WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Marmota marmota marmota CZRN00000000.1 (CZRN01) 332 37 50 96 93 29 11 16
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Marmota marmota marmota V16 trdv CZRN01000002.1 35604853 KGMLCNQVTQNSEDQTVLSGRELMLFCTYDVSFSNPDLYWYRKRPEGSFQFILYKDNTRSKYADFAQGRFFVKHSPTQKTFHLVMSQVRLEDSATYYCAVN
Marmota marmota marmota V39 trbv CZRN01000036.1 9136314 ARAQTIHQWPTSKVQLVGSPLSLECTVKGASTPNLYWYRWAAGGALHQLFYSVSVGQVDPEMFQNFSASRPQSDQFFLSSKKLLLEDSGFYFCAWS
Marmota marmota marmota V50 igkv CZRN01000064.1 9620437 YNGDNVMTQTPLSLSVPPGQPASISCWSGQSLLPSDGNSYLSWYMQRPGHSPRLLIYMASNRASGVPDKFSGSGSGTDFTLKISRVEAEDVGVYYCQDGLYF
Marmota marmota marmota V51 igkv CZRN01000064.1 9643912 ARCDITMTQSPSSLSASPGDRVTITCRASQNINSWLAWYQQKPGQAPKLLIYKASSLESGVPSRFSGSGSGTDYTFTISSVEPEDAATYYCQQGSNLP
Marmota marmota marmota V52 igkv CZRN01000064.1 9650055 VRCDIMMIQSLSSLPVSPGDRITITCRASQDISSYLYWYQQKPDQAPKLLIYYATSLESGVSSRFSGSGSGTNFTLTISILEPEDATTYYCQQGNSYP
Marmota marmota marmota V53 igkv CZRN01000064.1 9677362 VRCDITITQSPSSLPVSHGDRVTLTCRASQSISNYLHWYQQKPGQAPKLLIRYANTLESGVPSRFSGSGSGTDFTLTISSLEPEDVANYYCQQSNSNP
Marmota marmota marmota V54 igkv CZRN01000064.1 9705310 SIVSSGEIVLMQSPRSLAASQGERVTMTCTASSSISTSYLHWYQQKPGSSPCLLIYRTSTMASGVPECFSGSGSGTSYTLTISSMEAEDVANYYCQYWGSP
Marmota marmota marmota V55 igkv CZRN01000064.1 9742421 VRCDIQMTQPTSSLSASLGDRVTITCRASQSIGTGLAWYQQKPGQAPKLLIYHANNLESGVPSMFSGSGSGTDFTLTISSLEPEDFATYYCQQYNGSP
Marmota marmota marmota V56 igkv CZRN01000064.1 9755818 ARCDITMTQSLSSLSKSLGDRVTIMCQASQSISNYLNWYQHKPGQFPKRLIYGASNLQSGVPLRISGSGSGTDFTLISSSLEPEDAATYFCLQDTVPL
Marmota marmota marmota V57 igkv CZRN01000064.1 9852949 VGCDIQMTQPTSFLSASRGDRVTITCRASQSIGYALSWYQQKPGQATKLLIYSANSLQSGVPSRFSGSGSGTDFTLTISSIEPEDFATYYCRQYSSSP
Marmota marmota marmota V58 igkv CZRN01000064.1 9970889 VKMGTALTQSPALLAVYPGERATITCTTKPKENSKFSWYQQKPGQAPKLLVHGTSTLASGVPARFSGSHLGADFTLTISNVETNDTGTYYCVEWPG
Marmota marmota marmota V59 igkv CZRN01000064.1 10025333 ARCDITMTQSLSSLSKSLGDKVTIMCHETQSISNYLNWYQHKPGQFPKRLIYGAFNLQSGVPLRFSGSGSGADFTLISSNLEPEDAATYFCLQDTVPL
Marmota marmota marmota V60 igkv CZRN01000064.1 10030934 ARCDIQMTQSPSSLSKSVGDRVTISCQASQGIKNYLHWYQQKPGQAPKLLIHWATSMGYGVSSRFSGSGYGKDFTLTISSLEPEDVATYYCLQGYSSP
Marmota marmota marmota V61 igkv CZRN01000064.1 10048566 VRCDITMTQSPSSLPVSRGDRVTITCRASQGISSYLNWYQQKPGQALKLLIYGANSLQSGVPSRFTGSGRGTDFSLTISSLETEDVGTYYCQQGSSFP
Marmota marmota marmota V62 igkv CZRN01000064.1 10063818 FRCDITMIQSPSSLHVTRGDRVTITCRASQRISNRLHWYQKKPGQAPKLHIYGANTLQPGVPSRFNGSGYGTDFTLTISSLEPEDVAIYYCQQGSSSP
Marmota marmota marmota V63 igkv CZRN01000064.1 10067529 TTGEIVLTQTPASVALSPGERVTLTCRASQSVGSYLAWYQKKPGQAPRHLIYGASSRASGIPAQFSGSGSETDYTLSISSLEPEDAAVYYCVQ
Marmota marmota marmota V64 igkv CZRN01000064.1 10108632 SIVSSGEIVLTLSPGSLAASQGERVTMTCTASSSISTSYLHWYQQKPASSPCLLIYRISTLASGVLARFSGSGSGTSYSLTICSVEAEHVAMYYCQQWGSSL
Marmota marmota marmota V65 igkv CZRN01000064.1 10141567 SSGDSVMTQSPLSLSITLGQSVSISCRSSQSLLHSDGNTYLHWVVHKPGQAPRGLIYLVSNWYPGVPHRFSGSGSGTDFTLRINRVEAEDAGVYYCVQS
Marmota marmota marmota V66 igkv CZRN01000064.1 10259105 VRCDIQMTQPTSSMSAYGGYRVTITCRASQSIDYALAWYQQKPGQAPKLLIYSANSLQSGVPSRFSGSGSGTDFTLTINGLEPEDVAIYYCQQYYNSP
Marmota marmota marmota V67 igkv CZRN01000064.1 10270021 ARCDITMTQSPSYLSKSPGERVTITCRASQGISSYLNWYQQKPGQSPKSLIYGASNLQSGVPSRFSGSGSGTDFTLTISSLEPEDFATYYCLQYDKLP
Marmota marmota marmota V68 igkv CZRN01000064.1 10297284 VRCDITMTQSPSSLPVSRGDRVAITCRASQGISSYLNWYQQKPGQALKLLIYGANSLQSGVPSRFTGSGHGTDFSLTISNLETEDVGTYYCQQGSSFP
Marmota marmota marmota V69 igkv CZRN01000064.1 10340240 VRCDITMTQSPSSLPVSPGDRVTLTCRASQGISNYLHWYQQKPGQPPKLLIYYANTLQSGVPSRFSGRGSGTDFTLTINSLEPEDVATYYCQQVSSW
Marmota marmota marmota V70 igkv CZRN01000064.1 10381022 VKCDITMTQSPSSLSVSPGGRVTITCRASEDIYDYLNWYQQKPGQPPKLLIYGASNLQPGVPSRFSGSGSGTDYSLTISSLEPEDVATYYCQQGSSSP
Marmota marmota marmota V71 igkv CZRN01000064.1 10397992 VRCDIMMTQSPSSLPVSHGDRVKITCTASQDISSYLNWYQQKPGQAPKLLIRYANTLESGVPLRFSGSGSGTDYTLTISSLEPEDVADYFCLQYDSYP
Marmota marmota marmota V72 igkv CZRN01000064.1 10439521 SSGDTVMTQSPLSLSITLGQSVSISCRSSQSLLHSDGNTYLHWVVHKPGQAPRGLIYLVSNWYPGVPHRFSGSGSGTDFTLRINRVEAEDSGVYYCVQS
Marmota marmota marmota V73 igkv CZRN01000064.1 10447108 IRCDIQMTQSPSSLTASQGDSVTITCQASENVYSYVAWYQKKQEQAPKLLIYAASNLQSGVPSRFSGSGYGTDFTLTISSLETEDVAAYYCQQCYSA
Marmota marmota marmota V74 igkv CZRN01000064.1 10488555 ITDTDFVLTQTPASVALSPGERATFTCRASQSVGSSLAWYQQKPGQALRRLIYGASSRVSGIPAWFSGSGSGTDYTLSISCLEPGDAAVYYCVQGHTD
Marmota marmota marmota V75 igkv CZRN01000064.1 10537458 VKMGNALTQSPALLTVYPGVRTTITCITNPKENSKFSWYQQKPGQPPKLLVHSTSTLASGVPAQFSGSHSGAYFTLTISNVETNDAGTYYCVEWPEDPS
Marmota marmota marmota V76 igkv CZRN01000064.1 10564574 IRCDIMMTLSPSSLPVSHGDRVTITCRAREGIINRLHWYQQKPRQAPKLLMRYANTLESGVPSRFSGSASGTDFTLTISSLEPEDVASYYCVQSNIYP
Marmota marmota marmota V77 igkv CZRN01000064.1 10580367 ARCDITMTQSPTSLSASPGDRVTITCRANQNINSWLAWHQQKPGQAPKVLINKASNLQSGVPSRFSGSGSGTDYTLTISSLEPEDVATYYCQQDSSYP
Marmota marmota marmota V78 igkv CZRN01000064.1 10612816 ARSDIQLTQSPSPLSVSLGDRVAITCRASQDISNNLNWYQQKPGQAPKCLIYWATNLQSGVPSRFSGSGSGTDYTLTISSLEPEDIATYYCQQYNSSP
Marmota marmota marmota V79 igkv CZRN01000064.1 10622663 TRCDTTMTQSPSSLSKSQGDRVAISCKASQSIGTALAWYQQKAGQTPKLLIYRATSLQPGVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQGYLP
Marmota marmota marmota V80 igkv CZRN01000064.1 10629903 ARCDITITQSPSSLPVSHRERVTITCRASQNVNNWLAWYQQKPGQAPKPLIYKASNLQSGVPSRFSGTGSGTDYTLTISSLEPEDIATYFCLQYDSYP
Marmota marmota marmota V81 igkv CZRN01000064.1 10721113 TSGDIVMTQTPLSQPITPGQSVSLSCRSSQSLLHSNGNTYLHWIVHKPGQAPQGLIYLVSNRYTGVPDRFSGSGSGTDFTLRISRVEPEDAGIYYCYQAKEYP
Marmota marmota marmota V82 igkv CZRN01000064.1 11041187 TSGDIVLTQTPLSEPVTPGQPDFISCRSSQSLLHSNGIMYLYWVVNKPGQARSGLIYQVSIWFTGVSDRFSGSGSETDFTLRISRVEPDDAGIYYCVQYLQT
Marmota marmota marmota V83 igkv CZRN01000064.1 11052837 STGDIVLTQTPLSEPITLGQSASISCRASQSLLNSDGKTYLYWFVHKPGQAPKRLIYQVSNRDTGVPDRFSGSGSGTEFTLTISRVEPEDAGVYYCWQAKELP
Marmota marmota marmota V84 igkv CZRN01000064.1 11141832 TSGDVVLTQTPLSVPINPGQPASISCRSSQNLLHSNGKTYLHWVVHKPGQAPQGLIYEVSNRHTLVSDRFSGSGSGTDFTVRISRVEPDDAGVYYCWQE
Marmota marmota marmota V85 igkv CZRN01000064.1 11162580 TSGDVVMTQNPLSEPITPGESASISCRSSQSLLHSVGNMYLKWVMHKPGQAPKGQIYRVSNRFTGVSDRFSGSGSGTDFTLRISRVEPDDAGIYYCMQILHDP
Marmota marmota marmota V86 igkv CZRN01000064.1 11198497 TSGDVVLTQTPLSEPVTPGQSASISCKSSQSLLYSDGNTYLSWVVHKPGQAPQGLIYQVSNRYSGVSDRFSGSGSGTDFTLRITRVEPEDAGVYYCFQG
Marmota marmota marmota V87 igkv CZRN01000064.1 11252217 TSGDVVLTQTPLSEPVIPGQPASISCRSSQSLLHSDGNTYLYWFVHKPGQAPQGLIYKISNRFTGVSDRFSGSGSGTDFTLRISRVEPEDAGIYYCYQAKENP
Marmota marmota marmota V88 igkv CZRN01000064.1 11280822 TSGDIVMHQTPLFEPITLRQPASVSCKSSQSFIDSAGNTYLSWVVHKPGQAPQGLIYKVSNQYTGVSDRFTGSGSGTDFTLRISRVEPEDAGVYYCVQL
