WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Lycaon pictus LPRB00000000.1 (LPRB01) 77 11 21 5 14 14 7 5
Lycaon pictus LPRA00000000.1 (LPRA01) 81 14 20 5 16 15 6 5
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Lycaon pictus V13 trav LPRB01000005.1 14276189 TDAQVVQVNDSMYGFIGTDVVLHCSFTNPLPSVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELDDEGVYICEF
Lycaon pictus V43 trav LPRB01000008.1 2230448 VTGMKVEQSPSALSLQEGASCTLKCNYSSTPDNVQWFRQNPGGGSLTRLFYIASGMKQSGRLNCTLNAKERFSTLHVAASQLEDSAPYLCAVE
Lycaon pictus V44 trav LPRB01000008.1 2376658 QTHGDSVKQMEGQVTLSEEASLTINCTFSTSVTPTLFWYVQYLGEGPQILLKALRDKEKGSNKGFEATLDSSSKSFQLKKGSVQMSDSAVYYCVMS
Lycaon pictus V45 trav LPRB01000008.1 2447298 MTSQQKGVEQSPGSLSTPEGTTASLNCNYSDSASQYFMWYRQYSGKGPELLMNIYSKGEKEEGRFAVQVDRAKQYVSLLIRDSQPSDSATYLCAVS
Lycaon pictus V46 trav LPRB01000008.1 2451496 GTGAQSVSQPDAYVTVSEEAPVELRCSYSSSIQPYLYWFVQYPNQGPQLLLQYTLKGALVKGIKGFEAEFKRNETSFHLRNPSAHGSDTAKYFCALS
Lycaon pictus V47 trav LPRB01000008.1 2493516 VSSKQEVKQSPEALSVRERDSVVLSCNFTDSAIYSLQWFRQDPGKGLTLLLLIQSNQKEQTSGRIKVWLDMSSRQSTLYITASQPSDSATYLCAV
Lycaon pictus V48 trav LPRB01000008.1 2507617 GTGAQSVTQPDAHITVPEESPLELRCNYSYGATPYLYWYVQYPNQGLKLLLRYFSGDTVVQGIKGFKAEFSKTSFHLKKPSAHWSDSAKYFCAAS
Lycaon pictus V49 trav LPRB01000008.1 2512679 VTGMEVEQRPLVESVLEGASPTLQCNFSTSATSVQWFRQDPGGHLVHLFYIPSGTKHNGRLNSTTVTKERRSSLYIFSSQTTDSAIYFCAVK
Lycaon pictus V50 trav LPRB01000008.1 2551191 INGQEIKQNPQFLLLQEVEDFTIYCNSSSTLNGLQWYKQRPGDGPVLIKLFKGGEVKQKRLTAQLGETRKDSSLHKAASQTADAGTYFCAGSTVLS
Lycaon pictus V51 trav LPRB01000008.1 2568766 KSTQLLQQSPRSLSIQEGENFTTYCNFTSTFPSFQWYRQKPGAGPVHLMTLSKGGEVKKQKSLTALFGEARKDSSLLIIAAQPGDAAIYFCAGS
Lycaon pictus V52 trav LPRB01000008.1 2574850 IRVQMKVEQSPGVLILQEGRNASMMCNYSIAVTSVQWFQQNHEGHLTSLLYIVSGMKQKGRLKFTADTKERNSHLYITDSQPGDSVTYFCTVE
Lycaon pictus V53 trav LPRB01000008.1 2610018 IMSETKTTQPNVMESTEEEPVHLPCNHSTISGNEYIHWYRQIPQQSPEYMIHGLKDNVTNGMATLIIAVDRKSSTLILPWITLRDAAVYYCIVKE
Lycaon pictus V55 trdv LPRB01000008.1 2669944 SSMAQKVTQTQPDISVRDTETVTLNCMYDTSDSNYLFWYKQPPSREMILIIRQEAYRQENATNNRFSVNFQKGSKSFSLRISDSRLEDAATYFCALME
Lycaon pictus V56 trdv LPRB01000008.1 2677681 SSMAQKVTQTQPEMFVQKTETVILHCTYDTSDSDYYLFWYKQPPSREMILIIRQEVYRQDNATNNRFSVNFQKGNKSFSLKISDSRLEDAAMYFCVLAG
Lycaon pictus V57 trav LPRB01000008.1 2708442 RTHGNSVKQTDQITVLEGTSVTMNCIYTFTQYPTLFWYVQYPNKALQLLHKETMENSKNFGARNIKDKNSPITKSSVQVSNSAMYYCLLRDTHNAK
Lycaon pictus V58 trdv LPRB01000008.1 2750321 SSNSETVRQSQNKVYKQEGESVTLDCSFTLSFNYYVMNWYQQPFGERMTEVMSIYSDSTSSSKGRYSVSFQKGNKILTLTITGLTLTDSGVYFCAVGEV
Lycaon pictus V59 trdv LPRB01000008.1 2788668 VSLDIILEPETKTLTVLVGEPATFRCNVTGGDLKNYQVSWYRKNEDNSLTLIYRQSNNTNDNLRSNFKGNTDASKSQCILDIEKATTANAGTYYCAAD
Lycaon pictus V83 trbv LPRB01000016.1 6754048 VRAQTIHQRPLARVQLVGSLLSLECTVQGASSPYLYWYRQSLRGAPQLLFSSLSVTQIVPETPHNFTASRPQNGQFILSSKKLLLSDSGFYLCAWS
Lycaon pictus V101 igkv LPRB01000017.1 37467036 CGGRHILTQFPETLAVSPDSFISITCQSSMDIGTSMAWYQQKPGEAPRLLIFGAYARAAGTPSRFQGSGSGSDFSLTIHGVEAEDMGVYYCQ
Lycaon pictus V102 igkv LPRB01000017.1 37505470 SSGEVVMIQTPLSLSVSPGEPASISCRASQSLWHSNGNTYLYWYLQKPGQSPQLLIDLVSNRFTGVSDRFSGSGSGTDFTLRISRVEAEDVGVYYCMQS
