WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Microtus agrestis LIQJ00000000.1 (LIQJ01) 70 7 4 32 3 17 5 2
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Microtus agrestis V1 igkv LIQJ01000874.1 131450 ARGDIQVTQSPSSLLESVGERVIITCRTSQDISRYLRWFQQKPGKAPKLLIYGASNLADGVPSRFSGSGSGTGFSLTISSLESEDIADYYCLQYDKYP
Microtus agrestis V2 trbv LIQJ01002491.1 20131 LSEAGVTQFPRYMIIRERQEVSFWCDPISGHNTLYWYLQPRDQSLQFLVYFQNEAVMDDSQLPKDRFSAVRPNGVNSTLKIQSAKLEDSGTYLCASSL
Microtus agrestis V3 trbv LIQJ01002491.1 25689 HTDAGVTQSPKHQVAEKGQTVILTCKPVSGHNDLYWYRQTKAQGLELLRYFRSKSLMEDDKTGKDRFTAEMLKSSVSTLKIQPTEPQDSAVYLCASSL
Microtus agrestis V4 trbv LIQJ01002491.1 43514 STNTGVIQTPRHKVTKMGQEATLSCKPISGHSGVYWYRQTTVRGLEFLISFRNQAPIDDTGMPKERFSAQMPDATLSTLKIQTTQPQDSAVYLCASSL
Microtus agrestis V5 trbv LIQJ01002491.1 51852 CVDTMVMQNPRYKVAMVGKPVNLSCSQSLNHDVMYWYQQKPNQAPKPLLYYYDTTLNKEADTSENFQSNRPNNSFCSLGIRSAGLGDSSIYLCASSR
Microtus agrestis V6 trbv LIQJ01002491.1 68841 TTHSAITQKPKFLIGLQGQRLTVECHQDFNHDTMYWYRQDPGKGLRLIYYSLTETDIQKGELSEGYSVSREKKPFFPLTVTSAQKNQMAVYLCASSI
Microtus agrestis V8 trbv LIQJ01002491.1 83615 SMGTEVIQNPRYLVKGKEQKAKMDCTRIKGHSYVYWYYKKLGEELKFLAYFQNADILDKIDTIGKNISAKCPTDLPCTIEIQSSQLTDSAVYFCASSQ
Microtus agrestis V9 trbv LIQJ01002906.1 1854417 PLETAVFQNPQYLVTQVGNKASLKCDQDLGHDAMYWYKQDSKQSLKIMFIYNNKQLILNESVPSRFSPQSPDKAHLNLQVKPVELGDSAVYFCASSY
Microtus agrestis V10 trbv LIQJ01002946.1 127190 PVSAGITQTPKSMLIKTGQHVTMKCTQDMKHDSMFWYRQDPGLGLRLIYYSYDVGITDKGDVHEGYNVSRSNTENFFLILEPASPSQTSVYFCASSY
Microtus agrestis V11 trbv LIQJ01002946.1 130558 LTNAGVSQSPLYRIIKRGQDTALECDPVSGHRGLYWYRQNLGQGPVFMVFFQDELLSDKSGMSNDRFSAVRPEGSVSTLKIQSTDEEDSGIYLCASSL
Microtus agrestis V12 trbv LIQJ01002946.1 135036 LTDAGITQTPRYWIAQTGRKMTLECSQNMNHNWMFWYRQSAGEGLKLIYYSGSVGSTTKGDVPEGYGVSRNKTENFTLTIGSARPSQTSMYFCASS
Microtus agrestis V13 trbv LIQJ01002946.1 150856 HTKAGVSQSPTHSIIKKGQNVSFRCDPISGHMGLFWYQQKSGQGPEFLIYFQNEVAPDKSGLPGDRFSAERPKGSYSVLKIQPVKQGDSAVYLCASSL
Microtus agrestis V15 igkv LIQJ01004875.1 14057 SRGDIVMTQTPASLTVSLGDQASISCRASKSIVQSSGNTYLEWYLQKPGQSPQLLIYKISNRFSGVSDRFSGSGSGTDFTLKISKVEPEDLGVYYCMQSSFTP