Marmota marmota marmota V90 igkv CZRN01000064.1 11347854 FSGDVVLTQTPLSEPITPGQPASISCRSSQSFLHSDGNTYLHWVVHKPGQDPQSLIYKVSNENTGVSDRFTSSGSGTEFTLRISRVEPEDAGVYYCLQV
Marmota marmota marmota V91 igkv CZRN01000064.1 11356267 TSGDIVMTQTPLSEPITPGQSLPISCRSSQSLLHSNGKTYLYWVVHKPGQAPQGLIYQVFNRYTGVSDRFSGSGSGTDFTLRISRVEAEDAGVYYCWQG
Marmota marmota marmota V92 igkv CZRN01000064.1 11363457 TSGDVVLTQTPLSEPITPGQSVSISCRSSQSLLHSDGNTYLSWVVHKPAQAPKRLIYKVSNRDTGVPDRFSGSGSGTDFTLTIGRVEAEDAGVYYCVQG
Marmota marmota marmota V93 igkv CZRN01000064.1 11377779 SSGDVVLTQTPLSEPVTPGQPASISCRSSQNLLHSNGNTYLNWVVHKPGQVPQGLIYWVSNRYTGVSDRFSGSGSGTDFTLKISRVEPEDAGVYYCWQA
Marmota marmota marmota V94 igkv CZRN01000064.1 11402716 TSGDIVMTQTPVSEPVIPGQPASISCRSSQSILHSNGNTYLHWVVHKPGQAPRGLIYFVSNRYSGVSDRFSGSGSGTNFILRISRVEPEDAGIYYCHQG
Marmota marmota marmota V103 iglv CZRN01000099.1 2907327 SWAQFELTQPHSVSAPPGKTVTISCTRSSDDIGSYYVYWYQQRQGSAPSTVIYEDDKRPSGVPDRFSGSIDSSSNTASLSISDLQIEDEADYYCQSYDSSYN
Marmota marmota marmota V104 iglv CZRN01000099.1 2959078 SWAQFELTQPHSVSASPGKTVTISCTRSSGNIGSYYVHWYQQCQGNAPSTVIYADDQRPSGVPDRFSGSIDSSSNTASLSISGLQIEDEADYYCHSYDSNY
Marmota marmota marmota V105 iglv CZRN01000099.1 3016739 SWAQFELTQPHSVSASPGKTVTISCTRSSGNIGSSYVYWYQQRQGNAPSTVIYADDQRPSGVPDRFSGSIDSSSNTASLSISDLQIEDEADYYCQSYNSSYN
Marmota marmota marmota V106 iglv CZRN01000099.1 3115219 SWGQFVLTQPHSVSASPGKTVTISCTRSSGNIGSKYVHWYQQHQGSAPSTVIYDDDKRPSGIPDRFSGSIDSSSNTASLSISGLQIEDEADYYCQSYDSSYN
Marmota marmota marmota V107 iglv CZRN01000099.1 3173967 LGPVCGDSATLTVWDSRTNAYHLCTGSSNNIGGYYVSWYQQLPEMAPKLLIYGNSNQHSGVPDPFSGSKSGNSASLTITGLQLEDEADYYCQSYDSSLS
Marmota marmota marmota V109 iglv CZRN01000099.1 3210757 VDCQTTVIQEPSLSVSPGGTVTITCGLSSGSVSTGHYPGWYQQNPGLAPRLLIYNTNNRFSGVPDRFSGSIIGNKAALTITGALTDDEADYYCSLYMGSGI
Marmota marmota marmota V110 iglv CZRN01000099.1 3238456 SWAQSVLTQQPSLSGTPGQTITISCTGSSNNIGGYYVNWYQQIPETAPKLIIYDYSKRNSGVSDRFSGSNSGNSASLTITGLQPEDEADYYCQSYDSSLDA
Marmota marmota marmota V111 iglv CZRN01000099.1 3314133 TWAQSVLTQQPSLSGTPGQTVTISCTGSSNNIGYSFVNWYQQFPATAPKLLIYGDSNRPSGIPDRFSGSKSGNSGSLTITGLQPDDEADYFCQSYDSSLNA
Marmota marmota marmota V112 iglv CZRN01000099.1 3338939 SWAQSVLTQQPSLSGTPGQTITISCTGSSTNIGSYSVNWYQQFPETVPKLLIYADSNRPSGVSDRFSGSISGNSASLTITGLQPEDEADYYCQSYDSSLDA
Marmota marmota marmota V113 iglv CZRN01000099.1 3396473 SWAQSVLTQQPSLSGTPGQTITISCTGSSNNIGRYGVSWYQQLPEMAPKLLIYYNSNRPSGVPDRFSGSRSGNSGSLTITRLQPEDEADYYCQSYDSSLSS
Marmota marmota marmota V114 iglv CZRN01000099.1 3451528 SWSQSVLAQQPTMSGTPGATVTISCTGSSTNIGNSYNVHWYQQLPETAPKLLIYSNSNRPSGVPDRFSGSKSGNSGSLTITRLQPEDEADYFCQSYDSSLSS
Marmota marmota marmota V115 iglv CZRN01000099.1 3558993 SWAQSVLTQQPSMSGTPGETVTISCTGSSNNIGIFGVSWYQQFPETAPKLLIYSNSNRPSGVPDRFSGSRSGNSGSLTITRLQPEDEADYFCQSYDSSLNA
Marmota marmota marmota V116 iglv CZRN01000099.1 3687012 SWAQSVLTQQPSLSGTPGETVTISCTGSSNNIDSYYVNWYQQIPERIPKLLIYDNGNRPSGVPDRFSGSRSGNSGSLIITNVRPEDEGDYYCQSYDSSLS
Marmota marmota marmota V117 iglv CZRN01000099.1 3710477 SWAQSMLTQQPSLSGTPGQRVTISCTGSSNNIGDGYYVSWCQQFPETAPKLLIYENSNRPSGVPDRFSGSRSGNSGYLTITGLQSEDKAVYYCQSYDKSLKA
Marmota marmota marmota V118 iglv CZRN01000099.1 3728518 SWAQSVLTQQPSLSETPGQRVTISCTGSSNNIGGGYYVSWYQQFPETAPKLLIYGNSDRPSGVPDRFSGSKSGNSASLTITGLQPEDEAVYYCQSYDKSLKA
Marmota marmota marmota V119 iglv CZRN01000099.1 3752389 SLSQPVLTQSPSVSASLGASVKLTCTLSSQHSTYYISWYQQQPGKAPLYVMYVDSDGSHGKGNGIPDRFSGSSSGADRYLSISNIQNEDEADYLCGV
Marmota marmota marmota V120 iglv CZRN01000099.1 3758412 SLSQPVLTQLPSLSASPGASSKLTCTLSSGFSVGSYRIYWYQQKPGSPPKYLLNYYSESSKHQGPGVPNRFSGSKDTSANVGVLRISGLQFEDEADYYCAV
Marmota marmota marmota V121 iglv CZRN01000099.1 3849851 SWAHSVLTQQPSLYGTPGQRVTISCTGSSNNIGSYDVQWYQQIQEMAPKLLIYYDNNRYSGVPDRFSGSKSGNSASLTITGLQPEDEADYYCQSYDNSLGA
Marmota marmota marmota V122 iglv CZRN01000099.1 3882952 SLSQPVLIQLPSLSASPGASSKLTCTLSSGLSVGSYWINWYQQKPGSPPKYLLSYYSESYKHQGSGVPSRFSGSKDTSANAGVLQISGLQLEDEADYYCGT
Marmota marmota marmota V123 iglv CZRN01000099.1 3915892 SSAQSVLAQQPSLSGNPGQRVTISCTGSSNNIGSNIVQWYQQLPATAPKLLIYADSNRPSGVPDHFSGSKSGNSASLTITGLQPDDEADYYCQSYDDNLGA
Marmota marmota marmota V124 iglv CZRN01000099.1 3985271 SLSQPVLTQLPSLSASLGASSKLTCTLSSGFSVGNYWISWYQQKPGSPPKYLLSYYSESSKNQGTGVPSRFSGSKDTSANAGVLQISGLQLEDEADYYCGT
Marmota marmota marmota V125 iglv CZRN01000099.1 4000570 SWAQSVLTQQPSLSGTPGQKVTISCTGSSNNIGGYYVHWYQQLPETAPKLFIYENSYRPSGVPDRFSGSKSGNSASLTITGLQPEDEADYYCQSYDSSLS
Marmota marmota marmota V126 iglv CZRN01000099.1 4028279 SWAQSVLTQQLSLSGTPGQKVTISCIGSSTNIGDGYTVHWYQQLPEMSPKLLIYSNSNRPSGVPNHFSGSRYGNSGLLTITGLQPEDEADYYCQSYDKSLKA
Marmota marmota marmota V127 iglv CZRN01000099.1 4152254 SWAQSVLTQQPSLSGNPGQRVTISCTGSSNNIGGNYVHWYQQLQEKAPQLLIYDNSDRPSGVPDRFSGSKSGNSASLTITGLQPEDEAVYHCQSYDDSLNA
Marmota marmota marmota V128 iglv CZRN01000099.1 4259847 SQAQSKLIQESSKSASKGEKVTLSCAGNSNNVGTYYVGWYQHILGSAPKTVMLGTTRPSGIPDRFSGSHSGNTATLTITGLQVEDEANYYCSTWDSSLN
Marmota marmota marmota V129 iglv CZRN01000099.1 4283020 STSQAVVTQETSLTTTPEGTVTLTCGSNTGAVTTSNYAKWIQQKPYQVPQGVIGDTTNWVPGVPARFSGSLLGDKDALTITRAQTEDEATYYCALWFSNH
Marmota marmota marmota V130 igkv CZRN01000099.1 4323687 SLSQPVLTQLPSISASSGATVRLSCTLSSGDIVTGYDTTWYQQKPENQSQFLLRYHLDSDKNQGSGVPSHFFGSKDASANAEFLLISGLHQEGKADYYCL
Marmota marmota marmota V131 iglv CZRN01000099.1 4325861 SQAQSKLIQEYSMSASKGETVTLSCAGNSNNVGAYYVGWYQQILGSAPKTVMLGTSRPTGIPGRFSGSYSGNTATLTITGLQVEDEANYYCSTWDKSLS
Marmota marmota marmota V132 iglv CZRN01000099.1 4348431 STSQAVVTQETSLTTTPGGTVTLTCGSSTGAITTSNYAGWVQQKPYQVPQGVIGGTSNRVPGVPARFSGFLLGDKAALTITGAQTEDEATYYCVLWFSNH
Marmota marmota marmota V133 iglv CZRN01000099.1 4379362 SLSQLVLTQPPSASASLGQTAKLTCTLSSGYSSYWVAWYQQSPGKSPRFVMRGGTSGIVGSKGDGIPDRFSGSGSGLDRYLTIQNIQEEDENVYYCGADY
Marmota marmota marmota V134 iglv CZRN01000099.1 4650583 SMASYVLTQPPSVSVTPGQTAIITCSGDKLSENYIHWYQQKSAQSPVLVIYEDSERPSGIPDRFSGSSSGNTATLTISRVQAEDEADYYCQRWDSNAK
Marmota marmota marmota V135 iglv CZRN01000099.1 4780034 FWAQSALTQPPSVSGTPGQSVTITCAGTSSDIGKYNDVSWYRNRPGTTHKLMIYGVSNRPSGIPNRFSGSKTGTTASLTISGLQLEDEADYYCCSYAGS
Marmota marmota marmota V136 iglv CZRN01000099.1 4802548 SVASYVLTQPSSVSVTPGQTARITCGGNNIGSKYVHWYQQKPAQSPLLVIYDNSNRPSGIPDRFSGSKSGNTATLTISGVQAGDEADYYCQVWDSSA
Marmota marmota marmota V137 iglv CZRN01000099.1 4865149 SVVSYELTQPPSVSVAPGQTATIICSGDALPKKYAYWFQQQHPGQSPVQVIYKDSERPSGIPERFSGSSSGTTATLTISRTQTEDEAVYYCLSSYDDSGN
Marmota marmota marmota V138 iglv CZRN01000099.1 4885760 SWSQSALTQPPSASGSIEQPVTISCTGTSNDIEICNNVSWYRNLPGASPQILNYGATNHPSSVPDHSFGSQSGNSASLTISSLQAEDEADYYCCSYTSSSN
Marmota marmota marmota V139 igkv CZRN01000100.1 11995 IRCDIQMTQTPSSLSVSQGDRVTITCQASENIYSYASWYQQKQEQAPKQLIYSASNLQSGVPSRFSGSGSGKYYSLTISDLEPDDVATYYCLQTNSSP
Marmota marmota marmota V140 igkv CZRN01000100.1 39874 VRCDITMTQSPSSLPVSRGDRVTITCKASQGISGYLHWYQQKPGQAPKLLIRNANTLESGVPSRFSGSGSGSDYTLTISSLEPEDVANYYCQQGSSSP