Lycaon pictus V103 igkv LPRB01000017.1 37526945 ITGEIVMTQSPDSLSLSQEKKVTITCQASQSVSSYLAWYQQKPGQAPKLLIYGASNKATGVPSRFSGSGSGTDFTFTISSLEPEDVAVYYCQQYNSGY
Lycaon pictus V104 igkv LPRB01000017.1 37543411 STGEAVMTQTPLSLAVTPGELATISCRASQSLLRSDGKSYLNWYLQKPGQTPRPLIYEASKRFSGVSDRFSGSGSGTDFTLKISKVEAEDVGVYYCQQSLHFP
Lycaon pictus V105 igkv LPRB01000017.1 37617199 SSGDIVMTQTPLSLSVSPGETASISCRANQSLLHSNGNTYLDWYMQKPGQSPQGLIYRVSNHFTGVSDRFSGSGSGTDFTLKISRVEADDAGVYYCGQG
Lycaon pictus V112 trgv LPRB01000018.1 11370800 GGAGLKLEQTPVVVGRLGTSATLLCTVDSSVYYIHWYFHKKFAAPKRLLYLDMSSSSVQRDTSVKADKVNAKKGKDSYSCNLLVQKLEKSDEGVYYCAAWE
Lycaon pictus V113 trgv LPRB01000018.1 11429775 GGAGLNLEQNPVAVERLDTLAILKCQVDTWVWYINWYFHQEGTAPKWLLYLDMSTGKVQRDAFVNADKVSAQKGKDSYSCALLVQRLRKSDEGVYYCAAWE
Lycaon pictus V114 trgv LPRB01000018.1 11485498 GGAGLKLEQTPVVVVHLGTSATLPCTVDSSVYYIHWYFHREGIAPKRLLYIHTYSSSVQRDASVNMDKVNAKMDKNNYSCKLLVQKLEKSDEGVYYCAAWE
Lycaon pictus V115 trgv LPRB01000018.1 11504960 GLVAFSLEQPSVVVARMDTLAILPCKASTKISHIHWYHHQEHTAPQRILRLEVSGSSVHKDSVLKADKIIAIKDKDVTSYSLLVLKLKKNDEAVYYCATWE
Lycaon pictus V116 trgv LPRB01000018.1 11566886 GHAETRLEQPAVVVAREKSSASLLCTANVKASYIHWYRYQEEKGLQRLLHLAMFQSDVQWDSVLEADKVTAIETKDGYSCTLLVLKLEKSDEGMYYCAAWR
Lycaon pictus V117 trgv LPRB01000018.1 11587642 TKADTLITQLMPSVIKKQGNTAFLECQIKTGAFKKNVYIHWYRQKPDQPLQRILYISSNENVVHEQGVSEERYEARKWKQDLPASLRIHRVNEADAGLYYCACWD
Lycaon pictus V118 trgv LPRB01000018.1 11649798 GLGQVKLEQHEISVSRARDKTARISCKVITEDFNSEVIHWYRHKPDQEIEHLIMVQTSSTQASLDGRKNKLEASKNAVTSTSTLSINFLQEDDEAMYYCACWKG
Lycaon pictus V127 trav LPRB01000024.1 19455602 TSDQEFQVTQPESSISVRAGEILTLGCNVSARSPAGPVLWFRENGQERRLIYNFNGSQFPRVTQVEDTEFNQTDYSIRISNVSPKDVGTYYCVKLTI
Lycaon pictus V145 iglv LPRB01000026.1 25653937 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPGWYQQTQGRAPRTIIYRTSSRPSGVPNRFSGSISGNKAALTITGAQPEDEADYYCSLYMGS
Lycaon pictus V146 iglv LPRB01000026.1 25752855 VDSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTGNKPGWYQHTPGQAPRRIIYDTSSRPSGVPDRFSGSISENKAALTITEAQPEDEADYHCSLYMSGGA
Lycaon pictus V147 iglv LPRB01000026.1 25949314 SWAQSVLTQPASVSGSLGQRVTISCTGSSSSIGRGYVGWYQQLPGTGPRTLIYGISNRPSGVPNRFSGSRSGSTATLTIAELQAEDEADYYCSSWDRSLSA
Lycaon pictus V148 iglv LPRB01000026.1 26198071 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNVGYGNYVGWYQQLPGTGPRTIICYTNTRPSGVPDRYSGSKSGSTATLTISGLQAEDETDYYCTTCDSSLNA
Lycaon pictus V149 iglv LPRB01000026.1 26570313 SWAQSVLNQPPSVSGSLGQRITISCSGSTNDIGMLGVNWYQQLPGKAPKLLVDGTENRPSGVPDRFSGSKSGNSGTLTITGLQAEDEADYYCQSYDLMLGA
Lycaon pictus V150 iglv LPRB01000026.1 26614756 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNVGYGNDVGWYQQLPGTGPRTIIYNTNTRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSSYDSSLN
Lycaon pictus V151 iglv LPRB01000026.1 26652490 SWAQSVLTQPASVSGVLGQRVTISCSGSSSNIGGNYVSWHQQVPETGPRNIIYADNYRASGVPDRFSGSKSGSTATLTISVLQAEDEADYYCSVGDDSLK
Lycaon pictus V153 iglv LPRB01000026.1 26760493 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRYNVGWLQQLPGTGPRTVIYSSSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTYDSSLSS
Lycaon pictus V154 iglv LPRB01000026.1 26797040 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGGNSVGWYQQLPGRGPRTVIYSTNSRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTWDDSLSA
Lycaon pictus V155 iglv LPRB01000026.1 26839662 SWAQAVLTQPPSVSAVLGQRVTISCTGSSTNIGSGYDVQWYQQLPGKSPKTIIYDNSNRPSGVPDRFSGSKSGSTASLTITGLQAEDEADYYCQSSDDNLDD
Lycaon pictus V156 iglv LPRB01000026.1 26856901 SWAQSMLTQLASVSGSLGQKVTISCTGSSSNIGGNYVGWYQQLPGIGPRTVIYGNNYRPSGVPDRFSGSKSGSSATLTISGLQAEDEAEYYCSSWDDSLR
Lycaon pictus V157 iglv LPRB01000026.1 26868981 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRDYVGWYQQLPGTHPRTLIYGNSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTWDNSLNV
Lycaon pictus V158 iglv LPRB01000026.1 26890481 SWAQSVLNQPASVSGALGQKVTISCSGSTNDIGRFGVSWYQQLPGKAPKLLVDSDGDQPSGVPDRFSGSSSGNSGTLTITGLQAEDEADYYCQSVD
Lycaon pictus V159 iglv LPRB01000026.1 27009258 SWAQSVLTQLASVSGSLGQRVTISCSGSTNDIGIIGVNWYQQLPGKAPKLLIYDNEKRPSGIPDRFSGSKSGNSGTLTITGLQAEDEADYYCQSMDFSLG
Lycaon pictus V160 iglv LPRB01000026.1 27216476 FVASYVVTQPPSVSVNLGQTASITCGGDNIASTYVSWQQQKSGQAPVTIIYRDSNQPSGIPERFSGSNSGNTATLTISRAQAEDEADYYCQVWNSGNK
Lycaon pictus V161 iglv LPRB01000026.1 27221342 SVASSVLTQPPSVSVSLGQTATITCSGESLSRYYAQWYQQKPGQAPMTVIYGDRERPSGIPDRFSSSSSENTHTLTISGAQAEDEAEYYCEIWDASAD
Lycaon pictus V162 iglv LPRB01000026.1 27309427 SVASYVLTQLPSKNVTLRQPAHITCGGDSIGSKSVHWYQQKLGQAPVLIIYGDSNRPSGIPERFSGDNSGNTATLTISGALAEDEAYYYCQVWDSSAK
Lycaon pictus V163 iglv LPRB01000026.1 27555102 SMASTGLNQAPSMLVALGQMATITCSRDILGKRYAYWYQHKPSQAPVLLINKNNERASGIPDWFSGSNSGNMATLTISGVRPEDEADYYCQSYDSSGN
Lycaon pictus V164 iglv LPRB01000026.1 27565895 SVASYVLTQSPSVSVTLGQTASITCRGNSIGRKDVHWYQQKPGQAPLLIIYNDKSQPSGIPERFSGTNSGSTATLTIREAQTNDEADYYCQVWESSAD
Lycaon pictus V165 iglv LPRB01000026.1 28751295 FQPGLAQPDALLFFPGQVAQLSCMLSPRHATIGEYGVSWYQQRAGSAPRYLLYYRSEKDYHRSPDIPDRFSAATDAAHNACILTISPVQPEDDADYYCSVG
Lycaon pictus V211 ighv LPRB01000008.1 74239347 VQGEVQLVESGGNLVKPGGSLRLSCVASGFTFSSYYMDWVRQAPGKRLQWVAGISSDGSSTHYPEAVKGRFTISRDNAKNTLYLQMNSLRAEDSAVYYCAM
Lycaon pictus V212 ighv LPRB01000008.1 74098423 VQGEVQLVESGGDLVKPGDSLRLSCVASGFTFSSYAMSWVRQAPRKGLQWVGYISSDGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTALYYCAR
Lycaon pictus V213 ighv LPRB01000008.1 74048925 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYYMHWVRQAPGKGLQWVARISSDRSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCAK
Lycaon pictus V214 ighv LPRB01000008.1 73834512 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSNDMDWVRQAPGKGLQWLTRISNDGRSTGYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAK
Lycaon pictus V215 ighv LPRB01000008.1 73747937 VQGEVQLVESGGDLAKPGGSLRLSCVASGLTFSSYSMSWVRQAPGKGLQWVAAISYDGSSTYYTDTVKGRFTISRDNARNTVYLQMNSLRAEDTAVYYCV
Lycaon pictus V216 ighv LPRB01000008.1 73592363 VQSEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYGMNWVRQAPGKGLQWVAYISSGGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCAG
Lycaon pictus V217 ighv LPRB01000008.1 73554536 VHSEVQLVQSGAEVKKPGASVKVSCKTSGYTFINYYMIWVRQAPGAGLDWMGQIDPEDGATSYAQKFQGRVTLTADTSTSTAYMELSSLRAGDIAVYYCA
