYQQKEGDLLRRILYGSTKSYKQDTPNPRLEADTKENGVFYLIINKVIKSDEGTYYCACWD
Rhinolophus sinicus V12 iglv LVEH01000996.1 37942 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPNWYQQTPGRAPRRLIYHTNGRPSGVPDRFSGSISGNKAALTITGAQPEDEADYYCALYMSS
Rhinolophus sinicus V13 iglv LVEH01000996.1 47153 ATSQATVTQEASLSTSPGGTVTLTCGSSTGAVTSSNYASWVQQKPYQAPRGLIGNTNNRVPGVPARFSGSLIGDKAALTITGAQPEDEAEYYCALWFS
Rhinolophus sinicus V14 trbv LVEH01001063.1 5216 PRDAAGVTQKPRHKVTNMGQGVNLTCEPMSGHNSLFWYRQSSVQGPELLIYFQNQAPMDETGMPKTRFSAQMPTGSFSSLKIEPTEPGDSAVYLCASSL
Rhinolophus sinicus V15 trbv LVEH01001063.1 11084 PLGAIVTQNPRYQVIRIGKPVTLHCSQDMNHDSMYWYQQRLSQAPKLLFYYYDEEFNNETDTSDNFQPKRHNTSFCSLGIRSPGVGDSAVYLCASSR
Rhinolophus sinicus V16 trbv LVEH01001063.1 15346 SLDAEVIQTPGHLVKGKGQNVTMDCVPIKEHRYVVWYQQILAKEFKFLISFQYNKVYETEMPKERFLAECPQDSACRLEIQGTELQDSAIYLCASSE
Rhinolophus sinicus V17 trbv LVEH01001063.1 23611 PTSASTTQNPRQLVMGRGQEATLKCYPMNSHIYVNWYQQSPGEGLKFMISLGKEETLDESGMPTKRFSAEFPKEGPSVFKIQLAEPGDSAVYFCASSL
Rhinolophus sinicus V18 trbv LVEH01001063.1 25177 SSGLGARVSQYPSRAIRTSGASVNIECRSVDFQATTVFWYRQFPKQGFILLATSNTGSSAKYEQDFKEDKFPISHPNLTFASLTVANVHPEDSSLYFCGAS
Rhinolophus sinicus V19 trbv LVEH01001063.1 31284 SKDTEVTQTPRHLVRGKKQKAKMECAPIPGHSYVYWYRKKLEEELKFLVYFQNDDVMEKTEEIDKQILVQCPKNERCRLEIQSTDSGDSALYFCASSQ
Rhinolophus sinicus V20 trbv LVEH01001063.1 34115 LTDAEIYQTPAFRLTRAGQNVTLECKQNLKYNAMYWYRQDPGQGLRLIYYSTVEKDVQKGDLTEGCGVSREEKGLFPLTVKLAHTNQTSLYLCSGSA
Rhinolophus sinicus V21 trbv LVEH01001063.1 38645 SVDAKVTQTPGHLIRGRGQKAKMKCIPEKQHPVVYWYQHIQKEEFKFLISFQNDQVLDQIEMVKERFSTSCSPNSPCSLEILSPEPGDSALYFCASSQ
Rhinolophus sinicus V22 trbv LVEH01001063.1 44113 SMDTGVTQTPRNSITKTGSTIVLECSQNKGHDYMYWYRQDPGLGLQLIYYSLNINDINPGEFSDGYSVSRKELVKFSLILKTASPNQTALYFCASSD
Rhinolophus sinicus V23 trbv LVEH01001063.1 47513 LMEADVSQTPRHCVTGTGKKITLKCSQTMGHNYMYWYQQDPGMELQLIYYSYGVKSVEKGEQSSETTASRTSQEQFSLMFNSTSPSQTSWYFCASSE
Rhinolophus sinicus V24 trbv LVEH01001063.1 51236 FQDAGVTQFPRHRVSGTRKKLTLRCSQDLGHFTMYWYRHDPGFGLQLIYYSNGVKAIEKGDVPARYHVTREELKSFPLTLESASTNQTSVYFCASSE
Rhinolophus sinicus V25 trbv LVEH01001063.1 56071 PMEAGVTQTPRYLITKTEKKLTVNCSQNMNHEAMFWYRQDPGKALKLIYYSVNVNLIDDGDIPDGYEVSRKKKEDFPLTLKSTSTNQTSVYFCASSV
Rhinolophus sinicus V26 trbv LVEH01001063.1 60546 LVNADVTQTPSYLVKKMGEEVLLECLQDMNHDRMFWYRQDPGLGLRLLHFSYGVDSNEIGDFPHGYSVSRKKTERFTLTMKSASTNQTSVYFCASSD
Rhinolophus sinicus V27 trbv LVEH01001063.1 64034 SVFGALVSQKPSRDICQRGTSMTIQCQVDSQMTFLFWYRQLPGESLTLIATANQGSEATYESGFTKDKFPISRPNLMFSNLTVTDMRPEDSSLYFCSVG
Rhinolophus sinicus V28 igkv LVEH01001215.1 44925 LKVGNAVVQSLASLTFSLGESIIITCKTNPNEKTKFAWYQQKPGQTHQVLVYDTSSQASGVPTQFSGRGSGTDFTLTISNVETVDAATYYCHE