Marmota marmota marmota V141 igkv CZRN01000100.1 50289 SSRDTVIIQSSLSLSFTPGQAASISCRSSQSLLHSNGITYLYWVVHKPCQAPQGLIYGVPNQFTGVPDRFSGSGSGTDFTLRISRVEAEDAGVYYCLKS
Marmota marmota marmota V142 igkv CZRN01000100.1 104884 IRCDIKMTQSLSSLPVSRGDRVIITCRASQGISSYLNWYQQKPVQAPKLLIYVANSLQSGVPSRFSGSGCGIDFTLTISSLETEDVTTYYCQKYSSL
Marmota marmota marmota V143 iglv CZRN01000106.1 46527 SVATYVLTQPSSVSVTPGQTARITCGGNNIGSKNVQWYQQKPAQSPLLIIYEDSKRPSGIPDQFSGSNSGNTATLTISGTQAGDEADYYCQVWDGND
Marmota marmota marmota V144 iglv CZRN01000106.1 75704 SVISYELTQPASVSVALGQTATITCSGDALPKKYAYWFQQQHPGHIPVRVIYKDSEQPSGIPDRFSGSSSGTTATLTISRTQTEDEAVYYCFSWNNDDTQ
Marmota marmota marmota V145 iglv CZRN01000106.1 104377 SVASYMLTQPSSVSVTPGQTTKITCGGNSIGNKYVHWYQQKTAQTPLLIIYRDSNQPSGIPDRFSGSNSGNTATLTISEAQAGDEADYYCQVEDSNA
Marmota marmota marmota V146 iglv CZRN01000106.1 179623 SWSQSALNQPPSASGSSGQTVTISCTGTSNDIGRYNSVSWYRNLSGASPTLLIYGVTNRPSGIPDRFSGSKSGNTASLTISRLQPEDEADYYCCS
Marmota marmota marmota V147 iglv CZRN01000106.1 194567 TVASYVLTQPSSVSVTPGQTARITCEGNSIGSYSVHWYQQKPEQAPVLVIYSSSNRPSGISDRFSGSNSGNTATLTISGAQAGDEADYYCQVW
Marmota marmota marmota V154 igkv CZRN01000119.1 12706 TSGGIVTTQTPLYEPITLGQPASISCRSSQSLVDSGGNTYLSWVVHKPGQAPRGLIYKVFKWFTGVSDRFSGSGSGTDFTLRISRVEPEDAGVYYCSQLTEAP
Marmota marmota marmota V155 igkv CZRN01000119.1 21363 TSGDIVMTQTPLSEPITPGQSVSLSCRSSQSFLHSNGNTYLSWFVHKPGQAPQGLIYRVSNWFTRVSDRFSGSGSGTDFTLKISRVPHDDAGIYYCQQGKELP
Marmota marmota marmota V156 igkv CZRN01000119.1 40599 TSGDIVMTQTPLSEPVTPGQPASISCRSSQSLLHSNGKTYLYWVVHKPGQAPQGLIYQVSNRYTGVSDRFSGSGSGTDFTLRISRVEAEDAGVYYCWQGIEYP
Marmota marmota marmota V157 igkv CZRN01000119.1 54416 TSGDVVMTQTPLSELITPRQPASISCRSSESLLHSDGKTYLHWVVHKPGQAPQVLIYGVSNQFTGVSDRFSGSGSQTDFTLRISRVEPDDAGIYYCVQSLHIP
Marmota marmota marmota V158 igkv CZRN01000119.1 102209 TNGDIVMTQTPLSEPVTPGQSVSLSCRSSQSLLHSNGKTYLSWVVHKPGQAPRGLIYEISNRYTGVSDRFSGSGSGTDFTLRISRVEPEDTGIYYCLQSLQAP
Marmota marmota marmota V159 igkv CZRN01000119.1 115749 STGDIVLMQTPLSEPITPGQSASISCRASQSLLHSDGKTYLYWFVHKPGQAPKRLIYQVSNRDTGVPDRFSGSGSGTEFTLTISRVEPEDAGVYYCWQL
Marmota marmota marmota V163 igkv CZRN01000155.1 219154 ARCDITMTQSPSSLSGSPGDRVTITCRASQSINSWLAWYQQKPGQAPNRLIYKASSLESGVPSRFSGSGSGTDYTLTISSMEPEDAATYYCQQGSNLP
Marmota marmota marmota V164 igkv CZRN01000155.1 225220 VRCDIMMTQPLSSLPVSLGDRVTIACRASQGIGSNFHWYQQKPGQVPKLLIYYATSLESGVSSRFSGSGSGTDFTLTISILEPEDAAIYFCQQGYISL
Marmota marmota marmota V165 igkv CZRN01000155.1 346906 VRCDIMMTQSPSSLPVSPGDRVTITCRASKDIYGNINWYQQKPGQAPKVLMYGANILESGVPSRFSGSGSGTDFTLTISSLEPEDVAHYYCQQSNSNP
Marmota marmota marmota V166 igkv CZRN01000155.1 363296 ARCDIMMTQSPASLSASQGDRFTIICRASQGISNKLNWYQQKQGQAPKLLIKYATSLESDVPSMFSGSGSGTDFTLTIRSQEPEDVANYYCLQ
Marmota marmota marmota V167 igkv CZRN01000155.1 425886 SVGNTVMTQIPLFLSVTPGEPAYISCRSSQSLLDSDGNTYLPWVVHKPGQAPQSLIYKVSNQYPGVPDRFSGSGSGTDFTLRISRVEPEDAGVYYCLQS
Marmota marmota marmota V168 igkv CZRN01000155.1 483122 YSGDVVLTQNSLSVPITSGQSASISCRSSQSLLYSDGNTYLHWYLQKPGQAPKLLIYTVSDQFTGVPDRFSGSGSGTEFTLRISRVEAEDTGVYYCFQN
Marmota marmota marmota V169 igkv CZRN01000155.1 495121 VKMDTALTQSPALLAVYPGESTTITCTTNLKEKSKFSWYQQKPGQPPKLLVHGTSTLASGVLAQFSFSHSGPDFTLTISNMETNDAGTYYCVEWPG
Marmota marmota marmota V170 igkv CZRN01000155.1 524003 SSGDTVMTQSPLSLSITLGQSVSISCRSSQSLLHSDGNTYLHWVVHKPGQAPWGLIYLVSNWYPGVPHRFSGSGSGTDFTLRINRVEAEDSGVYYCVQS
Marmota marmota marmota V171 igkv CZRN01000155.1 590760 SGARCDTTMTQSPSSLSKPQGDRVVISCKASQSTGTAVAWYQQKAGQTPKLLIYRATSLQPGVPLRFSGSGSGTDFTFTISSLEPEDAATYYCQLDYN
Marmota marmota marmota V172 igkv CZRN01000155.1 626875 VRCDIMMTQSPSSLPVSHGDRVTLTCRASQGIVSNLKWYQHKPGQAPKLLIYLATNLQSGVLSMFRGSGSGPDFTLTISSLEPEDFATYYCQQDSSYP
Marmota marmota marmota V173 igkv CZRN01000155.1 711646 TIWDIVMTQTPLSQPVTPGQSVSLSCRFSQSLLHSTYLYWVVHNPGQAPQSLIYLVFNWFTGVPDKFSCSGSGTDCTLRISREEPDNDGIYYCYETKEYP
Marmota marmota marmota V174 igkv CZRN01000155.1 759849 VRPDIQMIQPTPSLSASRGDRVTITCRASHRIGNALSWFQQKPGQAPKPLIYAANSLQSGVPSRFSGSGSGTDYSLTISSLEPEDFGTYYCQQYNSSP
Marmota marmota marmota V175 ighv CZRN01000188.1 38363 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITSGYDWSWIRQPPGKGLEWIGEICSSGNTNYSPSLKSRVSISRDMSKNQFSLQLSSLTTQDWDTYYCAR
Marmota marmota marmota V176 ighv CZRN01000188.1 53007 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYCWHWIRQPPGKGLEYIGYICYNGNTNYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Marmota marmota marmota V177 ighv CZRN01000188.1 72755 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWFRQAPGKGLEWVALIRNKANSYTTEYAASVKDRFTISREDAKNTLYLQMSSLRTEDTATYYCAR
Marmota marmota marmota V178 ighv CZRN01000188.1 90751 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVGEINPSGGTTNYANSVKGRFTISRENSKNTLYLQMSSLRAEDTATYYCAR
Marmota marmota marmota V179 ighv CZRN01000188.1 95984 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVGEINPSGGTTNYANSVKGRFTISRENSKNTLYLQMSSLRAEDTATYYCAR
Marmota marmota marmota V180 ighv CZRN01000188.1 101219 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMDWVRQSPGKGLECVAHIRNKANSYSTVYAASVKDRFTISREDAKNTLYLQMSSLRTEDTATYYCAR
Marmota marmota marmota V181 ighv CZRN01000188.1 104432 VLCQVQLQETGPGLVKPSQTLSLTCAVSGNSITSGYGWSWIRQPPGKGLEYIGHIDSGGSTNYSPSLKSRVSISRDTSKNQFSLQLSSLTTQDTATYYCAR
Marmota marmota marmota V182 ighv CZRN01000188.1 182908 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSYYCWEWIRQPPGQGLEWIGDICYNGNTYYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Marmota marmota marmota V183 ighv CZRN01000188.1 194857 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSDYWWSWIRQPPGKGLEYIGYISYGGSTYYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Marmota marmota marmota V184 ighv CZRN01000188.1 199218 VLCQVQLQESGPGLVKPSQTLYLTCAVSGYSITSDYGWSWIRQPPGKGLEWIGNIWYNGNTNYSPSLKSRVSISRDTSKNQFSLQLSSMTTQDTATYYCAR
Marmota marmota marmota V185 ighv CZRN01000188.1 230971 IQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWVALIRNKANSYSTAYAASVKDRFTISRDNSKNTLYLQMSSLRTEDTATYYCAR
Marmota marmota marmota V186 ighv CZRN01000188.1 243486 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSSYRWNWIRQPPGKGLEWIGGIRNDGDTKYNPSLKSRVSISRDTSKNQFSLQLSSLTTQDRAAYYCAR
Marmota marmota marmota V187 ighv CZRN01000188.1 254342 VQCEVQLVESGGGLVRPGGSLRLSCAASGFTFSDYWMHWVRHAPRKGLEWISFISERSLYINYADSVKGLLTISRDNSKNTLYLQMSSLRTKDTATYYCAR
Marmota marmota marmota V188 ighv CZRN01000188.1 260609 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLEWVGEINPSGGTTNYANSVKGRFTISRENSKNTLYLQMSSLRADDTATYYCAR
Marmota marmota marmota V189 ighv CZRN01000188.1 300515 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYNMYWVHQAPGKGLEWISYISYNSGTIKYANFVKGRLTISKDNAKNTLYLQMSSLRAEDTATYYCTT
Marmota marmota marmota V190 ighv CZRN01000188.1 329494 VLCQVQLQESGPGLVKSSQTLSLTCAVSGFSITTSGYGWSWIREPPGKGLEWIRYISYDGSTNYSPSLKSQVPISRDTTKNQFSLQLSSLTKQDMATYYCAR