Microtus agrestis V16 igkv LIQJ01005026.1 180855 AKCDIQMTQSPASLSASLGDSVTITCQASENIYSYLAWYQQRPGKSPNLLIYNAKSLAAGVPSRFSGSGSGTQYSLKISSLQPEDIAIYYCQHYYGTP
Microtus agrestis V17 igkv LIQJ01006262.1 16734 SKGQILLTQPAESLHVTPGERVSITCRASQSLLYTDGKHYLSWYQQKKGQPIKAFIYHASVRIDGVPTRFIGSGAGTEFTLTIEDLKLEDFAVYYCLQ
Microtus agrestis V18 trav LIQJ01006697.1 76754 RTQGDSVTQTGGQVTISEGGFLTINCTYTMTNIGSPALFWYVQYPGESLQFLLKVITAGAKGSSRGFEATYDKGSSSFHLEKASVQESDSAVYYCALS
Microtus agrestis V19 igkv LIQJ01006708.1 2596 AKCDIQMTQSPASLFASLGDSVTITCQASQNIGSLLAWYQQKTGSPPKLLIYYANSLAEGVPSRFSGTRSGTQFTLKISSLQPEDVANYYCQQYDSLP
Microtus agrestis V21 igkv LIQJ01009735.1 3659 ACADIVMTQSPSSLAVSAGEQVTISCRSSQSLLAGSTNYLAWYQQKPGQAPKLLIYYASNRYTGVPDRFTGSGSGTDFTLTVSSVQAEDLADYYCQQSRSPP
Microtus agrestis V22 igkv LIQJ01009735.1 33461 ACADTVMTQSPSSLAVSAGEKVTINCKSSQSLLGSEDKKNYLYWYQQKPGQAPKLPIYYASTRHTGVPDRFIGSGSETDFTLTISSVPAEDLGHYYCMQAYDFP
Microtus agrestis V23 igkv LIQJ01010308.1 7999 ARCEIQMTQSPASLSSSLGDSITIKCQAGQNIKSYLAWYQQKQGKPPKLLIYATNRFADGIPPRFSGSGSGTQYSLKISGLQPEDVATYYCQQGFRTP
Microtus agrestis V24 igkv LIQJ01010308.1 26781 ARCEIQMTQSPASLSASLGDTVTITCQASQNIYNALAWYQQKPGKSPKLLIYAASILANEVPSRFSGSGFFTQYSLKIGGLREEDVATYYCLQFRYAS
Microtus agrestis V25 iglv LIQJ01010403.1 167522 SFCQPVLTQSSTVSASLGASVKLTCTLSSEHRTYAIAWYQQQPDKAPKYLMYVLSNGNHGKADGIPDRFSGSSSGAHRYLSISNIQPEDEADYYCGTGDNSRR
Microtus agrestis V26 ighv LIQJ01018977.1 82 VESQVQLLQSEAELGKPGFSVKLSCKASGYTFTDYTMNWVKQRPGQGLEWIGRIASGSTDYAQKIHGKVTLSVDKSSRTAYMELSRLTSEDSAVYYCA
Microtus agrestis V27 ighv LIQJ01018993.1 32143 VLSQVQLKESGPGLVQPSQTLSLTCTVSGFSLTDYDISWVRQSPGKGLEWMGGIWYNGNTEYNSAFQPRITISRDTSKNQVFLKLNSLQSEDTAMYYCTK
Microtus agrestis V28 ighv LIQJ01020419.1 4115 VQSQVLLQQSGAELKSPGSSVKMSCKASGYTFTDYNINWMKQRPGEGLEWIGYINPSNGGTGYAQKFQGKATLTADKSSSTAYMELSSLTSEDSAVYYCA
Microtus agrestis V29 ighv LIQJ01024039.1 73129 VVSQVQLHQSGPELEKPGSSVKLSCKASGYTFTYNYISWVKQRPGQELEWIGWIYPGSGSTDYNEKFQGKAKLTADKSSSTAYMELSSLTSEDTAVYFCA
Microtus agrestis V30 igkv LIQJ01024080.1 2025 GRCDIQMTQSPSSLSVSLKDRVTITCHASKDISDYLSWFLQKPGKSPKRLIYRANSLSDGVPSRFSGSGSGTDFTLTISSLEPEDTATYYCLQSKE