Rhinolophus sinicus V29 trbv LVEH01001256.1 2213 LVDAGVTQKPKFQIRKTGQMVTLSCAQDMSHNYMYWYRQDPGHGLQLIHYSVAAGTTDEGDVPEGYNVSRSNTEDFPLTLKSASPSQTSVYFCASSY
Rhinolophus sinicus V30 trbv LVEH01001256.1 5250 SVFTGDAGDKVSQSPRHRVTEKGQNVSLRCDPISGHVGLYWYRQTLGQGPEFLMYFQGEGAVDTSGMPKERFSAERSEGSYSFLKIQRAEQKDSAVYLCASSL
Rhinolophus sinicus V31 trbv LVEH01001256.1 8428 PMNAAITQTPRYHIIQTGKKMNLTCSQHMNHFAMFWYRQDPGQGLRLIYYSGSASSISKGDVTEGYSVSRDKHEHFPLTLNSASTNQTSLYLCASSQ
Rhinolophus sinicus V32 trbv LVEH01001256.1 14334 DTDTEVSQSPRHRVTEKGQNVSLRCDPISGHTALYWYRQTLGQGPEFLMYFQGKDAGDTSGMPKERFSAERSEGSYSFLKIQRAEQRDSAVYLCASSL
Rhinolophus sinicus V33 trbv LVEH01001256.1 19388 LADVGVTQSPRHLIKGRGGKAVLKCRPISGHKSLLWYQQTQGQGPQFLVEYYEKEEREKGKISDQFSFKLFKDYSSELTKSSLQLEDSAVYLCASSL
Rhinolophus sinicus V34 trbv LVEH01001256.1 23729 HMDAGITQSPRYKVTGTEKKVTLTCHQTENHDYMYWYRQDPGHGLRLIHYSIAAGTTNEGDVPEGYNVSRSNTEDFPLTLKSASPSQTSVYFCASSY
Rhinolophus sinicus V35 trbv LVEH01001256.1 27954 LTEGGVAQSPRHKITGKGQAVTFWCDPIPNHQTLYWYRQTLGQGLGLLIRFENEAAMDDSQLPKNRFSAERPEGTNSTLKMQRAELGDSAVYFCASSL
Rhinolophus sinicus V36 trbv LVEH01001256.1 33846 LTDAAGVTQTPRHKVTRMGQPVTMNCKPMSDHSHLYWYRQTSAQGPEFLIYFNNQQPVDDSGMPKTRFSANMSSRSSSSLNIETTEPGDSAVYLCASSS
Rhinolophus sinicus V37 iglv LVEH01001300.1 28836 VSSQPVVTQEPSLTVMPGLTVTLTCSMSTGPVTTGNAPGWFLKKPGQAPQQLIYQMDKRPASVPNRFSGSILGGRAALTIAGAQPEDEAEYFCIVWYNAPA
Rhinolophus sinicus V38 iglv LVEH01001300.1 58143 SVVSNELTQPPSVSVTLGQTARITCSGDAIEEGNFVHWYQQKLGQAPVLVIYADSNQPSGIPDRFSGSNSGNTATLTISGAQAEDEADYYCQVWDIANDK
Rhinolophus sinicus V39 iglv LVEH01001340.1 1416 SVVSSDLTQPAAASVSLGQTASITCQGEILKSNYARWYQQKPGQAPVLLIYGNNNRSSGIPDRFSSSYPDDTSILTISGAQAEDEADYHCGLWDKSKK
Rhinolophus sinicus V40 iglv LVEH01001430.1 17458 SWAQSVPTQPPSVSGAPGQSVTISCTGSSSNIGGNYVHWYQQLPGSAPKLLIYDNSKRPSGIPDRFSGSKSGNSASLTISGLKTEDEADYYCETYDDSLRA
Rhinolophus sinicus V42 iglv LVEH01001440.1 7819 SVVSSDLTQPAAASVSLGQTARITCQGESLKSYYADWYQQKPGQAPVLVIYDNNNRPSGFPDRFSSSHSDDTSTLTISGARAEDEADYYCKSVDSSGE
Rhinolophus sinicus V43 iglv LVEH01001485.1 907 SWAQSALTQPPSVSGTPGTSVTISCAGSSNDVGGYNYVSWYQQHPGTAPKLLIYEVTKRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCCSYSNVYS
Rhinolophus sinicus V44 iglv LVEH01001485.1 12221 AWAQSALTQPPSTSGTPGTSVTISCAGSSNDVGRYNYVSWYQQRPGTATKLLIYDVTKRPSGIPDRFSGSKSGNTASLTISGLQPEDEADYYCCSYTSSGT
Rhinolophus sinicus V45 iglv LVEH01001490.1 3305 PVASYELTQSPALSVAPGQTARISCTGDSLDKKYTRWFQQKPGQAPVVVIYKDSERPSGIPDRFSGSSSGKTATLTISGARAEDEADYYCQSADSSGN