Marmota marmota marmota V191 ighv CZRN01000188.1 341456 VQCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYCWEWIRQPPGQGLEWIGDICYNGNTYYSPSLKSRVSVSRDTSKNQFSLQLSSLTTEDTATYYCAR
Marmota marmota marmota V192 ighv CZRN01000188.1 389078 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMHWVRQAPGKGLEWISSIRYDSNSIYYAESVKGQFTISRDNSKNMLYMQMSSLRAEDTATYYCAR
Marmota marmota marmota V193 ighv CZRN01000188.1 396808 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSGYWWSWICQSPGKGLEWIGHICYDGNTYYNPSLKSRVSISRDTSKNQFSLQLSSLTTKDMATYYCAR
Marmota marmota marmota V194 ighv CZRN01000188.1 402062 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSYISSGSSYINYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTATYYCAR
Marmota marmota marmota V195 ighv CZRN01000188.1 407120 VQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSSISTDGSYTYYADSVKGRFTISRENSKNTLYLQMNSLRTEDTATYYCAR
Marmota marmota marmota V196 ighv CZRN01000188.1 428722 VLCQVQLQESGPGLVKPSQTLSLTCAVSGFSITTSDYYWHWICQPPGKGLEWIGYISYGSSTYYNPSLKSQVSISRDTSKNQFSLQLSSMTTQDTATYYCAR
Marmota marmota marmota V197 ighv CZRN01000188.1 461267 VLCQVQLQESGPGLVKPSQTLSFTCAVSGYSITSGYWWSWIRQPPGKGLEYIGSISYDGSTYYSPSLKSRVTISRDTSKNQFSLQLSSLTTEDTATYYCAR
Marmota marmota marmota V198 ighv CZRN01000188.1 484477 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMYWFRQAPGKGLEWISYISGDSSDINYANAVKGRFTISRDNSKNTLYLQMSSLRAEDTATYYCAR
Marmota marmota marmota V199 ighv CZRN01000188.1 532335 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTVSSYWMSWVRQAPGKGLEWISYINTGGSTYYADSVKGRFTISRDNSKNSLYLQMSSLRAEDTATYYCAR
Marmota marmota marmota V200 iglv CZRN01000294.1 48260 SVASYVLTQPSSVSVTPGQTATITCEGNSIGSYLVHWYQQKPAQAPLLVIYEVSKQPSGIPDRFSGSNSGNTATLTISGAQAGDEADYYCQVENSNA
Marmota marmota marmota V201 iglv CZRN01000294.1 109613 FQVQSALTQPPSVSGTPGQSVSISCAGTSSDIGKYNEVSWYQNRPGTTHKLMIYDVSSRPSGIPACFSGSKTGNTASLTISGLQVEDEADYYCCSYAGNYN
Marmota marmota marmota V202 iglv CZRN01000294.1 126963 SVASYVLTQPSSASVTPGQMAKITCEGDNFGSKYVHWCQQKSAQAPAPLLIIYEDSKWPSGIPDQFSGSNSWNTATLTISGAQAGDEADYYCQVWDSSA
Marmota marmota marmota V203 igkv CZRN01000349.1 71229 VRCDIMMTQSSSSLPVSCGERVTITCRDNQGISSYLNWYQQKPGQAPKLLIYGANSLQSGVPSRFSGSGCGTDFTLTISSLEPEDVGTYYCQQCSSSP
Marmota marmota marmota V204 igkv CZRN01000349.1 90102 VRCDITMTYSSSSLPVSHGDRVTITCRASENIYDYLLWYQQKPGQAPKFLICRTDTLQCGVPSRFSGSGSETDFTLTISNLEPEDVGIYYCQ
Marmota marmota marmota V205 iglv CZRN01000366.1 78322 SVASYVLTQPSSVSVTPGQTARITCGGNNIGSKNVQWYQQKPAQYPLLIIYEDSKRPSGIPDQFSGSNSGNTATLTISGAQAGDEADYYCQVWDRGA
Marmota marmota marmota V206 iglv CZRN01000420.1 36985 SVASYVLTQPSSVSVTPGQTARITCGGNSIGSKIVHWYQQKPAQAPLLIIYDDNNRPSGIPDRFSGSNSGNTATLTISGAQAGDEADYYCQVWDGSA
Marmota marmota marmota V207 iglv CZRN01000420.1 76621 FWAQSALTQPPSVSGTPGQSVTISCAGTSSDIGKYNGVSWYQNCPGTTRKLMIYDVSSRPSGIPSRFSGSKTGNTASLTISGLQLEDEADYYCCSYAGS
Marmota marmota marmota V208 iglv CZRN01000584.1 687 SVASYVLTQPSSVSVTPGQTARITCGGNNIGSKNVQWYQQKPAQSPLLVIYGNSNRPSGVPDQFSGSNSGNTATLTISGAHTGDEADYYCQVWDSSA
Marmota marmota marmota V209 iglv CZRN01001621.1 4490 SWSQSALNQPPSASGSVGQTVTISCSGTSNDIEIYNNVSWYRNLPGSSPKILIYGATNRPSSVPDCFSGSQSGNSASLTISSLQAEDEADYYCCSYTSSSN
Marmota marmota marmota V210 ighv CZRN01001859.1 4755 VLCQVQLQESGPGLVKSSQTLSLTCAVSGFSITTSGYGWSWIHEPPGKGLEWIRYISYSGTTNYSPSLKSQVPISRDTTKNQFSLQLSSLTKQDMATYYCAR
Marmota marmota marmota V211 ighv CZRN01003524.1 152 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYSMHWVRQAPGKGLEWISFISERSLNINYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTATYYCAR
Marmota marmota marmota V212 ighv CZRN01007355.1 1996 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYSITTSGYDWSWIRQSPGKGLEWIGYISYGGGTNYSPSLKSRVSISRDTSKNQFSLQLNSLTTEDTATYYCAR
Marmota marmota marmota V213 igkv CZRN01008715.1 2038 SIVSSGEILLTLSPGSLAASQGERVTMTCTASSSIRTSYLHWYQKKPGSSPCLLIYRISTLASGVLARFSGSRSGTSYSLTICSVEAEDVAMYYCQQWGSSP
Marmota marmota marmota V214 trav CZRN01010128.1 609 SSFAQKVTQAQPAMWVQEKEAVTLLCSYDTSETSYGLLWYKQPSSGEMVFLILQNSYTQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRD
Marmota marmota marmota V215 igkv CZRN01011856.1 288 VRCDIMMTQTLSSLPVSPGDRVTISCRASQDISNYLYWYQQKPGQAPKLLIYYATSLESGVSSRFGGSGSGTDFTLTISSLEPEDAATYYCQQGSSYP
Marmota marmota marmota V242 trav CZRN01000002.1 37269666 TLSLAKTTQRISMDAYEGQEVNISCNHTNIATNEYIFWYRQVPHQGPHFVIQGYKTNVANEVASLFIPVDRKSSTLSLHRVTLKDSAVYYCTVG
Marmota marmota marmota V243 trav CZRN01000002.1 37243081 VSRGEKVEQRPSFLSVPEGDSAVIHCTYTDSASTYFFWYKHEPGAGLQLLMQILSNMEKKQDQRLTVLLSKKDKHLSLNITAANPRDSATYFCAAR
Marmota marmota marmota V244 trav CZRN01000002.1 37236038 VKGGNQVEQSPPSLRPWEGDRTSMSCTYSVSVFNGLQWYRQDAGSGLRHLFSMYSAGDVQQKGRLRATLLKGGSSLNITAMQHGDSATYLCAV
Marmota marmota marmota V245 trav CZRN01000002.1 37227519 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTMTSVQWFRQNPGGGLINLFYLASGTKQEGRLKATADAKERYSTLHISTSQLEDSGTYLCAAE
Marmota marmota marmota V246 trav CZRN01000002.1 37218545 VIQGEKVDQHPSTLRVQEGDSAVITCTYSDTASSYFPWYKQEVGKGPQHIIDIRSNKEINQMQRFIVVLDKKAKHFSLNITATEPGDSAVYFCGAS
Marmota marmota marmota V247 trav CZRN01000002.1 37213049 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSETSYGLLWYKQPSSGQMVFLILQTSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Marmota marmota marmota V248 trav CZRN01000002.1 37188061 GVRGQQVEQRPSALRLQEGTSPTLRCNFSTSMQSVQWFRQNPGGSLINLFYLASGTKQEGRLKATADPKERYSTLHISTSQLEDSGTYLCAAE
Marmota marmota marmota V249 trav CZRN01000002.1 37179431 STHGDSVTQMEGQVTMSEGALLTINCTYSATTSAYPTLFWYVQYPGKGLQLLLKAVKANDKVSNKGFEATYNKGATSFLLEKASVQESDSAVYYCALG
Marmota marmota marmota V250 trav CZRN01000002.1 37172736 GVRGQQVEQSPSALRLQEGTSSTLRCNFSTTMTRVQWFRQNPGGSIRSLFFLTSGTKQEGRLKATMNSKERYSTLIISTSQLEDSGTYLCAAE
Marmota marmota marmota V251 trav CZRN01000002.1 37161831 FSQGEKVEQRPSTLSVQEGDSAVINCTYSDSALDYFPWYKQEAGKGPRRIIDIRSNKEINQIQRFIVVLDKKAKHFSLNITATQPGDSAVYFCAAS
Marmota marmota marmota V252 trdv CZRN01000002.1 37153350 SSFAQKVTQAQPAMWVQEKEDVSLLCSYDASDTRYGLLWYKQPSSGEMVFLICQNSYSQQNATEGRYSVNFQKASKSIQLVISASQLGDSGVYFCALRE
Marmota marmota marmota V253 trav CZRN01000002.1 37146440 RTHGNSVTQTEGQVILLEGALLTINCTYSTTGYPTLFWYVQYPGEGPQLLFRVSRSNEKGSNKGFEATYKKKTTSFHLEKASVQESDSAVYYCALG
Marmota marmota marmota V254 trav CZRN01000002.1 37138232 GVRGQQVEQSPSALRIQEGTSTTLRCNFSTNIYSVQWFLQNPGGSLRSLFFLTSGTKQEERLNATMNSKEHFSNLIISTSQLEDSGTYFCAM
Marmota marmota marmota V255 trav CZRN01000002.1 37116656 VSQGEKVEQRPSTLSVQEGDSAVINCTYSDSALDYFPWYKQEAGKGPQLIIDIRSNKEINQIQRFIVVLDKTAKHFSLNITATQPGDSAVYFCAAS
Marmota marmota marmota V256 trdv CZRN01000002.1 37103948 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSETSYGLPWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNFQKASKSIQLVISASQLGDSEVYFCALRD