Microtus agrestis V31 igkv LIQJ01030221.1 4787 SRCDIQMTQSPSQTASLGDTVTIKCQASQNINDELTWYQQKPGKSPKLLIYAASRLFAGVPSRFSGSGSGRDFTLTISSVETEDIATYYCKQDLTY
Microtus agrestis V32 igkv LIQJ01035775.1 3436 SRGDIQVTQSPSSLSASLGDRVTITCRTSQDVSRYLQWFQQKPGQAPKLLIYRASNLEDGVPSRFSGSGSGTDYSLTISSLESDDIATYYCQQYDKYP
Microtus agrestis V33 iglv LIQJ01081066.1 361 SCAQFVLTQPNSASGSLGSTVTISCKRSSGNIGGSFVYWYQQHVGSSPTNVIDYDDHSLSEIPDRFSVSIDSSSNSASLTITDLQIEDEADYYCQSYDDSDY
Microtus agrestis V34 igkv LIQJ01229968.1 146 IRCDILMTQSPSSLSVSLGDKVTISCRASQGISVYLNWYQQKPGEAPKLLIYRASSLENGVPSRFSGSRSGTDFTLTISSLEPEDIGTYYCQQHNNYP
Microtus agrestis V35 iglv LIQJ01001439.1 31762 TCAQFVLTQPNSVSGSLGSTVTISCKRSSGNIGSRYVHWYQQHVGSPPTNVIYKDDKRPSGIPDQFSGSIDSSSNSASLTITDLHIEDEADYYCQSYDDSGY
Microtus agrestis V36 trbv LIQJ01001939.1 88854 LLNAKVIQNPRYLVKGKKQKAKMSCSPEKGHPVVFWYKQNNNNEFTFLISFQNQEVLQQIDMVKNRFSAECPSNSPCSLEIQSSEAGDSALYLCASSL
Microtus agrestis V37 trbv LIQJ01001939.1 48571 STEAQVSQAPRHLITETGKKLIITCSQNMNHDYMFWYKQDSGLGLKLIYYSINAGRLDKREVSDGYSVSRREKEAFPLSLESTKISQTSLYLCASS
Microtus agrestis V38 trbv LIQJ01001939.1 36608 SVFSVLVSQKPQRLICQSGTSLKIQCVLDSQVAGMFWYRQIPGQSLVFMAAANEGSEATYEKEFNKDKFPISRPNLTFSTLTVSNARPEDSSFYFCSAG
Microtus agrestis V39 igkv LIQJ01002123.1 692 AICDIQMTQSPSSLHASLGDKITITCRASQGISNYLNWYQQKPGKSPKLLIYYTNNLVNGIPSRFSGSGSGTDYSLTISSLESEDIATYYCQQGYYNNP
Microtus agrestis V40 ighv LIQJ01002519.1 119547 VQCDPQLVETGGGLVQSGGSLKLSCSASGFTFSDYWMNWIRQAPGKGLEWVGVIKHKPNNYETSYAASVKGRFTISRDDSKSVLYLQMNSLRVEDTAIYYCAS
Microtus agrestis V41 igkv LIQJ01002902.1 15910 VQCDIHMTQSPVSLSAFIGDTVTITCQASQDIGRYLGWYQQKPGESPKFLIYYASNLLADVPKRFSGSGSGTEYLLTIISLEPEDSGIYYCQQCYSYP
Microtus agrestis V42 igkv LIQJ01002902.1 2884 SRGDIVLTQSPATLSVIPGDRVILTCRASQGINSYLHWYQKKTNEAPKLLIKYASQSISGIPSRFSGSGSGTDFTLSINNLEPEDIAVYYCQHDYSWH
Microtus agrestis V43 trgv LIQJ01003021.1 79159 RQTSPNLEERIMSITRTVGSSVKITCDVRIISSYIYWYRFQEGRTPQYLLSYNIISSTTVVDSGLSLEKYHVYEGTDKTYKFVLRNVEESDAGLYYCAIWT
Microtus agrestis V44 trgv LIQJ01003021.1 68393 GLGKVEQPEISVTRATDETAQISCKVSINSFKSVVIHWYRQKPNQGLQFLLHVMATPTHILLDETKKMEASKNSSASTSTLTIYSLKEEDEAIYYCSYG