Rhinolophus sinicus V46 iglv LVEH01001490.1 13302 FVASYELTQPPSVSVALGQTARITCGGNNIGGKDAHWYQQKPGQAPVLVIYDDNERPSGIPDRFSGSNSGNTATLTISGARAEDEADYYCQVWDSSGD
Rhinolophus sinicus V47 iglv LVEH01001573.1 9698 SWAEFVLTQPRSVSGSPGQKVTISCTRSSGNIESKYVHWYQQRAGGAPTMVIYEDNKRPSGVPDRFSGSIDSSSNSASLTISGLQPEDEADYYCQSYDSND
Rhinolophus sinicus V48 trbv LVEH01001575.1 1733 LLDTAVLQTPKYLVTQVGNKESLKCEQNLGHDAMYWYRQDAKQLLKIMFTYNNKELIVNETVPSRFSPDPPDKAHLNLHINSLEPGDSAVYLCASSQ
Rhinolophus sinicus V49 iglv LVEH01002167.1 5805 SWAQSVLTQPPSVSGAPGQSATISCTGSSSNIGDNYVHWYQQLPGKAPKLLIYDNSKRPSGVPNRFSGSKSGNSASLTISGLKAEDEADYYCETYD
Rhinolophus sinicus V50 ighv LVEH01003293.1 2857 VHSEVQLVQPGAEVRKPGASVKVSCKASGYTFTDYYMHWVQQVLGQGLEWMGWIYADSGGTNYAQKFQGRVTITADTSTSTAYMELSSLRPEDTAVYYCAR
Rhinolophus sinicus V51 iglv LVEH01004094.1 937 FVTSYELTQPPSVSVALGKTARITCEGNNIGRKVVNWYQQKPRQAPVLVTYDDCGWPSGNPDRFSGSNSGNTATLTISGAQAEDEDEADYYCQVWDSGN
Rhinolophus sinicus V52 iglv LVEH01011965.1 275 SVVSSDLTQPAALSVSLGQTARITCQGESLKSYYAGWYQQKPGQAPVLLIYGNNNRPSGIPDRFSSSYSYDTSILTISGTQAEDEADYYCEVWDSSGE
Rhinolophus sinicus V58 igkv LVEH01000286.1 300125 TTGEIVMTQSPASLSLSLGERATLTCRASQTVSSYLAWYQQKPGQAPKLLIYGATTRASGIPARFSGSGSGTDFTLTISSLEPEDFAIYYCQQYNSGY
Rhinolophus sinicus V59 igkv LVEH01000286.1 291163 ARCDIQMTQSPSSVSASVGDTVTITCRASQSIGNWLNWYQQKPGTAPKLLIYGASSLQTGVPSRFSGQGSGTDYTLTISSLQPEDVATYYCLQGYSTP
Rhinolophus sinicus V60 igkv LVEH01000286.1 262531 ARCDIQMTQSPSSVSASVGDTVTITCRASQSISSWLAWYQQKPGTAPKLLIYRASNLETGVPSRFSGQGSGTDFTLTISSLQPEDVATYYCQQYDNTP
Rhinolophus sinicus V61 igkv LVEH01000286.1 220685 ARCDIQMTQSPSSLSASLGDTVTITCRASQSISNELSWYQQKPGTSPKLLIYNANSLQTGVPSRFSGQGHGTDFTLTISSLQPEDVATYYCLQDYNWP
Rhinolophus sinicus V62 igkv LVEH01000286.1 130270 ARCDIQMTQSPSSLSASVGDTVTITCRASQGISNWLHWYQQKPGTAPKLLIYKASTLQTGVPSRFSGQGSGTDFTLTISSLQPEDVATYYCLQSSSLP
Rhinolophus sinicus V63 igkv LVEH01000286.1 118326 ARCDIQMTQSPSSVSASLGDSVTITCRASQSINSWLNWYQQKPGTAPKLLIYNANSLQTGVPSRFSGQGSGTDFTLTISSLQPEDVATYYCQQHNSLP
Rhinolophus sinicus V64 igkv LVEH01000286.1 99568 ASGNTVLTQAPVLLSVSLRQSASITCSANQSISDYLSWYQQKPGQAPKILIYDADDRYPGVSDRFTGIQSGTEFILTISKVEADDVTSYYCQQGYTAP
Rhinolophus sinicus V65 igkv LVEH01000286.1 47124 ARCDIQMTQSPSSLSASLGDKVTITCRASQDISSWLNWYQQKPGTAPKLLIYNANNLQTGVPSRFSGQRSGTDFTLTISSLQPEDVATYYCLQHSSLP
Rhinolophus sinicus V67 trav LVEH01000342.1 1062844 SNVAQQVTQPQPEMSVLEAETVTLACTYSTSTSDYYLFWYKQPPSGEMMFVIRQEAYKQQNATENRFSVNFQKASKSFSLRISDCQLEDAAMYFCALRE
Rhinolophus sinicus V68 trav LVEH01000342.1 1029846 VSGKNGVEQSPQYLSAQEGEFITINCSYSIGINTLHWLRQNPGEGLVTLFILSLEKKEKGRLRATINTKERYSSLYITASQSKDSAIYFCAIE