Marmota marmota marmota V257 trav CZRN01000002.1 37093646 RIRGDSVSQMEGHVTISEGALLTVNCTFSATRSGYTTLFWYVQYPGEGLQLLLKAVKANDKVSNKGFEATYKKDTSSFNLEKASVQESDWAVYYCALG
Marmota marmota marmota V258 trav CZRN01000002.1 37067285 VSQGEKVEQHPSTLSVQEGDSAVINCTYSDSASNYFPWYKQETGKGPQHIIDIRSNKEMNQVQRFIVVLDKKAKHFSLNITVTQPGDSAVYFCVAS
Marmota marmota marmota V259 trav CZRN01000002.1 37060461 SSFAQKVTQAQPAMWVQEKEAVTLLCSYDTSETSYGLLWYKQPSSGEMVFLILQNSYTQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRD
Marmota marmota marmota V260 trav CZRN01000002.1 37048101 VHSQQKAVEQSPEALSVPEGAVASLNCTYSDSASQNFRWYRQYSGKGPKLLISIFSNGEKGEGRFTAQLDTAKRHLFLHIRGSQLSDSATYFCAV
Marmota marmota marmota V261 trav CZRN01000002.1 37037828 GSEAQSVTQPDRHVLVSEGAPLQLRCSYSSSVSPYLFWYQQRPSQGLQLLLKYMSGATLVTGINGFQAELRKNETSFHLRKPSAHWCDSAEYFCALG
Marmota marmota marmota V262 trav CZRN01000002.1 37033127 VNSQQEEGSPRVLTIQEGENATMNCSYKSSTTTLQWYRQDSGKGPALVILIRSNEREKHSGRLTATLDTSTQRSVLSITASQAADAATYFCATD
Marmota marmota marmota V263 trav CZRN01000002.1 37031101 TSMAQKVIQAQTAISVVEKEAVTLDCVYETSDSTYYLFWYKQLLNGELTLLIRQGSYNEQNATEGRYSLNFQKASSSIQLIITASQLMDAAVYFCALRE
Marmota marmota marmota V264 trav CZRN01000002.1 37009832 SSMSQKVTQDQAATSMLEKEAVTLNCAYNATSFSYYLFWYKQSPSGEMILLMDQESYREEKVTEGRFSLNLQKSVSSISLTILALELQDSAVYFCALRE
Marmota marmota marmota V265 trdv CZRN01000002.1 36981588 FSVAQKVIQVQPATSGQLGEAVTLGCSYETSWSAYNLFWYKQIPSGEIIFLIRQGSSGANEISGRYSVQFRRAAKSIKLTISPLQREDSAKYFCALWE
Marmota marmota marmota V266 trav CZRN01000002.1 36953480 GVRGQQVEQSPSVLRLQEGTSPTLRCNFSTTMDSVQWFRQKLGGGLISLFFLASGTKQEGRLKATADAKERYSTLHISTSQLNDSGTYICAV
Marmota marmota marmota V268 trav CZRN01000002.1 36947655 VSQGEKVEQHPSTLSVQEGDSTVINCTYSDGASTYFPWYKQEAGKGPQHIIDIRSNKEINQIQRFIVVLDKKAKHFSLNITATQPGDSAVYFCAAD
Marmota marmota marmota V269 trav CZRN01000002.1 36936573 GSEGDSVIQTEGQMTLSEGSSLTVNCSYETSQYPALFWYVQYPGEGPQLLLKAVKANDKVINKDFEATYDQETTSFHLVKASVQESDMAVYYCALG
Marmota marmota marmota V270 trav CZRN01000002.1 36912318 GVRGQQVEQSPSALRLQEGTSSTLRCNFSTNIYSVQWFRQNPGGSLISLFYLASGTKQEGRLKATVDAKERYSTLHISTSQLEDSGTYLCAV
Marmota marmota marmota V271 trav CZRN01000002.1 36901644 VSRGDKVEQSPSTLSVQEGDSIVINCTYSNSGSVYFLWYKQEAGKGLQMIIDIRSNKEINQIQRFIAVLDKKDKHFSLNITAAQPGDSAVYFCAAD
Marmota marmota marmota V272 trav CZRN01000002.1 36894908 SSFAQKVTQAQPAMWVPEKEAVSLLCSYDTSTGSYDLLWYKQPSSGEMVFLIRQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Marmota marmota marmota V273 trav CZRN01000002.1 36884112 RIRGDSVSQMEGQVTLSEGALLTINCTYSATTSGYPTVFWYVQYPGEGLQLLLKAVKANDKVSNKGFEATHNKEATSFHLEKASVQESDSAVYYCALG
Marmota marmota marmota V274 trav CZRN01000002.1 36873718 GVRGQQVEQSPSALRLQEGASSTLRCNFSTTIYSVQWFRQNPGGGLINLIYLASGTKQEGRLKATADAKERYSTLHISTSQLEDSGTYLCAVE
Marmota marmota marmota V275 trav CZRN01000002.1 36861053 MSQGEKVEQHPSTLSVQEGDSAVINCTYSDSASNYFPWYKQETGKGPQHIIDIRSNKEINQVQRFIVVLDKKAKHFSLNITATQPGDSAVYFCAAS
Marmota marmota marmota V276 trdv CZRN01000002.1 36856945 SSFAQKVTQAQPAMWVQEKEAVSLHCSYDTSETSYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSVVYFCALRE
Marmota marmota marmota V277 trav CZRN01000002.1 36844293 VHSQQKAVEQSPAALSVPEEAVASLNCTYSDSASQNFGWYQQYSGKGPKLLISIYSNGEKGEGRFNAQLNTAKQHLFLHIRGSQLSDSATYLCAV
Marmota marmota marmota V278 trdv CZRN01000002.1 36819597 FSVAQKVIQGQPATSAQEGEAVTLGCSYGTSWSAYDLFWYKLLPSGEIIFLIRQGSSGANKIRGRYSVQFRRAVKSISLTISPLKQEDSAKYFCALWE
Marmota marmota marmota V279 trav CZRN01000002.1 36800553 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTSMDSVQWFRQNPGGSLISLFFLASGTKQEGRLKATMNFQEQYSTLNISTSQLEDSGTYLCAG
Marmota marmota marmota V280 trav CZRN01000002.1 36794644 VSQGEKVEQHPSTLSIQEGDSAVINCTYSDSASTYFPWYKQEVGKGLQHIIDIRSNKEINQIQRFIVELDKKTKHFSLNITATHPGDSAVYFCAAR
Marmota marmota marmota V281 trav CZRN01000002.1 36767692 RTHGDSVTQMEGQVTISEGALLTINCTYSSTSYPTLFWYVQYPGEGPQLLLKAAKANDKVSNKGFEATYNKEATSFNLEKASIQESDLAVYYCALG
Marmota marmota marmota V282 trav CZRN01000002.1 36748902 SSFAQKVTQAQPAMWVQEKDAVSLLCSYDTSDTNYDLLWYKKPSSGEMVFLIRQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRE
Marmota marmota marmota V283 trav CZRN01000002.1 36728116 VSPGNKVEQRPSTLSVQEGDSLVFNCTYSDSGSVYFLWYKQEARKSLQMIIDIHSNKEINQIQRLIVVLDKKAKHFSLNITAAQPGDSAVYFCAAD
Marmota marmota marmota V284 trdv CZRN01000002.1 36722169 YSFAQKVTQAQPAMWVQEKEAVTLLCSYDTSDSRYGLLWYKQPSSGETVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSGVYFCALRE
Marmota marmota marmota V285 trav CZRN01000002.1 36709368 KIHADSVTQMESHVTISEGALLTINCTYSSTRYPALFWYVQYPGEGLQLLLKAVKTNDKVSNKGFEATYNKEATSFNLEKASIQESDAAVYYCALG
Marmota marmota marmota V286 trav CZRN01000002.1 36698344 GVRGQQVEQSPSALRLQEGTSSTLRCNFSTSMTRMQWFRQNPGGGLINLFYLASGTKQEGRLKATANPKERYSTLHISTSQLEDSGTYLCAA
Marmota marmota marmota V287 trav CZRN01000002.1 36690911 VSQGEKVEQRPSTLSVQEGDSAVINCTYSDSGLNYFPWYKQEAGKGFRMIIDIRSNKEINQIQRFIVVLDKKVKHFSLNITATQPGDSAVYFCAAD
Marmota marmota marmota V288 trav CZRN01000002.1 36686813 SSFAQKVTQAQPAMWVQEKEAVSLLCTYDTSAGNYDLLWYKQPSSGEMVFLIRQNSYGQENATEGHYSVNLQKASKSIQLVISASQLGDSAVYFCALRD
Marmota marmota marmota V289 trav CZRN01000002.1 36680397 RTHGQSVTQTESQLTMSEGSILTINCTYSSIGYAYLFWYVQYPGEGPQLLLKAVKANDKGSEKGFEATYRKETTSFHLEKASIQESDTAVYYCALG
Marmota marmota marmota V290 trav CZRN01000002.1 36667834 VHSQQKAVEQSPAALSVPEGAMASLNCTYSDSASRNFMWYQQYSGKGPKLLMFIYSNGEKGEGRFTTQLDTAKRHLFLHIRGSQLSDSATYFCAL
Marmota marmota marmota V291 trav CZRN01000002.1 36659639 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVSPYLFWYQQRPSQGLQLLLKYMSGATLVTGIDGFQAELRKNETSFHLRKPSAHWSDSAEYFCALS
Marmota marmota marmota V292 trav CZRN01000002.1 36654722 VNSQQEEESPRVLSVQEGENATMNCSYKSSTTTLQWYRQDSGKGPALVILIRSNEKEKHSGRLTATLDTSTKRSVLSITASQAADAATYFCATD
Marmota marmota marmota V293 trdv CZRN01000002.1 36645652 TSMAQKVIQAQTAISVVENKAVTLHCVYETREPNYYLFWYKQLPSGKLTFLIRQESYNKQNATEGRYSLNFQKASSSIQLTITASQLMDAAVYFCALEE
Marmota marmota marmota V294 trav CZRN01000002.1 36631907 RSNGDSVTQTAGLVTLVEGAPVTLNCTYQATYSGSFLCWYVQYLDKAPQLLLKSATENQKTESQGFHATLFKKENSFHLQKPAVQPSDSAVYYCAVE
Marmota marmota marmota V295 trdv CZRN01000002.1 36597688 LSVAQKVTQVPPATSGQEGGAVTLECSYETSRSAYNLFWYKELPSGKMMLLIRQSSSGANRREGRYSVQFRRADKYISLTISPLQREDSAKYLCALRE
Marmota marmota marmota V296 trav CZRN01000002.1 36579702 VSRGEKVEQHPSFLSVQEGDSAVIHCTYTDSASTYFFWYKHKPGAGLQLLMQILSSMERKQDQRLTVLLSKKDKHLSLNITAAHPRDSANYFCAAR
Marmota marmota marmota V297 trav CZRN01000002.1 36559509 VKGGNQVEQSPPSLRPWEGDGTSMSCTYSVSALNSLQWYRQDKGTGLRHLFSMYSAGDVQQKGRLRATLLKGGSSLNITAVQHGDSATYLCAV
Marmota marmota marmota V298 trav CZRN01000002.1 36517573 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTMQSVQWFQQNPGGGLISLFFLTSGTKQEGRLKATANPKECYSTLHISTSQLEDSGTYLCAG
Marmota marmota marmota V299 trav CZRN01000002.1 36503090 MSQGEKVEQHPSTLSVQEGDSAVINCTYSDSTSVYFLWYKQEPGKGLQMIIDIRSNKEVNQIQRFTVVLDKKAKHFSLNITATQPGDSAVYFCAAS