Microtus agrestis V45 trgv LIQJ01003021.1 62059 TGGSIPTSHLMSYITKRKGDTAFFECQFKIILRHDTYIHWYRQKPGQPPKRMLCLNSRGNIIYEKGFSEERYEAKQWQSDLSSNLRIYQVTEEDTGIYYCAYWV
Microtus agrestis V46 trgv LIQJ01003021.1 59654 GDYWISQDQLSFTRRPNKTVHISCKLSGVPLQNTIVHWYQLREGEPIKRIFYGSAKTQKQDKLNSRLETDEKSDGTFYLIINNVIRADEATYYCACWD
Microtus agrestis V47 trgv LIQJ01003021.1 35156 GLGQLEQPEMSVTKAIGESAQIACKISPDHSNTDIHWYRQRENQQFDYLINVRQNYNQRPLDGINKKIEVSKDRQTSTSTLKVNFLKKEDEAFYYCAIWT
Microtus agrestis V48 ighv LIQJ01003341.1 111692 VHSQGQLQQSGPELVRPGTSVKLSCRASDDITYHYIHWVKQSPSGGLEWIARIHSEGDNTKYNQKFKGKAILTTDTFSSTAYMELRSLTSEDSAVYYCA
Microtus agrestis V50 igkv LIQJ01003972.1 42057 SWGQVVLTQSPESTAAFQGEKVTISCISSVSTGYFYWYQQKPKASPKLLIYEVTKLASGVPARFSGSRSGSSYSLTISSIEAEDAATYYCQQGYSY
Microtus agrestis V51 iglv LIQJ01004214.1 28016 SWAEVVFTQPQSLSGSLGQKMTISCTRSTGNIGSNYVYWYQQHSASAPRLLIYNYDQRPSGVPNRFSGSKDSSSNSGTLTISGLQAEDEADYYCLSGYDKH
Microtus agrestis V52 igkv LIQJ01004540.1 18538 IRCDILMTQTPSSLSASLGETVTISCLASQGISSYLNWYQQKPGKAPKLLIYGASYLENGVPSRFSGSGYGTDFTLAISSLEPEDTGIYYCQQASNLP
Microtus agrestis V53 igkv LIQJ01004540.1 6938 IRCDILMTQSPSSLSVSLGERVTISCQASEGISNYLSWYQQKPERPPKPMIYRASNLENGVPSRFSGSGSGTDFSLTISSLEPEDTGIYYCLQTKSLP
Microtus agrestis V54 trbv LIQJ01004811.1 78375 VGAQIIHQQPAVSVQPVGSSLSLECTVKGQSSPNLYWYWQDKGGTLQQLFYSISVGDVVSVTARNLSASRPQDGQFILSSEKLLLSHSGFYFCAWS
Microtus agrestis V55 igkv LIQJ01005769.1 82466 VSCNIQMTQSPLTVSASLGDRVTITCHASQNINNWLVWYQQKPGNAPVLLIYKTSNLQTGIPSRFSGSGSGTDYTLTIDNLQPEDVATYFCMQHQSC
Microtus agrestis V57 trdv LIQJ01006320.1 83187 VSLDVNLEQVDQITVVAGDRAIFNCTVTGGDLRKFQMSWYKKSEDNALILVYKLNNNSTEDLMGNFKGKIDISESRFILDIQKATTKDAGTYYCGSD
Microtus agrestis V58 igkv LIQJ01006708.1 154060 ARCDIQMTQSPSTLSASLGESVTIICLASQEINGHLAWYQQKPGECPKLLIYGTNSLADGVSPRFSGSRSGSQYSFKIGSLQSEDAATYYCHQGDN
Microtus agrestis V59 igkv LIQJ01006708.1 63855 ARCDIQVTQSPSSLSASLGDRITITCRTSQGVSNYISWYQQKPGEVPKLLIYYASTLQSGVPQRFSGSGSGTDFSFTISRLEPEDIATYYCMQGQGW
Microtus agrestis V60 igkv LIQJ01006708.1 55669 SKGEIVLIQSPAYMTASSGGKVIITCRASSSINSNYFHWYQQKPGASPKLLIYSTSYLAAGVLDRFSGSGSGNSYFLTISCMQDEDAATYYCQHGSSS
Microtus agrestis V61 trdv LIQJ01006977.1 15966 SSIAQKATQEQRVINKKEGEQVTLDCSYETSKSFYQLYWFKQTPSGEMIFLIRQISSSHHNESSGRYAVIFQKSAKSISLIISASQVEDSMNYFCALGEP