Rhinolophus sinicus V69 trdv LVEH01000342.1 963986 VSLDIILEPVTKTLTVLAGKTATFYCTITGADLKNYQMSWYKKNEDSSLTVVYRQSNSSGDNLRSNFKGKVDVLKSQYILDILKAATKDAGTYYCGCD
Rhinolophus sinicus V70 iglv LVEH01000397.1 10282 SWAEFVLTQPRSVSGSPGQKVTISCTRSSGNIESEYVHWYQQRAGGAPTTVIYRDNERPSGVPDRFSGSIDSSSNSASLTISGLQPEDEADYYCQSYESNN
Rhinolophus sinicus V71 iglv LVEH01000397.1 6977 SLSQPVLTQPPSLAASPGASARFTCTLSSGFNVAGYRISWFQQKPGSPPWYLLNFYSESNKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCAT
Rhinolophus sinicus V76 trav LVEH01000581.1 56946 FAGQGVQQAAELTAMEGASVQINCSYQISAFNGLSWYQQHEGSSPMFISYNILDGLESRGHHFSSFLSRSETYSYLLVKDLQMKDSASYLCAVR
Rhinolophus sinicus V77 trav LVEH01000581.1 1725 GLRAESVSQPDDQVTVTEGDPLTVKCTYLTSGFRFLFWYVQYPNQGLQFLLKYFPGDSLVKGSFGFVAEFNTSQMSFHLKKRSALGSDSAVYFCAGR
Rhinolophus sinicus V78 trbv LVEH01000650.1 14126 VGAQTIHQWPSTRVQAVDSPLSLECTVKGTSNPNLYWYRQAAGGALQLLFYSIGVGQVSSEGDQNLKASRPQDGRFNLTTEKLLLSDSGFYLCAWS
Rhinolophus sinicus V79 trav LVEH01000955.1 123041 ENVVQRPPSLSVQEGNGCDMDCSYSDSASQYFSWYKQEAGKGPQSIIHIRSYQDKIEDGRFTVLLNKTVKQFSLHIVATQPGDSAVYFCAASTHCFS
Rhinolophus sinicus V80 trav LVEH01000955.1 98310 VSGGENVVQGPPSLSVQEGNSCDMNCSYSDSGSDYFPWYKQEAGKGPQLILHIRSHQVKTKDGRFTVLLNKAAKQFSLHIVATEPGDSAVYFCAAS
Rhinolophus sinicus V81 trav LVEH01000955.1 83420 RTHGASVSQMEGPVTLSEGSSLNVNCSYEDSGYSTLLWYVQYPGEGPQLLLKAVADGEKGRNKGFEATYRKESKSFHLEKASAQESDSAMYYCALS
Rhinolophus sinicus V82 trav LVEH01000955.1 79476 VSGADNVDQSPPSLSVQEGNSCAMNCSYSNSALDYFPWYKQEAGKGPQLIIYIRSHQENIKDRRFTVLLNKTAKQFSLHIEATQPGDSAVYFCAAS
Rhinolophus sinicus V83 trav LVEH01000955.1 61909 QTHGESVSQMEGPVTLSEGRSLNVSCSYEASGYPRLFWYVQYPGEGPQLLLQAFMDGEKGRNKGFEATYRKESKSFHLEKASAQESDSAMYYCALS
Rhinolophus sinicus V84 trav LVEH01000955.1 47407 SNIAQNVTQSQSALLVQEKEAVTLDCTYDTTDRTYSLIWYKQLSSGAIIFLIRHESYSQPNATEGRYSLNFQKEKKSVNLVISASQLEDSALYFCALR
Rhinolophus sinicus V85 trav LVEH01000955.1 40813 RTHGVSVSQTEGPVTLSEGTSLNVNCSYEEIQYPTLFWYVQYPGEGPQLLLKAVVDGEKGHNKDFEATYLKEPRSFHLEKASVHESDSAIYYCALS
Rhinolophus sinicus V86 trav LVEH01000955.1 30132 GANAQLVTQHDRHVTVTEGASLELKCNYTYSSSPYLFWYVQYPNQGLQFLLNYFSGNTLVKGIKDFEAEFRKDETSFHLKKSSARWSDSAVYFCAIS
Rhinolophus sinicus V87 trav LVEH01000955.1 24625 GTRAQTVTQPEDHISVIEGAPVQVKCNYSYSGSPELFWYVQYPKQGLQLLLKHFSKESTKGFTANLDKSGASFHLKKPAAQEEDSAMYYCVLR
Rhinolophus sinicus V88 trav LVEH01000955.1 14069 DTCGDSVNQTEGPIILPEGAFLTLNCTYQTSYSDFLYWYVQYQNKEPKLLLKSSSDKKVNSNGFHADLVKKDSSFHLQKPAVEATDSAVYYCALG
Rhinolophus sinicus V89 trdv LVEH01000955.1 12703 SSTTQSVNQTQSAISVVEKEAATLGCVFEAKSYSYYLFWYKQPPSGEMTFLIHQESFNEQKKTEGRYSLTFQKSANSINLTITASQVGDSAMYFCALR