Marmota marmota marmota V300 trav CZRN01000002.1 36496545 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSETSYGLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSGAYFCALRE
Marmota marmota marmota V301 trav CZRN01000002.1 36488956 RTHGDSVTQTAGHVTMSEGALLTINCTYSTTTIVYPVLFWYVQYPGEGLQLLLKAVKANDKVSNKGFEATYKKDTSSFNLEKASVQESNLAVYYCALG
Marmota marmota marmota V302 trav CZRN01000002.1 36468195 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVPPSLFWYQQRPSQGLQLLLKYASGATLVTGINGFQAELRKNETSFHLRKSSVHWSDSAEYFCVLG
Marmota marmota marmota V303 trdv CZRN01000002.1 36441272 TSMAQKVIQAQTAISVVEKEAVTLDCVYETSDPSYYLFWYKQLPSGKLTFLIRQDSYNKQNASEGRYSLNFQKASSSIQLTITASQLMDAAVYFCALRE
Marmota marmota marmota V304 trav CZRN01000002.1 36412364 RSNGDSVTQTAGLVTLVEGASVILNCTYQTSYSGSFLFWYVQYLDKAPQLLLKSATENQRTESQGFHATLVKKENSFHLQKPAVQPSDSAVYYCAVE
Marmota marmota marmota V305 trdv CZRN01000002.1 36366216 FSVAQKVTQVQPATYGQEGGVVTLDCSYETSQSAYNLFWYKELPSGKIMLLMHQSSSGANRREGRYSVQFRRADKYISLTISPLQREDSAKYLCALRE
Marmota marmota marmota V306 trav CZRN01000002.1 36348379 VSRGEKVEQRPSFLSVPEGDSAVIHCTYTDSASTYFFWYKHEPGAGLQLLMQILSSMERKQDHRLTVLLSKKDKHLSLNITAAHPRDSATYFCAAR
Marmota marmota marmota V307 trav CZRN01000002.1 36329996 VKGGNQVEQSPPSLRPWEGDGTSMSCTYSVSGFNSLQWYREDAGIGLRHLFSMYSAGDVKQKGRLQATLLKDGSSLNITAVRHGDSATYFCAV
Marmota marmota marmota V308 trav CZRN01000002.1 36327115 GVRGQQVEQSPSALRLQEGTSSTLRCNFSTTMNSVQWLSQNAEGGLISLFFLASGTKQEGRLKATANPKERYSTLHVSTSQLEDSGTYLCAG
Marmota marmota marmota V309 trav CZRN01000002.1 36315959 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSAGSYDLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRDR
Marmota marmota marmota V310 trav CZRN01000002.1 36295716 RTHGDSVTQTAGHVTMSEGALLTINCTYSTTTIVYPVLFWYVQYPGEGLQLLLKAVKANDKVSNKDFEATYKKDASSFNLEKASVQESDSAVYYCALG
Marmota marmota marmota V311 trav CZRN01000002.1 36284063 GVRGQQVEQSPSALRLQEGTSPTLRCNFSTTMNRVQWFQQNPGGGFISLFYLTSGTKQEGRLKATMNFQERYSTLHISTSQLEDSGTYLCAAE
Marmota marmota marmota V312 trav CZRN01000002.1 36271898 VSQGEKVEQHPSTLSVQEGDSTIINCTYSDSTSSYFPWYKQEAGKGPQHIIDIISNKEINQVQRFIVVLDKKAKHFSLNITAIQPGDSAVYFCAARMHDASQ
Marmota marmota marmota V313 trav CZRN01000002.1 36267718 SSFAQKVTQAQPAIWVQEKEAVTLHCSYDTSKTNYGLLWYKQPSGGEMVFLILQNSYGQENGTEGCYSVNLQKASKSIQLVILASQLGDSAVYFCALRE
Marmota marmota marmota V314 trav CZRN01000002.1 36261959 WTHGESVTQTEGQVTISEGSFLTINCTYSSSGYPNLFWYVQYPGEGPQLLLKAMKANDMGSEKGFEAIYKKETTSFHLEKASVQESDSAVYYCALS
Marmota marmota marmota V315 trav CZRN01000002.1 36238849 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVSPYLFWYQQRPSQGLQLLLKYASGATLVTGINGFQAELRKNETSFHLKKPSAHWSDSVEYFCVLG
Marmota marmota marmota V316 trav CZRN01000002.1 36228247 VSSQQGEASPQVLNIQEGENATLNCSYKTDTANLLWYRQDSGKGPALVILIRSNEREKHSGRLTATLDTSTKRSVLSIMTSQAAEAATYFCATD
Marmota marmota marmota V317 trdv CZRN01000002.1 36210755 ISMAQKVIQAQTAISVMEKETVTLDCVYETSYPSYYLFWYKQLPRGKLTFLIRQDSFNEQNATEGHYSLNFQKASSSIQLTITASQLMDAAVYFCALRE
Marmota marmota marmota V318 trav CZRN01000002.1 36184633 SSMSQKVTQDEAAISMLEKEAVTLNCVYNSTSFSYYLFWYKQPPSGEMILLMDQESYREENVTEGRFSLNLQKPVSSISLTILALELQDSAVYFCALRE
Marmota marmota marmota V319 trdv CZRN01000002.1 36141620 FIVAQKVTQVQPVISGQEGEAVTLDCSYETSWSAYVIFWYKQLPSGEIIFLIRQSSPGFSEIRGHYSVWFRKTAKSISLIISPFQREDSAKYFCALSG
Marmota marmota marmota V320 trav CZRN01000002.1 36127234 VRGGNQVEQSPPSLRPWEGDGTSMSCTHSVSGSTGLQWYRQDAGTGLRHLFSMYSAGDVQQKGRLRAMLLKGGSSLNITAVQHGDSATYLCAV
Marmota marmota marmota V321 trav CZRN01000002.1 36116194 DSRAQSVTQPDRQVTISEGNSLELACNYSYGGSFSLFWYVQYPNQGLQPLLKYISGNTLVQGIKGFEAEAKKSESSFNLRKPSVHWSDSAEYFCVLV
Marmota marmota marmota V322 trav CZRN01000002.1 36097332 GVRGQQVEQSPSALRIQEGTSPTLMCKFSTTMNKVQWFRQKPDGGLISLFFLTQGTKQEGRLKATADAKERYSTLHISTSQLEDSGTYLCAAE
Marmota marmota marmota V323 trav CZRN01000002.1 36091738 EKVEQHPSTLSVQEGDSAVINCTYSDSRSSYFPWYKQEAGKGPRIIIDIRSNKEINQVQRFISVLDKRAKHFSLNITATQPGDSAVYFCAADARCFP
Marmota marmota marmota V324 trdv CZRN01000002.1 36084854 SSFAQKVTQAQPAMWVQEKEDVSLLCSYDTSFANYNLLWYKQPSSGEMIFLILQNSYSQKNAAKGRYSLNFQKASKSIQLVISASQLGDSEVYFCALR
Marmota marmota marmota V325 trav CZRN01000002.1 36077837 GIHGDSVTQIENKMTVSEGSFLTINCTYTATGYPSLFWYFQYPGEGLQLFFRVSKANEKGSNRGFQATYNKEATSFHLEKDCVQESDSAVYYCALG
Marmota marmota marmota V327 trav CZRN01000002.1 36058768 VHSQQKAVEQSPAALSVPEGSVASLNCTYSDSASQYFFWYRQYPGKGPKLLISIYSNGEKGEGRFTAQLEKANRHLFLHIRGSQLSDSATYLCAV
Marmota marmota marmota V328 trav CZRN01000002.1 36050933 GSGAQSVTQPDRHVLVSEGAPLQLRCSYSSSVSPYLFWYQQRPSQGLQLLLKYASEATLVTGINGFQAELRKNETSFHLRKPSAHWSDSAEYLCALS
Marmota marmota marmota V329 trav CZRN01000002.1 36044249 GIRAQTVTQPEDHIAVFEGALVQVKCNYSYTGSPVLFWYVQYPGQGLQVLLKHTSSDRTKGFTAALDRGEKSFHLQKPSAHLEDSAIYYCALS
Marmota marmota marmota V330 trav CZRN01000002.1 36036697 VNSQQQEESSWVLSIQEGQNATMNCSYKTSTNNLQWYRQDSGKSPALVILIRSNEKEKHSGRLTATLDTSTKRSVLSITASQAADAATYFCATD
Marmota marmota marmota V331 trav CZRN01000002.1 36025400 TSMAQKVAQDQTAISVMEKEAVTFNCTYEISDDIYYLFWYKQPPRGKPTYLIRQDSYNEQNAMEGRYSLNFQKASSSIQLTITASQLMDAAVYFCALEQ
Marmota marmota marmota V332 trav CZRN01000002.1 36009380 KSHGDSVTQTAGLVTLVEGAPMILNCTYQTIYSVFILWYVQYLDKAPQLLLKSATENQKTENQGFHATLVKKENSFHLQKTAVQTSDSAVYYCAVR
Marmota marmota marmota V333 trav CZRN01000002.1 35964433 VRGMQVEQSPSALILQEGASSTLLCNFSTSANNVQWFRQNPGGRLINLFYIPSGTKQSGRLTSTTVSKERRSSLYISSSQTTDSAVYFCAVDAQCSP
Marmota marmota marmota V334 trdv CZRN01000002.1 35946080 FSMAQKVTQVQPATSGQEGEAVTLDCSYEMSYPTYYIFWYKQLSSGEIIFLIHQSSFGSDERKGRYSVQFSRAAKSISLTISPLQREDSAKYFCALRE
Marmota marmota marmota V335 trav CZRN01000002.1 35937432 VNGEQLKQIPPSLHIQEGEDFTIYCNYSSTIDSLQWYKQKPGGSPVFLMIIVKDGDVKKQGRLTAQLGKTRKDSSLHIVATQATDVGTYFCAV
Marmota marmota marmota V336 trav CZRN01000002.1 35920755 GSKALSVTQPDLHVTVTEGVCLELRCNYSYAATPYLFWYVQYPDQHLEHLLTYLARDTLVKGIKGFEAEFKESESSFNLRKSSAHLSDSAKYFCAPV
Marmota marmota marmota V337 trav CZRN01000002.1 35909117 VSTQQLEQSPKFQNIQEGNNLTVHCNSSSVFTSFQWYRLKPGDGPILLLTLLKGGEVKEQKRLTARFDEARKGSSLHIATAQPRDEGIYICA
Marmota marmota marmota V338 trav CZRN01000002.1 35903869 VRRAQMKVEQSPQVLNLQEGMSSSLLCNYSLSMTSIQWFQQNPGGQLISLFYIASGVQQNGRMKSTVNSKERYSQLFIRDSQPGDSASYFCAVE
Marmota marmota marmota V339 trav CZRN01000002.1 35883595 VRSQQPEQSPQALIIQEREDVTINCSSSKTLYSVQWYRQKHAEGPMFLMMLLKGGEQKSHDKITAMFHEKKQQSSLYIRASRLSHSGTYLCAVE
Marmota marmota marmota V340 trav CZRN01000002.1 35863053 VSSQVLLQSPRSLSIQEGENLTINCNSSQSFYALHWYRQNYDGEFIFLMLFRKGGEEKSHEKLTARLDAKMQQSSLSITAAQPSHSGTYFCGGE
Marmota marmota marmota V341 trav CZRN01000002.1 35842514 VSSEDKVVQSPPSLVVHEGDSATLNCSYEMANFQSLHWYKQEEKAPTFLFILVSSGAEKKLGRLSGSLNKKLSTLHITATQPGDAATYLCAVE
Marmota marmota marmota V342 trav CZRN01000002.1 35809821 ASMAQRVTQSQLEMSVQETETAILDCTYDTRESNYYLYWYKQTASWQMIPIIRQEAYKQENATENHFSVNFQKAAKSLGLKISDSQLGDAAVYFCALQ