Lycaon pictus V218 ighv LPRB01000008.1 73191573 VQAEVQLVESEGDLVKPGGSLRLSCVAFGFTFSSYDMDWVCQAPGKGLQWVTYISNGGSSTRYADAVKGQFTISRDNAKNTLYLQMNSLRDQDMAVYYCVS
Lycaon pictus V219 ighv LPRB01000008.1 73181648 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYDMDWVRQAPGKGLQWLSEISSSGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLKAEDTAVYYCAR
Lycaon pictus V220 ighv LPRB01000008.1 73133446 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSSDMSWIRQAPGKGLQWVAYISNDGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAETVR
Lycaon pictus V221 ighv LPRB01000008.1 73025283 VLSELTLQESGPGLVKPSQTLSLTCVVSGGSVTSSYYWNWIRQRPGRGLEWMGYWTGSTSYSPAFQGRISITADTAKNQFSLQLSSMTTEDTAVYYCAR
Lycaon pictus V230 trdv LPRB01000008.1 2866144 KGVLCEQVIQSSLEQMVASGSKVTLLCTYDTSYSNPDLYWYQIRSDHSFQFVLYRDNTQSRNADFTQGRFSVLHNPSQKTFHLVISQVEPEDSATYYCAID
Lycaon pictus V249 trbv LPRB01000016.1 6959201 PLDTTVSQTPRYLIAHVGSKKLLKCEQNLGHNAMYWYKQDLKQLLKIMFIYFNQGLNLNESVPGRFSPETSDKAHLNLHVDSLETGDSAVYFCASSQ
Lycaon pictus V250 trbv LPRB01000016.1 6948568 PLDTTVSQTPRYLIAHVGSKKLLKCEQNLGHDAMYWYKQDLKQLLNVMFIYNNKELILNESVPGRFSPETSDKAHLNLHVDSLETGDSAVYFCASSQ
Lycaon pictus V251 trbv LPRB01000016.1 6936820 PMDTGITQTPKHLLTETGRRVTLKCEQHLGHNAVYWYQQSTQKPPKLMFAYSYKVLIENETASGRFSPECPDSSRFYLHMDALEPNDSAFYLCASKE
Lycaon pictus V252 trbv LPRB01000016.1 6924332 GPVESEVIQTPRHMIKARGQTVTLRCSLISGHLSVYWYQQALGQGPRFLIQYYNREERDKGDIPARFSVQQFSNYSSQLEMNSLEPGDSALYLCASSL
Lycaon pictus V253 trbv LPRB01000016.1 6900107 PVGAGVIQTPRHLIKGSGGKALLECHLVSGHNTVRWYKQAPGQGPQFLFEYYRQEQRDKGDVSARFSAQQFSDASSQLEMNPLEPGDSALYLCASSL
Lycaon pictus V254 trbv LPRB01000016.1 6895308 YMDAGIIQSPRYKVTGTGKRVTLRCHQTDNYDYMYWYRHDLGHGPRLIYYSYGINSTEKGDLSNGYTVSRSNKMDFPLLLDSVTSSQTSVYFCADSY
Lycaon pictus V256 trbv LPRB01000016.1 6868479 HMGAMVIQSPRYQVTKVGKPVTLNCSQNLNHDAMYWYQQKLRQAPKLLLYYYDTELTKETDTSDNFQPTRLSNSLCSLSIHSPGLGDSAVYLCASSK
Lycaon pictus V257 trbv LPRB01000016.1 6854284 STNAGVTQNPRHLVRRTGQEAILTCSPEKGHSYFYWYQQFLGEGLKFMIYLQKETILDQSGMPKKRFSTEFSKDGLSILKIQPAELGDSAVYFCA
Lycaon pictus V258 trbv LPRB01000016.1 6851001 TASGGITQTPKYLFREEGRGVTLECEQDFNYDSMYWYRQDPGQGLRLIYYSLVENDAQKGDIPEGYSASRMKKAFFSLTMTSVQKNQTALYLCASGR
Lycaon pictus V261 trbv LPRB01000016.1 6825269 SMDAGITQTPRNGIIKKGKNISLECSQTKSHNYMYWYRQDPGMGLRLISYSFGVNYINEGEVSNGYSASRTDLEKFSLSVGTAIPNQTALYFCASSD
Lycaon pictus V262 trbv LPRB01000016.1 6819993 LMDGSVSQTPRHCISGTGKKITLECSQTMGYDNMYWYRQDPGKALQLLHYSYGVNTTEKAELSSGSTVSRLRKELFSLTLESTSLSQTSLYLCASSE
Lycaon pictus V263 trbv LPRB01000016.1 6794529 LLNAQVTQTPRQLIKKVGAKVLLKCSQNMDHERMFWYRQDPGLGLRLLHWSYNIDSVETGDIPYGYSVSRKKKDAFPLILESARINQTSVYFCASS
Lycaon pictus V264 trbv LPRB01000016.1 6787995 SVFGALVSQKPRRDICQRGTSMTIHCEVDTQVTLMFWYRQLPGQSLILIATANQGAEATYESGFTREKFPISRRTLMFSTLTVSNLSLEDTSSYFCSTR
Lycaon pictus V307 iglv LPRB01000026.1 26978275 ADSQTVVTQEPSLSVSPGGTVTLTCGLSSGSVSTSNYPSWYQQTQGKAPRMLIYNTNNRPSGIPNRFSGSISGNKASLTITAAQPEDETDYYCLLYMGSNI
Lycaon pictus V13 trav LPRA01000005.1 14276197 TDAQVVQVNDSMYGFIGTDVVLHCSFTNPLPSVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELDDEGVYICEF
Lycaon pictus V44 trav LPRA01000008.1 2217008 QTHRDLVIQMEGQVTLSEEAFLTVNCNYSASGYLALFWYVQYLREGPQLLLKASRDKEKGSNKGFEATNDRSSRSFHLKKSSVQMSDSAVYYCALR
Lycaon pictus V45 trav LPRA01000008.1 2353984 QTHGDSVNQTEGQVILSEEAFLSINCTYSITGSPTLFWYVQYLGQGPQLLLKALRDKEKGSSKGFEATLDKTSRSFHLKKGSVQLSDSAVYYCALS
Lycaon pictus V46 trav LPRA01000008.1 2376705 QTHGDSVKQMEGQVTLSEEASLTINCTFSTSVTPTLFWYVQYLGEGPQILLKALRDKEKGSNKGFEATLDSSSKSFQLKKGSVKMSDSAVYYCVMS
Lycaon pictus V47 trav LPRA01000008.1 2431875 VSGKNQVEQNPPSLITLEGKNCTIQCNYTVNPFGSLRWYKHSMGTGPAFLIGMTYSDSKKLYGSYTVTLDANSKQSSLHITAAQLSDSASYICVVS
Lycaon pictus V48 trav LPRA01000008.1 2447345 MTSQQKGVEQSPGSLSTPEGTTASLNCNYSDSASQYFMWYRQYSGKGPELLMNIYSKGEKEEGRFAVQVDRAKQYVSLLIRDSQPSDSATYLCAVS
Lycaon pictus V49 trav LPRA01000008.1 2451543 GTGAQSVSQPDAYVTVSEEAPVELRCSYSSSIQPYLYWFVQYPNQGPQLLLQYTLKGALVKGIKGFEAEFKRNETSFHLRNPSAHGSDTAKYFCALS
Lycaon pictus V50 trav LPRA01000008.1 2493563 VSSKQEVKQSPEALSVRERDSVVLSCNFTDSAIYSLQWFRQDPGKGLTLLLLIQSNQKEQTSGRIKVWLDMSSRQSTLYITASQPSDSATYLCAV
Lycaon pictus V51 trav LPRA01000008.1 2507664 GTGAQSVTQPDAHITVPEESPLELRCNYSYGATPYLYWYVQYPNQGLKLLLRYFSGDTVVQGIKGFKAEFSKTSFHLKKPSAHWSDSAKYFCAAS
Lycaon pictus V52 trav LPRA01000008.1 2512726 VTGMEVEQRPLVESVLEGASPTLQCNFSTSATSVQWFRQDPGGHLVHLFYIPSGTKHNGRLNSTTVTKERRSSLYIFSSQTTDSAIYFCAVK
Lycaon pictus V53 trav LPRA01000008.1 2551238 INGQEIKQNPQFLLLQEVEDFTIYCNSSSTLNGLQWYKQRPGDGPVLIKLFKGGEVKQKRLTAQLGETRKDSSLHKAASQTADAGTYFCAGSTVLS
Lycaon pictus V54 trav LPRA01000008.1 2568813 KSTQLLQQSPRSLSIQEGENFTTYCNFTSTFPSFQWYRQKPGAGPVHLMTLSKGGEVKKQKSLTALFGEARKDSSLLIIAAQPGDAAIYFCAGS
Lycaon pictus V55 trav LPRA01000008.1 2574897 IRVQMKVEQSPGVLILQEGRNASMMCNYSIAVTSVQWFQQNHEGHLTSLLYIVSGMKQKGRLKFTADTKERNSHLYITDSQPGDSVTYFCTVE
Lycaon pictus V56 trav LPRA01000008.1 2610065 IMSETKTTQPNVMESTEEEPVHLPCNHSTISGNEYIHWYRQIPQQSPEYMIHGLKDNVTNGMATLIIAVDRKSSTLILPWITLRDAAVYYCIVKE
Lycaon pictus V58 trdv LPRA01000008.1 2669991 SSMAQKVTQTQPDISVRDTETVTLNCMYDTSDSNYLFWYKQPPSREMILIIRQEAYRQENATNNRFSVNFQKGSKSFSLRISDSRLEDAATYFCALME
Lycaon pictus V59 trdv LPRA01000008.1 2677728 SSMAQKVTQTQPEMFVQKTETVILHCTYDTSDSDYYLFWYKQPPSREMILIIRQEVYRQDNATNNRFSVNFQKGNKSFSLKISDSRLEDAAMYFCVLAG
Lycaon pictus V60 trav LPRA01000008.1 2708489 RTHGNSVKQTDQITVLEGTSVTMNCIYTFTQYPTLFWYVQYPNKALQLLHKETMENSKNFGARNIKDKNSPITKSSVQVSNSAMYYCLLRDTHNAK
Lycaon pictus V61 trdv LPRA01000008.1 2750368 SSNSETVRQSQNKVYKQEGESVTLDCSFTLSFNYYVMNWYQQPFGERMTEVMSIYSDSTSSSKGRYSVSFQKGNKILTLTITGLTLTDSGVYFCAVGEV
Lycaon pictus V62 trdv LPRA01000008.1 2788715 VSLDIILEPETKTLTVLVGEPATFRCNVTGGDLKNYQVSWYRKNEDNSLTLIYRQSNNTNDNLRSNFKGNTDASKSQCILDIEKATTANAGTYYCAAD
Lycaon pictus V82 trbv LPRA01000016.1 6754131 VRAQTIHQRPLARVQLVGSLLSLECTVQGASSPYLYWYRQSLRGAPQLLFSSLSVTQIVPETPHNFTASRPQNGQFILSSKKLLLSDSGFYLCAWS
Lycaon pictus V99 igkv LPRA01000017.1 37467025 CGGRHILTQFPETLAVSPDSFISITCQSSMDIGTSMAWYQQKPGEAPRLLIFGAYARAAGTPSRFQGSGSGSDFSLTIHGVEAEDMGVYYCQ
Lycaon pictus V100 igkv LPRA01000017.1 37505459 SSGEVVMIQTPLSLSVSPGEPASISCRASQSLWHSNGNTYLYWYLQKPGQSPQLLIDLVSNRFTGVSDRFSGSGSGTDFTLRISRVEAEDVGVYYCMQS