Rhinolophus sinicus V90 trav LVEH01000955.1 8652 GSNGDSVNQTEGSVILPEGASMILNCNYQTTYSSPFLFWYVQYLNKAPQLLLKSMTENQRTEHQGFEAKLVKRDSSFHLQKSSLRMSDSAVYYCALS
Rhinolophus sinicus V91 trav LVEH01000955.1 1980 VSSKQEVNQSPDVLTVKEGDGLFLNCSYTDSNFYALQWYRQDPGKGLTFLLIQSSPGVQETGRIKAFFDKMSRHSALHIASAQLSDSATYLCAV
Rhinolophus sinicus V95 trav LVEH01001040.1 119738 AESKDQVFQPSSVVSSEGAVAEISCNHSISTAYNVFWYLHFPGLAPRLLVKGSRPSQQGRYHMTYERFSSSLLILQVQVADAATYYCALWDTE
Rhinolophus sinicus V96 trav LVEH01001040.1 79533 AESKDQVFQPSSVVSSEGAVAEISCNHSISNAYEFSWYLHFPGLAPRLLVKGSRPSQQGRYHMTYERFSSSLLILQVQVADAATYYCALRDTE
Rhinolophus sinicus V97 trav LVEH01001040.1 74118 GLRAESVSQPDDQVTVTEGDPLTVKCTYSFSLSPYMFWYVQYPNQGLQILLKYFAGDNLVKGSFGFVAEFNKSQTSFHLKKPSALGSDSAVYFCAGS
Rhinolophus sinicus V98 trav LVEH01001040.1 63184 TLSLAKTNQPSFIDSYEGQEVNIACNHTNIVANEYIFWYRQFPNQGPQFIIQGYKTNTTNEVASLFIPADRKSSMLSMPYASLRDTAVYYCIVS
Rhinolophus sinicus V99 trav LVEH01001040.1 56792 VSSQRIEQNPQHLSIQEGEEAILTCNFTNYSPAFLQWYRQDLGRDLIFLLLIRENERQKQTGRLRATFDTAIKQSSFHITASQPADSATYLCAA
Rhinolophus sinicus V100 trav LVEH01001040.1 46743 VSGGENVVQRPPTLSVQEGNSCDMNCSYSDSASNYFPWYKQEAGTGPQLFKYIRSNKDKIKDGRFTLLLNKTAKQFSLHIETTQPGDSAVYFCAAS
Rhinolophus sinicus V101 trav LVEH01001040.1 24878 VSGGENVVQRPPSLSVQEGNSCDMNCSYTDSASEYFPWYKQEAGKGPQFIIHIRSNQDKTEVGRFTVSLNKAAKQLSLHIEATQPGDSAVYFCAAS
Rhinolophus sinicus V102 trav LVEH01001040.1 11591 VSGADNVDQSPPSLSVQEGNSCAMNCSYSNSALEYFPWYKQEAGKGPQLIIYIRSNQDKTEVGRFTVLLNKAAKQLSLHIEATQPGDSAVYFCAAS
Rhinolophus sinicus V103 trav LVEH01001040.1 5764 SNIAKKVTQGQPSMLVQEKEAVTLDCTYDTTDSTYNLFWYKQLSSGAMIFLIRQDSYNQQNATEGRYSLNFEKAKKSVNLVISASQLEDSALYFCALRE
Rhinolophus sinicus V104 trav LVEH01001054.1 83142 VRSQDVQQSPQALIIQEGEGVTITCNSSKTLYSLHWYLQKPGEGPVILMILRQGGEDKNLDKIVATLNENKQQSSLYMVASQPRHSGTYFCGV
Rhinolophus sinicus V105 trdv LVEH01001054.1 76384 FSMAQKVTQPQRKVTMQEGRAVTLDCTYENQGSTYILYWYKQLASGEIVFLLYQEYDKRNAKRDRYSANFQRANAFISLTISSLELADSAKYFCALWE
Rhinolophus sinicus V106 trav LVEH01001054.1 39204 IMGNAKSTQPDAMESTEGKPVQLPCNHSTISGNEYIHWYRQIPHQGPEYLIHGLKRNETNGMATLIITTDRKSSALILPQVTVRDSAVYYCIVRD
Rhinolophus sinicus V107 trav LVEH01001054.1 32051 IMGDAKSTQPDAMESTEGKPVHLPCNHSEITGRDYIIWYRQIPHQGPQHVIESVRDNKTSGMATLIIATDRKSSTLILPQVTLRDSAVYYCIVRD
Rhinolophus sinicus V108 trav LVEH01001054.1 31660 IMGDAKSRQPDAMESTEGKPVHLPCNHSEITGRDYIIWYRQILHQGPQHVIESLRDNKTNGMATLTIATDRKSSALILPQVTVRDSAVYYCIV
Rhinolophus sinicus V110 trdv LVEH01001054.1 9521 FSMAEKVTQAQTTLTVQEGGAVTLDCTYETEWIAYNLHWYKQLPSGEMLFLLYQNYNEENVKQDRYSVNFQKAKKFISLTISPLQLADSAKYFCALD
Rhinolophus sinicus V111 trgv LVEH01001072.1 48004 GCGLSKLEQSQISISTEVKKSTDIYCNITSTDFVNDIIHWYRQKPNQALEHLIYVSSTTTLALTHLHGNKKFEARKNPRILTSILTVNFIEKEDVAIYYCAGWFI