Marmota marmota marmota V343 trav CZRN01000002.1 35803035 ASMAQSVTQSQPEISVQEAETATLDCTYDTKDSNYYLYWYKQTASGQMIPIIRQEAYKQENATENRFSVNFQKAAKSLGLKISDSQLGDAAVYFCALQ
Marmota marmota marmota V344 trav CZRN01000002.1 35785228 ITGEVVVEQNPRYLSTQEGEDHTIYCNYSVTSTDRLHWYRQDPGKSLEFLFILPSNGAVKQEGPLTASLDTMARLSTLHITDTQYVLSATYFCAL
Marmota marmota marmota V345 trav CZRN01000002.1 35762990 VNGKNEVEQSPQYLSAQEGELITINCSYSTGMTTLHWLQQNPGRGTVSLFVLSLQMKKNGRMSATINTKESQSSLHIEASQPRDSATYLCAV
Marmota marmota marmota V346 trav CZRN01000002.1 35682356 GSCRTEIIQSSNLAATMGTDVKFQCQYNNLKGNYDSVYWYLQRTNQRLTYIYHTFQGTVESERYQLSVDRKLSSSTLTVKQVQPRDRAVYYCAV
Marmota marmota marmota V347 trdv CZRN01000002.1 35676462 VCLDIILEPHTKTLTVLVGKPATFRCRVTGGDLKNYQMSWYKKNEDNSLFLIYKLNNSTGNLRNNLKGKIDTLKSEFILDIQKTTPQDAGTYYCGSD
Marmota marmota marmota V368 trgv CZRN01000027.1 14291101 SQTSSSLEGRMMSLKRTTASTAVITCDFAEERNFIHWYQLKEGKAPQHLLYHDFYNSKIVMDSGLDPVKYHVYEGTGQRSKFIVRNLEESDSAEYYCAYWSA
Marmota marmota marmota V369 trgv CZRN01000027.1 14277165 GHSLIQLEQPAQVLGHKGSSVFLQCLVHMRVSYIHWYGQQEGQAPQNLLRMGVSRKDVHWDSILKADKITGLNNNNGNSCSLLVLNLGKSEEGMYYCAAWD
Marmota marmota marmota V370 trgv CZRN01000027.1 14230820 SQTSRLEGRMMSVTSSPGSYVPITCDLREASTYIHWYQFKEGKAPRYLLYYNLLNFSVVVDSGIISEKYDANKGPDRRCKLVVRNVDESDSAVYYCAYWT
Marmota marmota marmota V371 trgv CZRN01000027.1 14191723 GLGLSKVEQSEISVSKEIKKSVNINCKISSTSFDTEAIHWYWKKPNKTLEHLIQVTSIKSPARGSLNGKGNKIEAKKYSQTSSSVLTIFSIEKEDAAMYYCAGW
Marmota marmota marmota V373 trgv CZRN01000027.1 14152696 SQTSSSLERRMISVTSSPGSNVVITCDLSSTYIHWYQFKEGQVPRSLLYYNNYNYRVVVDSGISSTKYDAKITDGSYQLIIQNLGDSDSAVYYCAYWT
Marmota marmota marmota V374 trgv CZRN01000027.1 14144420 SQTSFSLEGRMMSVTSSPGSYVSISCDLASTYIHWYQFKEGQAPRRLLYYDFINSKVVRDSGITWIKYSAYKGADGRCKLTVRNVEESDSAVYYCAHWI
Marmota marmota marmota V375 trgv CZRN01000027.1 14124438 SQTSSSLEGRMMSVTSSPGLYVVITCDLASTYIHWYQFKEGLAPRRLLYYDFVNSKVVRDSESTLVKYDAYKGTDGRCKLSIRNVEESDCAVYYCAYWT
Marmota marmota marmota V376 trgv CZRN01000027.1 14097226 SHTSSGLERGMMSVTSKPGSHVPITCDFNEASNYIHWYQFKEGQAPRHILYYNFLQSKVVVSSGIISGKYNANKGPDGRCTFVVQNVEESDSAVYYCSYWT
Marmota marmota marmota V377 trgv CZRN01000027.1 14057788 SHTSSSLERRMMLVTNSPGSHVPITCDLRETNKFINWYQFKEGKVPRYLLYYNFLNCKVVVDSGIISGKYDAYKGPDGKCKLEVRNVEESDSAVYYCAYWT
Marmota marmota marmota V378 trgv CZRN01000027.1 14021614 SQTSSSLEGRIRSVIRSPGSYVIIICEFREANKYIHWYQFKEGKSPRRILYYDIFNFKLDSGINSRKYEADKGKDRRCKFIVRNLEGSDSAVYYCAYWM
Marmota marmota marmota V379 trgv CZRN01000027.1 13961592 VLGELEQPEISISREKDKSAQMSCKAIIQSFESIDIHWYREKPNQGLEHLIYVRTKYNQRTLGGKNKKFEASKYYPTSTSVLTVNFLGKEDEATYYCACWT
Marmota marmota marmota V382 trbv CZRN01000036.1 9473659 HMESGVIQIPSHQVTKVGQMVILSCDPIFGHSFFYWYQQILEQRLEFLVSFYNGKTLEKSEILKDRFSVEKPDKSYFTLKIHLTKLEDSAMYLCASSL
Marmota marmota marmota V383 trbv CZRN01000036.1 9465770 PLHSGVSQTPKYLLAQAGKKQSFKCEQNLGHDTMYWYKQDSKQSLKMMFTYNNKLMIANETVPSRFSPESPDNAHLNLHVKSLEPEDSALYLCASSR
Marmota marmota marmota V385 trbv CZRN01000036.1 9447983 HTHAGVSQSPRHKVTKRGQNAVLRCDPISGHKGLYWYRQTPGQGPAFLMSFLNERAADKSGMPSERFSAERPQGSFSTLEIQLTVQGDSAVYLCASSS
Marmota marmota marmota V386 trbv CZRN01000036.1 9438927 HMEAGITQNPRHIITETGEKVTLRCHQTYNYDYMYWYRQDPGQGLQLIHHSYGVGNTAKGDVSDGYSVSRSNKTDFPLTLESTTRSQTSVYFCATSD
Marmota marmota marmota V387 trbv CZRN01000036.1 9423107 PLDSEVSQTPKYLLAQTGKKQFLKCEQNLGHNAMYWYKQDSKQSLKMMFSYYNKGMTVNEMVPSRFSPESPDKAHLNLHVKSLEPEDSALYLCASSR
Marmota marmota marmota V389 trbv CZRN01000036.1 9407093 LVDAVITQRPRHLILHTGKKTTLECSQNLNHYAMFWYRQDPGQGLKLLHYSDSVGSTAEGEAPQGSSVSRDQKEHFPLTLESPSTSQSSLYLCASSK
Marmota marmota marmota V390 trbv CZRN01000036.1 9397872 HMEAGITQSPRHVITETGEKVTLRCHQTYNYDYMYWYRQDPGQGLQLIHHSYGVGNTAKGDVSDGYSVSRSNKTDFPLTLESTTRSQTSVYFCATSD
Marmota marmota marmota V391 trbv CZRN01000036.1 9380833 PLDSDVSQTPKYLLTQTGKKQFLKCEQNLGHNAMYWYKQDSKQSLKMMFSYYNKEMTFNETVPSRFSPESPDKAHLNLHVKSLEPEDSALYLCASSR
Marmota marmota marmota V392 trbv CZRN01000036.1 9375714 HMEPGVRQAPSHAVTEAGQDVSLSCDPVAGQASLYWYRQTPAKGLEILVSFYNKQRLEKADFFRDRFSAERPEGALSTLKIQPTQLGDSATYLCSSSL
Marmota marmota marmota V393 trbv CZRN01000036.1 9366510 PTKAGITQSPKSQILKIGQRMTLTCAQDMNHDSMYWYRQDPGLGLRLIHYSHNVRNEEKGEVPHGYSASRSSKENFLLTLESPTPSQTSVYLCATSY
Marmota marmota marmota V394 trbv CZRN01000036.1 9345783 HTHAGVSQSPRHKVTKTGENIALRCDPVPGHVSLYWYRQTLGQGLEFLMSFQYERAADKSGMPSEWFSAERPQGSFSTLEIKLTEPGDSAVYLCASSS
Marmota marmota marmota V395 trbv CZRN01000036.1 9342758 LVDAVITQRPRHLILHTGKKTTLECSQNLNHYAMFWYRQDPGQGLKLLHYSDSVGSTAEGEAPQGSSVSRDQKEHFPLTLESPSTSQSSLYLCASSK
Marmota marmota marmota V396 trbv CZRN01000036.1 9329647 HTHAGVSQSPTHRVTKTGQNVTFRCDPIPEHNVLYWYRQTLGQGPEFLMYFQNKIAADKSGMPSERFSAERPQGSFSTLEIQLTVQGDSAVYLCASSS
Marmota marmota marmota V397 trbv CZRN01000036.1 9323682 SVDAEVILSPRHLIRAKGGKGSLKCCPMSGHRSVSWYQQAPGQGPQFLVEYYEKMQRNKGNLPDRFSAEQFDDYHSELNMNSMVLGDSATYLCASS
Marmota marmota marmota V398 trbv CZRN01000036.1 9321241 HLEAEITQSPRHIITETGEKVTLRCHQTYNYEYMYWYRQDPGQGLQLIHYSYTVGNTAKGDVSDGYSVSRSNKTDFPLTLESATRSQTAVYFCATSD
Marmota marmota marmota V399 trbv CZRN01000036.1 9309551 HTDAGVIQSPRHEVTEKRQAVTLRCEPISGHTHLFWYRQTAGQEPEFLIYFSSRSVVDDKGMPKDRFSAEMPSASSSTLKIQPTEPKDSAVYLCASSP
Marmota marmota marmota V400 trbv CZRN01000036.1 9300737 PTDAGVTQTPRHKVTQKGQTVTLRCEPHSNHDTIFWYRQTMVQGLELLVYFNNKLLVDDSGMPKDRFSAAMPEASFSTMKIQPTAPGDSAAYLCASSL
Marmota marmota marmota V401 trbv CZRN01000036.1 9291267 PVSAMVMQNPRYQITRVGKPVTLNCSQTLNHDTMYWYQQKPSHAPKLLLYYYDDQLNKQTDTSDNFQASRPKTSLCSLDVRSAGLEDSAVYLCASSR
Marmota marmota marmota V402 trbv CZRN01000036.1 9288689 SLGQEVTQTPRHLIKGKGQRVKMFCVPIKGHNYLFWYQQILAKQFKFLVSFQYNKVSDQSGMPKERFSAECSQNSSCSLEIQPTELQDSATYLCASSE
Marmota marmota marmota V403 trbv CZRN01000036.1 9268315 LTIADVTQNPRYLIRRRGQEAALRCSPEKGHNNVFWYQQLPEEGLKFMVHLQKENVIDDSGMPRKRYSAEFPREGPSTLKMEPADLEDSAVYICAS
Marmota marmota marmota V404 trbv CZRN01000036.1 9258725 GSGLGAHVSQHPSRAICKSGTSVKIECRFVDIQALTVFWYRQFPKQSFVLMATSNVGSEGTYEQGFVKENFPISHPNASFASLKVTSTHSTNSSFYFCAGS
Marmota marmota marmota V406 trbv CZRN01000036.1 9240954 GSGLGAHVSQHPSRAIGENGTFVNIECRFVDIQATTVLWYRQFPKQSFVLMALSNVGSDVIYEQGFDKEKFLISHPNLSFSSLKVTSAHSADSSFYFCGGS
Marmota marmota marmota V407 trbv CZRN01000036.1 9232556 GSGLGAHVSQHPSRAICESGTSVKIECRFVDFQAQVVFWYRQFPKQGFVLMATSNVGSEGTHEQDFDKEKFPISHPNSSFASLEVTRTHSTDSSYYFCAG
Marmota marmota marmota V408 trbv CZRN01000036.1 9218828 SFVAEVIQTPGHLVKTKGQKAKMHCVPTTGHTAVYWYQQKPNKELQFLIYFQNQEVLEQIEMVKQRFTVEYPQNSPCSLEIQSSEPGDSALYFCASSP
Marmota marmota marmota V409 trbv CZRN01000036.1 9208809 SMDSGVTQTPRKRITKTGKSTVLECSQTKGHDRMYWYRQDPGKGLWLIYFSIGVNDISQGEVSNGYSASRTEKPKFSLTVETATLNQTALYFCASSP
Marmota marmota marmota V410 trbv CZRN01000036.1 9187086 PLEAQVTQNPRYLITKTGKTLTVTCSQNMNHDCMYWYRQDPGLGLQLIYLSINVEMVDKGDISDGYIVSRKENKEFPLTLTSTSINQTSLYFCASSL