Microtus agrestis V62 igkv LIQJ01008621.1 47977 ACADIVMTQSPSTLAVPAGEKVTISCRSSQSLLYSALRKNLLNWYQQKPGQSPKLLIYYASTRDTGVPDRFIGSGSGTDFTLTISSVQAEDVAVYYCQQGRSDP
Microtus agrestis V63 igkv LIQJ01008621.1 28089 STRDIVLTQSPTSLAVSLGQSVTISCKSSGSVNKFGINLMHWYQKKPGEPLKLLIYNEGIRPSGIPARFSGNEASLDFTLTINTVEADDAATYYCQQGIDFP
Microtus agrestis V64 igkv LIQJ01009847.1 10450 SSSDVVMTQSPLSLTVSLGDQGSISCRSSQSLVASDGYTYLYWFLQKPGQSPQLLIYEVSNRFSGVSDRFSGSGSGSDFTLKISRVEPEDLGVYYCMQA
Microtus agrestis V65 igkv LIQJ01010308.1 15422 MICDIQMTQSPSLSASLGDRVSITCRASTSIGYGLAWYQQKPGSSPKLLIYQAANLESGLPSRFSGSGYGADFTLTISSLQPEDVATYYCQQYFDTP
Microtus agrestis V66 trav LIQJ01012329.1 2069 VSRGEQLEQQPSFLSVQEGGNAVINCTYTDSANYYFYWYKQETGAGLQFLLSILSNVDRKEEQEFTVLLNKEEKHLSLIITAAHIKDSATYFCATS
Microtus agrestis V67 igkv LIQJ01020662.1 12003 ASGDIVLTQDAHSIPVTPGESASISCRSSKSLLHSDGKTYLHWYRQKPGQSPELLIYLISNRATGVPDRFHGSGSGTDFTLKISRLEVEDVGVYFCQQGLGHP
Microtus agrestis V68 trbv LIQJ01026002.1 12689 FGDAAVTQIPRHLIKMKGQKATMKCSPEKGHTAVYWYQQKQDKELRFLIYFQNKQPLDQIDMVKERFSVEFRSDSDCSLEIKSSESRDSALYLCASSQ
Microtus agrestis V69 trbv LIQJ01026002.1 9832 SFDAEVIQIPRHLVKEKGQKANMDCFPEKGHTAFYWYHQSQKEFKFLINFRNEEIIEQTDMVKKRFSAKCPSNSPCSLEIQSSEAGDSGLYFCASSQ
Microtus agrestis V70 trav LIQJ01028177.1 716 VSSQQKVQQNPEFLSISEGATASLNCTFSDSASQYFWWYRQNPGKEPKALMYIISNGEKKEGRFTVQLNKSSLLVSLHIKDSQPSDSAVYLCAV
Microtus agrestis V71 igkv LIQJ01038209.1 4953 ARCDIQMTQSPASLSASVGESVTITCQPSESIGWGLAWYQQKQGDPPKLLIKAGNELANGVTSRFSGSRSDPQYSLKISSLHPEDVATYYCQQYNKYP
Microtus agrestis V72 igkv LIQJ01040013.1 3763 VRCAIQLIQSPSSLSVSLGDTIAISCQASQGVSNYLNWYQQKPGEAPKLLIYSASNLANGVSSRFSGSGYGTDFTFTISSLEPEDIGTYYCEQYKNYL
Microtus agrestis V73 igkv LIQJ01043083.1 2415 SRCDIQLIQSPSILSASLGDKVTITCRASKNIDIYLHWYQQKHGEAPKLLMYRATNLQSGVPSRFNGIGHGTYFTIMISSLESEDVATYYCLQSLIP
Microtus agrestis V74 igkv LIQJ01083951.1 2834 ARCDIQVTQSPPFLSASPGDKVTITCLASQGISDDLNWYQQKSGQAPTLLIYYANRLQSGVPSRFSGQYSGKSFTLTIGSVEPEDVGTYFCLQHYST
Microtus agrestis V75 ighv LIQJ01090233.1 402 ALSQIQMKESGPGLVNTSQSLSLTCTVSGFSLASYSIHWLRQPPGKGFEWMGEIWGDRSTSYNSAFQSRITITRDTSKSQVFLKLNSLQTEDTAVYYCAR