Rhinolophus sinicus V112 trav LVEH01001145.1 93610 VNGQQLQQFPQFLLLQEGENFTTYCNSSTTLQVLQWYKQSPGGSPVLLMRLFKFGDVFKQERLRARFGETGKDSSLHIVGTQTADAGTYFCAG
Rhinolophus sinicus V113 trav LVEH01001145.1 85440 GTRADSVSQPDGHITVSERTSLELRCNYTSTYGASVSLFWYVQYPSQNLQLLLKYVAGNTLVNGIKDFKAEFKKSESTFHLRKSSAHWNDSGVYFCAVS
Rhinolophus sinicus V114 trav LVEH01001145.1 76262 VSSASNVEQSPQSLHVQQGKSTNFTCRFPSGSFYALHWYRWKPAKSPQILFLFRSNRDEKEEGRVKATLDTKNGYSFLYIKGSQPEDSATYLCAF
Rhinolophus sinicus V115 trav LVEH01001145.1 72114 GTRAQSVSQPDGHITVSERTSLELRCNYTSIYGASVSLFWYVQYPSQNLQLLLKYVAGNALVNGIKDFQAEFKKSESTFHLRKSSAHWSDSGVYFCARS
Rhinolophus sinicus V116 trdv LVEH01001145.1 43467 FSMAEKVTQAQTTVTVQEGGAVTLDCTYETRWTAYTLHWYKQLPTGEMLFLLNEENSKLNERQDRFSVNFQKAKKFISFTISPLQLADSAKYFCALWE
Rhinolophus sinicus V117 trav LVEH01001145.1 34612 GTRAQSVSQPDGHITVSERTSLELRCNYTYGGSVYLFWYVQYPNQNLQLLLKYVAGNTLVNGIKDFQAEFKKSDNTFHLRKSSVHWSDSGVYFCVLS
Rhinolophus sinicus V118 trav LVEH01001145.1 26816 VSSASNVEQSPQFLHVQEGKSTNFTCRFPSGSFYALHWYRWEPAKSPKILFVISLNGDEKEKGRVKATLDTKNGYSFLYIKGSQPEDSATYLCAV
Rhinolophus sinicus V119 trav LVEH01001145.1 19308 VNGQELNQIPQFLLLQEGENFTSYCNSSITLNGIQWYKQSPGGSPVLLMKLVKSGDVWEQERLRAQFGETRKDSSLHIVGAQTADVGTYFCAG
Rhinolophus sinicus V120 igkv LVEH01001215.1 63277 ARCDIQMTQSPSSVSASLGDSVTITCRASQGISDDLAWYQQKPGTAPKLLIYEASSLQTSVPSRFSGQGSGTDFTLTISSLQPEDVATYYCLQYYSRP
Rhinolophus sinicus V121 igkv LVEH01001215.1 39757 TTGEIVMTQSPASLSLSLGERATLTCRASQTVSNSLAWYQQKPGQAPKLLIYGATTRASGVPARFSGSGSGTDFTLTISSLEAEDAAVYYCQQG
Rhinolophus sinicus V122 iglv LVEH01001221.1 27803 SLSQPVLTQPPSLSASLGASARLTCTLSSGFNVGDYHIYWYQQKPGSPPRYLLRFKSDSDKHQGSGVPSRFSGSKDTSANAGLLLISGLQPEDEADYYCET
Rhinolophus sinicus V123 iglv LVEH01001221.1 20914 SLSQPVLTQPPSLSASPGASARLTCTLRSDISVGSYVIRWYQQKPGSPPQYLLSYKSDSDKHQGSGVPSRFSGSKDTSANAGLLLISGLQPEDEADYYCET
Rhinolophus sinicus V124 iglv LVEH01001247.1 53065 SVAQAGLTQPPSVTKSLGQTATLTCTGNSNNVGNQGAAWLQQHPGRVPKLLTYRNNKRPSGVSERFSGSRSGSVSSLSISGLQPEDEADYYCSAWDSSLSA
Rhinolophus sinicus V125 iglv LVEH01001247.1 16956 SSSQAVVTQEPSLAVSPGGTVTLTCGSSYGALTNGHYPHWIQQKSGQAPRTLIYDTNKKHSWTPARFSGSIVAGKATLTLSGAQPEDEAEYYCFLVYSDH
Rhinolophus sinicus V126 iglv LVEH01001271.1 14408 SLSQPVLTQPPSLSASPGASARLTCTLSSGFNVGDFWIRWYQQKPGSPPRYLLTFHSDSDKHQGSGVPSRFSGSNDASTNAGILLISGLEPADEADYYCKT
Rhinolophus sinicus V127 ighv LVEH01001274.1 19493 VHSEVQLVQPGAEVRKPGASVKVSCKASGYTFTSYGMNWVRQAPGQGLEWMGYINTNSGGTSYAQKFQGRVTVTRDTSTSTAYMELSSLRPEDTAVYYCAR