Marmota marmota marmota V411 trbv CZRN01000036.1 9183064 LVDTGVTQTPRFLVKRMGEKAVLECLQDMDYERMFWYRQDPGLGLRLIYFSYDADNNDKGDIPEGYSVSRKKRERFSLILESASFTQTALYLCACSK
Marmota marmota marmota V412 trbv CZRN01000036.1 9177679 FVSSVLLYQEPSRSICQHGTSVTIQCQVDSQVSLMFWYRQPPGQGLMLIAIANQDSEATYESGFFKDKFPISRPNLTFSTLTVNTVSPEDSSLYLCSAR
Marmota marmota marmota V426 igkv CZRN01000064.1 11390335 AKCDITMTQSPSSLSKSQGETITISCQASQRINDYLNWYQQKPVQAPKLLIYYTNHLQSGVPSRFSGSGSGTEYSLTISSLEPEDFATYFCLQNDELP
Marmota marmota marmota V427 igkv CZRN01000064.1 11360390 AKCDITMTQSPSSLSKSQGETLTISCRASQGISNYLNWYQQKPGQAPKLLIYYTNRLQSGVPSRFSGSGSGTDYSLTISSLEPEDVAIYFCQQDYSSP
Marmota marmota marmota V428 igkv CZRN01000064.1 11204388 AKCDITMTQSPTSLSKSQGETVTIRCQASQSISNYLSWYQQKPGQAPKLLIYYTNQLQSGVPSRFSGSGSGTDYSLTISSLEPEDFATYYCQQYDDFP
Marmota marmota marmota V429 igkv CZRN01000064.1 11184268 AKCDIIMTQSPASLSKSQGETVTIRCQASQGISNYLSWYQQKPGQAPKLLIYYTNRLLTGVPSRFSGSGSGTDYSLTISSLEPEDFATYYCQQYSSW
Marmota marmota marmota V431 igkv CZRN01000064.1 11091784 AKCDIIMTQSPASMSKSQGETVTIRCQASQGISNYLSWYQQKPGKAPKLLIYYTNHLQSGVPSRFSGSGSGTDYSLTISSLEPEDAATYYCQQYDDFP
Marmota marmota marmota V432 igkv CZRN01000064.1 11083012 AKCDIIMTQSPASMSKSQGETVTIRCQASQGISNYLSWYQQKPGKAPKLLIYYTNHLQSGVPSRFSGSGSGTDYSLTISSLEPEDAATYYCQQYDDFP
Marmota marmota marmota V433 igkv CZRN01000064.1 11062793 AKCDITMTQSPTSLSKSQEERVTISCQASQGIRNYLNWYQQKPGQAPKLLIYYTNRLPSGVPSRFSGSGSGTDYSLTISSLEPEDFATYYCQQGISSP
Marmota marmota marmota V434 igkv CZRN01000064.1 10994492 ARCDFTMTQSPFFLSKSPGKRVTITCRASQGISNYLNWYQQKPGQAPKRLIYDASSPQSGVSTRFSGRGSGTDFTLTISSLEPEGFATYYCLQYDEFP
Marmota marmota marmota V435 igkv CZRN01000064.1 10988874 ARCDIQMTQSPSSLSKSVGDRVTISCQASQGIKNYLHWYQQKPGQAPKLLIHWATSMGYGVSSRFSGSGYGKDFTLTISSLEPEDVATYYCLQGYSSP
Marmota marmota marmota V436 igkv CZRN01000064.1 10961131 VRCDITMTQSPSSLPVSRGDRVTLTCRASQGISSNLHWYQQKPGQAPKLLIYRANNLQSGVPSRFSGSGSGTDFTLTISSLEPEDVATYYCQQHNSYP
Marmota marmota marmota V437 igkv CZRN01000064.1 10882010 VRCDITMMQSPSSLPVSRGDRVTITCRASQGISNNLHWYQQKPGQAPKLLIYWATNLQSGVPSRFSGSGSGTDFTLTISSLEPEDVATYYCQQSNSYP
Marmota marmota marmota V438 igkv CZRN01000064.1 10860247 ARCDITMTLSPSSLPVSCGDSVTITCRASQKINNWLAWYQQKPGQAPKPLIYRASSLQSGIPSRFSGSGSGIDFTLTISSMEPEDVATYFCQQGYLP
Marmota marmota marmota V439 igkv CZRN01000064.1 10823733 ARCDITMTQSPSSLPVSRGERVTITCRASQGISNNLHWYQQKPGQAPKPLIYSANSLQSGVPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQGSSYP
Marmota marmota marmota V440 igkv CZRN01000064.1 10809841 FRCDIMMTQSPSSLPVSRGDRVTLTCRASQGISSNLHWYQQKPGQAPKLLIKYANTLESGFPSRFSGSGSGTDFTLTISSLEPEDVADYYCQQSNSFP
Marmota marmota marmota V441 igkv CZRN01000064.1 10794758 VRCDITMTQSPSSLPVSRGDRVTITCRTRQGISNYLYWYQQKPGQAPKLLIYYTTSVESGVSLRFSGSGSGTDSTLTISSLEPEDAATYFCLQGYSSP
Marmota marmota marmota V442 igkv CZRN01000064.1 10773199 VRCDIMMTQSPSSLPVSRGDRVTITCRASQGISSSLHWYQQKPGQPPKLLIRYANTLQSGVPSRFSGSGSGTDFTLTISSLEPEDVATYYCQQSSSL
Marmota marmota marmota V443 igkv CZRN01000064.1 10706927 ARCDITMTQSPSSLSASPGDRVTITCRASQNINSWLAWYQQKPGQAPKLLIYKASSLQSGVPSRFSGSGSGTDFTLTISSLEPEDVATYYCQQHNSYP
Marmota marmota marmota V444 igkv CZRN01000064.1 10692815 VRCDIQMTQSPSSLPVSPGDRVTIICRASEGIGNFLAWYQQKPGQVPTCLIYDVTRLVSGIPRRFSGSGFGTNFTLTISSLEPEDAATYYCLHYYSYL
Marmota marmota marmota V455 igkv CZRN01000119.1 2773 AKCDIIMTQSPASLSKSEGETVTISCQASQGISNYLSWYQQKPGQAPKLLIYYTNRLQSGVPSRFSGSGSGTDYSLTISSLEPEDVATYFCQQGYLS
Marmota marmota marmota V456 igkv CZRN01000155.1 692525 ARYDIKMTQSPSSLSASPGDRVTITCTASQRINSWLAWYQQKPGQAPKCLIYKASSLESGVLSRFSGRASQTDYTLTISSLEPEDVATYFCLLYYSYP
Marmota marmota marmota V457 igkv CZRN01000155.1 659208 SSGDVVLTQSPLSLSITPGEPASIYCRSSQSLLHSNGNTYLYWYLQKPGQAPQLLIYQVSIRYTGVPDRLSGSGSGTEFTPRINRVEAEDAGVYYCYQA
Marmota marmota marmota V458 igkv CZRN01000332.1 758 ARCDIIMIKSPSSLPVSRRDRVTITCRASQGISNSLHWYQKKPGQAPKPLIYLATSLQSGVPSRFRGSGSGPDFTLTISSLEPEDFATYYCQQDSSYP
Marmota marmota marmota V460 ighv CZRN01000387.1 88961 VQCEVQLVEFGGGLVQPGGSLRLSCAASGFTFSDNWMSWVRQAPGKGLEWVGEINKNSDTINYANSVKGRFTISRDNSKNMLYLQMSSLRVEDTATYYCAR
Marmota marmota marmota V461 ighv CZRN01000387.1 45653 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMDWVHQAPGKGLEWVSYISSGSGTIYYADSVKGRFTISRDNSKNMLYLQMSSLRVEDTATYYCAR
Marmota marmota marmota V462 ighv CZRN01000387.1 44963 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMDWVHQSPGKGLECVAHIRNKANSYSTVYAASVKDRFTISREDAKNTLYLQMSSLRTEDTATYYCAR
Marmota marmota marmota V463 ighv CZRN01000387.1 23220 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYWWSWIRQPPGKGLEYIGYITSGGSTYYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Marmota marmota marmota V464 iglv CZRN01000543.1 31411 FWAQSALTQSPSVSGTPGQSVTISCAGTSNDFWKYNHVSWFQSHPGTTHKLMIHGVSSRPTGIPARFSGSKTGTKASLTISGLQLEDEADYYCCSYAGNYN
Marmota marmota marmota V465 ighv CZRN01000783.1 12738 VQCEVQLVKSGGGLVQPGGSLRLSCAASGFTFSSSGMSWVRQAPGKGLEWIAVIWYDASQKYYADSVKGRFTISRDNSKNMLYLQMSNLRAEDTATYYCAR
Marmota marmota marmota V466 ighv CZRN01000991.1 10193 VLCQVQLQESGPGLVKPSQTLSLTCAVSGYSITSGYWSWIRQPPGKGLEWIGYICYDGNTNYSPSLKSQTSISRDTSKNQFSLQLSSLTTEDTATYYCAR
Marmota marmota marmota V467 ighv CZRN01000991.1 4652 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMHWVRQAPGKGLEWISRISDDSSYINYANSVKGQFTISRDNSKNTLYLQMSSLRTEDTATYYCAR
Marmota marmota marmota V468 iglv CZRN01001861.1 1502 SVASYVLTQPSSVSVTPGQTARITCGGNNIGSKYVHWYQQKPAQSPLLVIYGTSNRPSGIPDRFSGSKSGNTATLTISGVQAGDEADYYCQVQ
Marmota marmota marmota V469 igkv CZRN01002143.1 1832 ARCDITMTQSPSSLSGCPGDRVTITCRASQSINSWLAWHQQKPGQAPKPLIYKASYLQSGVPLRFSGSGSGTDYTLTINRVEPEDAATYYCQQGSNLS
Marmota marmota marmota V470 ighv CZRN01002354.1 2755 VQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYYMYWFRQAPGKGLEWVGQINQNGGSTYYPDSVKGRFTISRDNSKNTLYLQMSSLRVEDTATYYCAR
Marmota marmota marmota V471 igkv CZRN01003098.1 3322 ARCDITMTQSPSSLSGSPGDRVTITCRASQSINSWLAWYQQKPGQAPNRLIYKASSLESGVPSRFSGSGSGTDYTLTISSMEPEDAATYYCQQGSNLP
Marmota marmota marmota V472 trav CZRN01004629.1 2638 VNSQQGEASLQVLSIQEGENATMNCSYKTDITNLQWYRQDSGKSPALVILIRSNEREKHSGRLTATLDTSTKRSVLSITASQAADAATYFCATD
Marmota marmota marmota V473 ighv CZRN01005670.1 457 VLCQVQLQESGPGLVKPSQTLSLTCSVSGYSITTSGYGWSWIRQPPGKGLEYIGYITSGGSTNYSPSLKSRVSISRDTSKNQFSLQLSSLTTEDKATYYCAR
Marmota marmota marmota V474 trav CZRN01005876.1 952 GVRGQQVEQSPSALRLQEGASSTLRCNFSTTIYRVQWFRQKPDGGLISLFFLASGTKQEGRLQATADAKERYSTLHISSSQQEDSGTYLCAA
Marmota marmota marmota V475 iglv CZRN01007275.1 1427 CSESTSISLWVCSQTVTISCSGTSNDIEIYNNVSWYRNLPGASPKILIYGATNRPSSVPDRFSGSQSGNSASLTISSLQAEDEADYYCCSYTSSSN
Marmota marmota marmota V476 trav CZRN01007854.1 1401 SSFAQKVTQAQPAMWVQEKEAVSLLCSYDTSAGSYDLLWYKQPSSGEMVFLILQNSYSQQNATEGRYSVNLQKASKSIQLVISASQLGDSAVYFCALRDR
Marmota marmota marmota V477 igkv CZRN01009403.1 347 TSGDVVLTQTPLSVPITPGQPASISCRSSQNLLHSNGKTYLHWVVHKPGQAPQGLIYEVSNRHTLVSDKFNGSGSGTDFTLRISRVEPDDAGVYYCGQE