Lycaon pictus V101 igkv LPRA01000017.1 37526934 ITGEIVMTQSPDSLSLSQEKKVTITCQASQSVSSYLAWYQQKPGQAPKLLIYGASNKATGVPSRFSGSGSGTDFTFTISSLEPEDVAVYYCQQYNSGY
Lycaon pictus V102 igkv LPRA01000017.1 37543400 STGEAVMTQTPLSLAVTPGELATISCRASQSLLRSDGKSYLNWYLQKPGQTPRPLIYEASKRFSGVSDRFSGSGSGTDFTLKISKVEAEDVGVYYCQQSLHFP
Lycaon pictus V103 igkv LPRA01000017.1 37617188 SSGDIVMTQTPLSLSVSPGETASISCRANQSLLHSNGNTYLDWYMQKPGQSPQGLIYRVSNHFTGVSDRFSGSGSGTDFTLKISRVEADDAGVYYCGQG
Lycaon pictus V112 trgv LPRA01000018.1 11319659 GAAGLKLEQTPVVVGRLGTLATLPCTVDTSVIYIHWYFHKEDTAPKRLLYLDMSRSYVQRDIFVKADKVNAKKGKNSYSCNLLLQKLEKSDEGVYYCAAWE
Lycaon pictus V113 trgv LPRA01000018.1 11374178 GGAGLKLEQTPVVVGRLGTSATLLCTVDSSVYYIHWYFHKKFAAPKRLLYLDMSSSSVQRDTSVKADKVNAKKGKDSYSCNLLVQKLEKSDEGVYYCAAWE
Lycaon pictus V114 trgv LPRA01000018.1 11488876 GGAGLKLEQTPVVVVHLGTSATLPCTVDSSVYYIHWYFHREGIAPKRLLYIHTYSSSVQRDASVNMDKVNAKMDKNNYSCKLLVQKLEKSDEGVYYCAAWE
Lycaon pictus V115 trgv LPRA01000018.1 11508338 GLVAFSLEQPSVVVARMDTLAILPCKASTKISHIHWYHHQEHTAPQRILRLEVSGSSVHKDSVLKADKIIAIKDKDVTSYSLLVLKLKKNDEAVYYCATWE
Lycaon pictus V116 trgv LPRA01000018.1 11570264 GHAETRLEQPAVVVAREKSSASLLCTANVKASYIHWYRYQEEKGLQRLLHLAMFQSDVQWDSVLEADKVTAIETKDGYSCTLLVLKLEKSDEGMYYCAAWR
Lycaon pictus V117 trgv LPRA01000018.1 11591020 TKADTLITQLMPSVIKKQGNTAFLECQIKTGAFKKNVYIHWYRQKPDQPLQRILYISSNENVVHEQGVSEERYEARKWKQDLPASLRIHRVNEADAGLYYCACWD
Lycaon pictus V124 trav LPRA01000024.1 19455619 TSDQEFQVTQPESSISVRAGEILTLGCNVSARSPAGPVLWFRENGQERRLIYNFNGSQFPRVTQVEDTEFNQTDYSIRISNVSPKDVGTYYCVKLTI
Lycaon pictus V143 iglv LPRA01000026.1 25662406 CADSASLSVRVPGPEVTISCTGSCSNIGRYSVSWLQQLPGTGPRTIIYYDRSRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSSYDSSLK
Lycaon pictus V144 iglv LPRA01000026.1 25949334 SWAQSVLTQPASVSGSLGQRVTISCTGSSSSIGRGYVGWYQQLPGTGPRTLIYGISNRPSGVPNRFSGSRSGSTATLTIAELQAEDEADYYCSSWDRSLSA
Lycaon pictus V145 iglv LPRA01000026.1 26198091 SWAQSVLTQPASMSGSLGQRVTISCTGSSSNVGYGNYVGWYQQLPGTGPRTIICYTNTRPSGVPDRYSGSKSGSTATLTISGLQAEDETDYYCTTCDSSLNA
Lycaon pictus V146 iglv LPRA01000026.1 26326037 SWAQSVLTQPASVSGSLGQMVTISCTGSTNNIGGDNYVHWYQQLPGKAPSLLIYGDDNRESGVPERFSGSKSGSSATLTITGLQAEDEADYYCQSYDDSLN
Lycaon pictus V147 iglv LPRA01000026.1 26378613 SWAQAVLTQPASVSGSLGQRVTISCTGSSSNVGYANYVGWYQQLPGTGPRTLIYGSSYRPSGVPDRFSGSSSGSSATLTISGLQAEDEADYYCSSYDSSLSG
Lycaon pictus V148 iglv LPRA01000026.1 26614776 SWAQSVLTQPASVSGSLGQRVTISCTRSSSNVGYGNDVGWYQQLPGTGPRTIIYNTNTRPSGVPDQFSGSKSGSTATLTISGLQAEDEADYYCSSYDSSLN
Lycaon pictus V149 iglv LPRA01000026.1 26652510 SWAQSVLTQPASVSGVLGQRVTISCSGSSSNIGGNYVSWHQQVPETGPRNIIYADNYRASGVPDRFSGSKSGSTATLTISVLQAEDEADYYCSVGDDSLK
Lycaon pictus V151 iglv LPRA01000026.1 26760513 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRYNVGWLQQLPGTGPRTVIYSSSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTYDSSLSS
Lycaon pictus V152 iglv LPRA01000026.1 26797060 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGGNSVGWYQQLPGRGPRTVIYSTNSRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTWDDSLSA
Lycaon pictus V153 iglv LPRA01000026.1 26832731 SWAQAVLTQPASVSGSLGQRVTISCTGSSSNIDRKYVGWYQQLPGTRPRTVIYDNSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTYDSSLSS
Lycaon pictus V154 iglv LPRA01000026.1 26839683 SWAQAVLTQPPSVSAVLGQRVTISCTGSSTNIGSGYDVQWYQQLPGKSPKTIIYDNSNRPSGVPDRFSGSKSGSTASLTITGLQAEDEADYYCQSSDDNLD
Lycaon pictus V155 iglv LPRA01000026.1 26856921 SWAQSMLTQLASVSGSLGQKVTISCTGSSSNIGGNYVGWYQQLPGIGPRTVIYGNNYRPSGVPDRFSGSKSGSSATLTISGLQAEDEAEYYCSSWDDSLR
Lycaon pictus V156 iglv LPRA01000026.1 26869001 SWAQSVLTQPASVSGSLGQRVTISCTGSSSNIGRDYVGWYQQLPGTHPRTLIYGNSNRPSGVPDRFSGSKSGSTATLTISGLQAEDEADYYCSTWDNSLNV
Lycaon pictus V157 iglv LPRA01000026.1 26890501 SWAQSVLNQPASVSGALGQKVTISCSGSTNDIGRFGVSWYQQLPGKAPKLLVDSDGDQPSGVPDRFSGSSSGNSGTLTITGLQAEDEADYYCQSVD
Lycaon pictus V158 iglv LPRA01000026.1 27009278 SWAQSVLTQLASVSGSLGQRVTISCSGSTNDIGIIGVNWYQQLPGKAPKLLIYDNEKRPSGIPDRFSGSKSGNSGTLTITGLQAEDEADYYCQSMDFSLG
Lycaon pictus V159 iglv LPRA01000026.1 27216496 FVASYVVTQPPSVSVNLGQTASITCGGDNIASTYVSWQQQKSGQAPVTIIYRDSNQPSGIPERFSGSNSGNTATLTISRAQAEDEADYYCQVWNSGNK
Lycaon pictus V160 iglv LPRA01000026.1 27221362 SVASSVLTQPPSVSVSLGQTATITCSGESLSRYYAQWYQQKPGQAPMTVIYGDRERPSGIPDRFSSSSSENTHTLTISGAQAEDEAEYYCEIWDASAD
Lycaon pictus V161 iglv LPRA01000026.1 27555122 SMASTGLNQAPSMLVALGQMATITCSRDILGKRYAYWYQHKPSQAPVLLINKNNERASGIPDWFSGSNSGNMATLTISGVRPEDEADYYCQSYDSSGN
Lycaon pictus V162 iglv LPRA01000026.1 27565915 SVASYVLTQSPSVSVTLGQTASITCRGNSIGRKDVHWYQQKPGQAPLLIIYNDKSQPSGIPERFSGTNSGSTATLTIREAQTNDEADYYCQVWESSAD
Lycaon pictus V163 iglv LPRA01000026.1 28751315 FQPGLAQPDALLFFPGQVAQLSCMLSPRHATIGEYGVSWYQQRAGSAPRYLLYYRSEKDYHRSPDIPDRFSAATDAAHNACILTISPVQPEDDADYYCSVG
Lycaon pictus V166 ighv LPRA01000438.1 10141 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYNMGWVRQAPGKGLQWVAWIYASGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR
Lycaon pictus V206 ighv LPRA01000008.1 74239393 VQGEVQLVESGGNLVKPGGSLRLSCVASGFTFSSYYMDWVRQAPGKRLQWVAGISSDGSSTHYPEAVKGRFTISRDNAKNTLYLQMNSLRAEDSAVYYCAM
Lycaon pictus V207 ighv LPRA01000008.1 74220872 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYYMHWVRQAPGKGLQWVAQISSDGSSTYYPDAVKGQFTISRDNAKNTLYLQMNSLGGEDTAVYYCAK
Lycaon pictus V208 ighv LPRA01000008.1 74048971 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYYMHWVRQAPGKGLQWVARISSDRSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCAK
Lycaon pictus V209 ighv LPRA01000008.1 73977469 VQGEVQLVESGGNLVKPGRSLRLSCVASGLTFCSYAIYWVHEAPGKGLQWVAAITTDGSSTYYTDAVKGRFTISRDNAKNKLYLQMNSMRAEDKPVYYCAR
Lycaon pictus V210 ighv LPRA01000008.1 73883020 AQGEVQLVESGGDLMKPGGSLRLSCVASGFTISSNYMNWVRQAPGKGLQWVGYISSDGSSTSYADAVKDRFTISRDNAKNTLYLQMNSLRAEDTAMYYCVK
Lycaon pictus V211 ighv LPRA01000008.1 73834558 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSNDMDWVRQAPGKGLQWLTRISNDGRSTGYTDAVKGRFTISRDNTKNTLYLQMNSLRAEDTAVYYCVK
Lycaon pictus V212 ighv LPRA01000008.1 73747983 VQGEVQLVESGGDLAKPGGSLRLSCVASGLTFSSYSMSWVRQAPGKGLQWVAAISYDGSSTYYTDTVKGRFTISRDNARNTVYLQMNSLRAEDTAVYYCV
Lycaon pictus V213 ighv LPRA01000008.1 73592409 VQSEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYGMNWVRQAPGKGLQWVAYISSGGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCAG
Lycaon pictus V214 ighv LPRA01000008.1 73554582 VHSEVQLVQSGAEVKKPGASVKVSCKTSGYTFINYYMIWVRQAPGAGLDWMGQIDPEDGATSYAQKFQGRVTLTADTSTSTAYMELSSLRAGDTAVYYCA
Lycaon pictus V215 ighv LPRA01000008.1 73191619 VQAEVQLVESEGDLVKPGGSLRLSCVAFGFTFSSYDMDWVCQAPGKGLQWVTYISNGGSSTRYADAVKGQFTISRDNAKNTLYLQMNSLRDEDMAVYYCVS
Lycaon pictus V216 ighv LPRA01000008.1 73181694 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYDMDWVRQAPGKGLQWLSEISSSGSSTYYADAVKGRFTISRDNAKNTLYLQMNSLKAEDTAVYYCAR
Lycaon pictus V217 ighv LPRA01000008.1 73149921 VQGEEQLVEFGGHMVNPGGSLGLSCQASGFTFSSYGMSWVRQAQKKGLQWVGHISYDGSSTYYADTLRDRFTISRDNTKNMLYLQMNSLRAKDTAVYYCMR
Lycaon pictus V218 ighv LPRA01000008.1 73105692 VQGEVQLVESGGDLVKPGGSLRLSCVASGFTFSSYHMSWVRQAPGKGLQWVAYINSGGSSTSYADAVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAS
Lycaon pictus V226 trdv LPRA01000008.1 2866191 KGVLCEQVIQSSLEQMVASGSKVTLLCTYDTSYSNPDLYWYQIRSDHSFQFVLYRDNTQSRNADFTQGRFSVLHNPSQKTFHLVISQVEPEDSATYYCAID
Lycaon pictus V242 trbv LPRA01000016.1 6959284 PLDTTVSQTPRYLIAHVGSKKLLKCEQNLGHNAMYWYKQDLKQLLKIMFIYFNQGLNLNESVPGRFSPETSDKAHLNLHVDSLETGDSAVYFCASSQ
Lycaon pictus V243 trbv LPRA01000016.1 6948651 PLDTTVSQTPRYLIAHVGSKKLLKCEQNLGHDAMYWYKQDLKQLLNVMFIYNNKELILNESVPGRFSPETSDKAHLNLHVDSLETGDSAVYFCASSQ
Lycaon pictus V244 trbv LPRA01000016.1 6936903 PMDTGITQTPKHLLTETGRRVTLKCEQHLGHNAVYWYQQSTQKPPKLMFAYSYKVLIENETASGRFSPECPDSSRFYLHMDALEPNDSAFYLCASKE
Lycaon pictus V245 trbv LPRA01000016.1 6924415 GPVESEVIQTPRHMIKARGQTVTLRCSLISGHLSVYWYQQALGQGPRFLIQYYNREERDKGDIPARFSVQQFSNYSSQLEMNSLEPGDSALYLCASSL
Lycaon pictus V246 trbv LPRA01000016.1 6915615 SVPTGHAEPGVSQSPRHRVTKRGQNVSFTCDPISGHVALYWYRQTMGQGPEFLVYFQNEEAVDESGLDKTRFSAKRPKGTSSTLQIQRAEQRDSAVYLCASS
Lycaon pictus V247 trbv LPRA01000016.1 6900190 PVGAGVIQTPRHLIKGSGGKALLECHLVSGHNTVRWYKQAPGQGPQFLFEYYRQEQRDKGDVSARFSAQQFSDASSQLEMNPLEPGDSALYLCASSL
Lycaon pictus V248 trbv LPRA01000016.1 6895391 YMDAGIIQSPRYKVTGTGKRVTLRCHQTDNYDYMYWYRHDLGHGPRLIYYSYGINSTEKGDLSNGYTVSRSNKMDFPLLLDSVTSSQTSVYFCADSY
Lycaon pictus V250 trbv LPRA01000016.1 6868562 HMGAMVIQSPRYQVTKVGKPVTLNCSQNLNHDAMYWYQQKLRQAPKLLLYYYDTELTKETDTSDNFQPTRLSNSLCSLSIHSPGLGDSAVYLCASSK
Lycaon pictus V251 trbv LPRA01000016.1 6854367 STNAGVTQNPRHLVRRTGQEAILTCSPEKGHSYFYWYQQFLGEGLKFMIYLQKETILDQSGMPKKRFSTEFSKDGLSILKIQPAELGDSAVYFCA
Lycaon pictus V252 trbv LPRA01000016.1 6851084 TASGGITQTPKYLFREEGRGVTLECEQDFNYDSMYWYRQDPGQGLRLIYYSLVENDAQKGDIPEGYSASRMKKAFFSLTMTSVQKNQTALYLCASGR
Lycaon pictus V255 trbv LPRA01000016.1 6825352 SMDAGITQTPRNGIIKKGKNISLECSQTKSHNYMYWYRQDPGMGLRLISYSFGVNYINEGEVSNGYSASRTDLEKFSLSVGTAIPNQTALYFCASSD
Lycaon pictus V256 trbv LPRA01000016.1 6820076 LMDGSVSQTPRHCISGTGKKITLECSQTMGYDNMYWYRQDPGKALQLLHYSYGVNTTEKAELSSGSTVSRLRKELFSLTLESTSLSQTSLYLCASSE
Lycaon pictus V257 trbv LPRA01000016.1 6794612 LLNAQVTQTPRQLIKKVGAKVLLKCSQNMDHERMFWYRQDPGLGLRLLHWSYNIDSVETGDIPYGYSVSRKKKDAFPLILESARINQTSVYFCASS
Lycaon pictus V258 trbv LPRA01000016.1 6788078 SVFGALVSQKPRRDICQRGTSMTIHCEVDTQVTLMFWYRQLPGQSLILIATANQGAEATYESGFTREKFPISRRTLMFSTLTVSNLSLEDTSSYFCSTR