Rhinolophus sinicus V128 ighv LVEH01001274.1 15557 VHSEVQLVQPGAEVRKPGASMKVSCKTSGYTFTSYWMHWVQQAPGQGLEWMGEIDPSDSYTSYAQKFQGRVTRTRDTSTSTAYMELSRLRPEDTAVYYCAR
Rhinolophus sinicus V129 iglv LVEH01001353.1 13663 SLSQPVLTQPPFVSASPGASARLSCTLSSGFVVGGYVIAWYQLKSGSPPKYLLAFKSDSDKVQGSGVPSRFSGSKDTSANAGLLLIAGLQPEDEADYYCAT
Rhinolophus sinicus V130 iglv LVEH01001353.1 6828 SWAQSVLTQPPSVSGAPGQSVTVSCTGSSSNIGGYYVQWYQQLPGSAPKLLIYGSRNRSSGVSDRFSGSKSGISASLTIRGLQAEDEADYYCQTYDKSLSA
Rhinolophus sinicus V131 trav LVEH01001363.1 48424 VNGRELNQFPQFLLLQEGENFTTYCNSSTIFNNMQWYKQSPGGSPVLLMKLVTAGDVLKRERLRALFGETRKDSSLHIVGAQTADVGTYFCAG
Rhinolophus sinicus V132 trav LVEH01001363.1 27889 VNGQEIKQFPQFLLLQEGQNFTTYCNSSTIFSNMQWYKQSPGGSPVLLMKLVTAGDVLEQERLRAQFGETRKDSSLHIVGAQTADEGTYFCAG
Rhinolophus sinicus V133 trav LVEH01001411.1 15781 IMGDAKSTQPDAMESTEGKPVQLPCNHSTISGSEYIYWYRQIPHQGQEYLIHGLKRNETNGMATLIITTDRKSSALILPQVTVRDSAVYYCIVRD
Rhinolophus sinicus V134 iglv LVEH01001420.1 1377 SLSQPVLTQPPSLSASPGTSARITCTLSSDISVGSYGIYWYQQKPGSPPRFLLYYSSSTSLGFGVPSRFSGSRDTSANAGLLLISGLQPEDEADYYCAI
Rhinolophus sinicus V135 ighv LVEH01001439.1 7645 VLSEVQLQQWGLGLVKPLQTLSLTCAVYEFSITTTGYCWSWIRQPPGKGLEWIGYICSMGGTYYSPSLKSRSSISRDTSKNQFSLQLKSVTTEDTAVYYCAR
Rhinolophus sinicus V136 ighv LVEH01001458.1 13537 VHYEVQLVQPGAEVRKPGASVKVSCKASGYTFTEYGMNWVRQAPGQGLQYMGWINTNTGNPTYAQGFSERCVFSMDTSVSTAYLQINSLKSEDTAVYYCA
Rhinolophus sinicus V137 trav LVEH01001480.1 34439 VNGQQLGQFPQFLLLQEGENFTTYCNSSTTLQVLQWYKQSPGGSPVLLMMLVKAGDVLKQERLRARFGETRKDSSLHIVGAQTADVGTYFCAG
Rhinolophus sinicus V138 trav LVEH01001480.1 26829 GTRAQSVSQPDGHITVSERTSLELRCNYTYGASVSLFWYVQYPSQNLQLLLKYFAGNTLVNGIKDFQAEFKKSESTFHLKKSSAHWSDSGVYFCAVS
Rhinolophus sinicus V139 trav LVEH01001480.1 11160 VNGQELKQFPQFLLLQEGENFTTYCNSSTIFNMQWYKQSPGGSPVLLMMLVTSGDMFKQERLRARFGETGKDSSLHIVGAQNADEGTYFCAGAQCSR
Rhinolophus sinicus V140 trav LVEH01001480.1 3839 GTRAQSVSQPDGHITVSEGTSLELRCNYTYSASVYLFWYVQYPSQNLQLLLKYLAGNTLVNGIKDFQAEFKKSDSTFHLRKSSAHWSDSGVYFCAVS
Rhinolophus sinicus V141 trav LVEH01001492.1 11548 VNGQELKQFPQFLLLQEGENFTSYCNSSTTLNNIQWYKQSPGGSPVLLMMLVKAGDVWEQERLRARFGETRKDSSLHIVGAQTADVGTYFCAG
Rhinolophus sinicus V142 ighv LVEH01001563.1 7196 VLSQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSYYCWSWIRQPPGKGLEWIGRICYDGSTYYSPSLKSRTSISRDTSKNQFSMQLKSVTTEDTAVYYCAR
Rhinolophus sinicus V143 iglv LVEH01001589.1 5696 VDSQTVVTQESSLSVSPGGTVTITCGLSSGSVSTSNYPSWYQQTPGRAPRLLIYSTNSRPSGVPDRFSGSISGNKAALTITGAQPEDEDDYYCALGMGSGI
Rhinolophus sinicus V144 iglv LVEH01001589.1 1333 SSSQAVVTQEPSLAVSPGGTVILTCGSSTGAVTSSHYPHWFQQKSGQAPRTLIYDTNNKLSWTPARFSGSIIGGKAALTLSGAQPEDEAEYYCALWYSNH
Rhinolophus sinicus V145 ighv LVEH01001642.1 8055 VHSEVQLVQPGAEVRKPGASVKVSCKASGYTFTSYYMYWVRQAPGQALEWMGRINPNSGGTDYAQKFQGRVTMTRDTSISTAYMELSSLRPEDTAVYYCAR
Rhinolophus sinicus V146 trav LVEH01001713.1 12645 VSSASNVEQSPQSLHVQEGKSTNFTCRFPSSAFTALHWYRWELGKNPKILFVISLNGDEKQKGRVKATLDTKNGYSFLYIKGSQPEDSATYLCAV
Rhinolophus sinicus V147 ighv LVEH01001875.1 18809 VQCEVQLVESGGNLRPPGGSLRLSCKGSGFTFSDYYINWICQTPGKGLEWVGFIRNKANGQTTEYAASVKGRFTISRDDSKSTAYLQMESLRAEDTAVYYCAR
Rhinolophus sinicus V148 ighv LVEH01002112.1 1837 VHSEVQLVQPGAEMRKPGASVKVSCKASGYTFTSYWMQWVRQAPGQGLEWMGWINPSSGGTNYAQKFQGRVTLTRDTSTSTAYMELSSLKSEDTAVYYCA
Rhinolophus sinicus V149 ighv LVEH01002131.1 23470 VLSQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYCWHWTRQPPGKGLEWIGHICASGSTNYSPSLKSRTSISRDTSKNQFSLQLSSVTTEDTAVYYCAR
Rhinolophus sinicus V150 iglv LVEH01002262.1 2183 SLSQPVLTQPPSLSASPGASARLTCTLSSGFNVGSYTIYWYQQKPGSPPRYLLYYSSSTSLGPGVPSRFSGSKDTSANAGLLLISGLQPEDEADYYCAV
Rhinolophus sinicus V151 trdv LVEH01002323.1 3341 SSVAQKVTQDPPSVSMQEEAAVTLNCRCETNDTDFTVFWYKQLASEEISFLLYQDSYEQNEKKGRYHTNVEKAAKSISFTIAPLKLEDSAKYFCALWQ
Rhinolophus sinicus V152 trav LVEH01002359.1 2730 VSSASNVEQSPQFLYIQEGKSTNFTCHFPSSGFTALHWYRWEPAKSPKILFVIRLNGDEKEEGRVKATLDTKNGYSYLYMKGSQPEDSVTYLCAV
Rhinolophus sinicus V153 iglv LVEH01002450.1 1971 ATSQATVTQEAALSTSPGGTVTLTCGSSTGAVTSSNYVRWVQQKPYQVPRGLIGGTSNRVPGVPERFSGSLLGDKAALTITGTQPEDEAEYYCALWFSNH
Rhinolophus sinicus V154 ighv LVEH01002569.1 646 VYSEVQLVQPGAEVRKPGASVKVSCKASGYTFTDYYMQWVRQAPGQALEWMGQIYAGSGGTNYAQKFQGRVTMTRDTSTSTAYMELSSLRPEDTAVYYCAR
Rhinolophus sinicus V155 ighv LVEH01002942.1 3482 VLSQVQLQQWGPGLVKPSQTLSLTCAVYQFSITTSGYCWHWIRQPPGKGLEWIGCICYDGSTYYSPSLKSRSSISRDTSKNQFSLQLSSVTTEDTAVYYCAR
Rhinolophus sinicus V156 ighv LVEH01003756.1 799 VHSQVQLVQPGAEVRKPGASVKVSCKASGYTFTSYWMQWVRQAPGQGLEWMGQIDPSDSETSYAQKFQGRVTITADTSTSTAYMELSSLRPEDTAMYYCAR
Rhinolophus sinicus V157 trdv LVEH01004161.1 592 FSMAEKVTQAQTTLTVQEGGAVTLDCTYETRWTAYTLHWYKQLPSGEMLFLLYQDYNKGNTKQDRYSVNFQRAKKFISLTISPLQLADSAKYFCALWD
Rhinolophus sinicus V158 ighv LVEH01004310.1 18766 VQSEVQLVQPGAEVRKPGASVKVSCKASGYTFTSYWMQLVRQAPGQGLEWMGWVYAGNGGISYAQKFQGRVTMTRGTSTSTAYMELSSLKSEDTTVYYCAR
Rhinolophus sinicus V159 trav LVEH01006377.1 309 SSVAQKVTQNPPSVSMQEGAAVTLNCLCESSETDFTVLWYKQLASGEISFLLYQELSGQNEKKGCYHTNVKKATKSFSFTIAPLQLEDSAKYFCALWE
Rhinolophus sinicus V160 trav LVEH01016525.1 440 VRGVQVEQSPTALSLQEGASSTLRCKFSTSASNVQWFRQNPGGGLINLFYISSGTKVNGRLTATTDPKERNSSLHISSSQTTDSAVYFCAVEPQCPP
Rhinolophus sinicus V161 trav LVEH01025137.1 327 SYSRPASHIHARGGGITLNCLCESSETDYFTVLWYKQLASREISFLLYQDSSGQAEKKGRYHTNVEKAATSFSFTIAPLKREDSAKYFCALWE