WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Lynx pardinus FIZN00000000.1 (FIZN01) 140 11 37 11 47 19 7 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Lynx pardinus V181 trav FIZN01050265.1 9109 VSSEDKVIQSPPSLVVQEEDSATLNCSYQVTNFQSLLWFQQQENAPTFLFRQISNGIQKSGRLKGTLDKKVLLSTLHITATQLGDSATYLCAVE
Lynx pardinus V41 iglv FIZN01010226.1 952 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGGGNYVSWYRQVPGTAPSLLIYENNKRPSGVPDRFSGSKSGSSGSLTITGLQADDEADYYCASWDNSRS
Lynx pardinus V42 iglv FIZN01012556.1 151 IWAQSGPNQPTSVSGALGQRVTISCTGVGSWVDWYQQIPGMAPKTIIYNNNNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSLWDSSGSA
Lynx pardinus V66 trbv FIZN01020384.1 5725 HTGARVIQSPRYQVTGIGKQVSLSCSQNLNHDAMYWYQQKPNQAPKLLLYYYDTNLYTEKDTSDNFKASRANSSFCSLDILLAGFEDTAVYLCASSK
Lynx pardinus V67 trbv FIZN01020384.1 22015 PMNAGVTQNPEHLVRGTGQEATLRCSPEKEHNYVYWYQQLPGEGLKFVVYLQKENIIDDSGMPTKRFSAEFPKEGPSVLKIRLAELGDSAVYFCASSL
Lynx pardinus V68 trbv FIZN01020384.1 35904 STDTQVTQSPRYLVRGKKQTAKMNCIPVKGHSYVYWYRQKLEEFKFLVYLQSEDILDKTEKFEDQFSAQCPKNSPCSLEIKSTEPGDSALYFCASSE
Lynx pardinus V69 trbv FIZN01020384.1 52972 SVDAGITQTPRNGIIETGKSIVLECSQTMDHAYMYWYRQDPELGLQLVYLSYGTDNINKGEVSNGYSASRKEREKFYLFLETAIPKQTALYFCATRD
Lynx pardinus V70 trbv FIZN01020384.1 59088 LVDASVSQTPRHYVSGTGKKITLECSQTMGHENMYWYRQDPGKALQLIHYSYGINTTEEVEASSGSTVSRIRKEHFPLTLESTSPSQTSLYFCASSE
Lynx pardinus V71 trbv FIZN01020384.1 65114 LKDAVVTQFPRHKILGTGKKLTLQCTQDMNHFSMYWYRQDPGSGLQLIYYSTGTEAFEKGDVPEGYHVSRNELPYFPLTLDSASTNQTSVYFCASSL
Lynx pardinus V72 trbv FIZN01020385.1 9245 PMVARVTQTPRHLITGTGKRLTVRCSQDMNHDALYWYRQDPGLGLKLIYYLRNVDFIEKGDVPDGYAVSRKEERNFRLTLESTGTNQTPLYLCASSKSS
Lynx pardinus V73 trbv FIZN01020386.1 5245 FVDTQGTQTPRYLIEKVGTEVLMECLQNTDHERTYWYRQDPGLGLQLLHWSYNIDSTEKGDAPDGYSVSRKKKNAFPLALDSASTNQTSVYLCASSK
Lynx pardinus V88 ighv FIZN01026028.1 195 VQCDAQLVESGGDLVKPGGSLRLTCVASGFTFSSYHMSWVRQAPGKGLQWVAAISYNAGSTYYVDSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Lynx pardinus V89 iglv FIZN01026703.1 33 SWTQLVVTQPSEVSKPVNKSVTISCTGSSSRVGAGGVSWYQQLPGSVPKVLIYGSSARPAGVPSRLSGSRSGNVASLSISSLQAEDEADYYCSVW
Lynx pardinus V127 iglv FIZN01038962.1 440 SWAQSELTQPPSVSGGLGQKVTISCTGSRSNIGIAGVNWYQQLPGKAPKLLIYGSRDRPSGVPDRFSGSTSGNTGSLTITGLQAEDEADYYCLSADVTQGA
Lynx pardinus V128 iglv FIZN01038962.1 8631 SWAQSVLTQPPSMSGSLGQRVTISCTGSSSNIGSNYVSWYQQLPGKTPKTIIYWDNSRPSGIPERFSGSKSGSTGTLTITGLQAEDEADYYCSSWDSSGSA
Lynx pardinus V129 iglv FIZN01039498.1 236 IWAQSGPNQPSSVSGALGQRVTISCTGVGSDVGWYQQIPGIAPKTIIYGNSNRPSGVPDRFSGSKSGSTATLTITGLQAEDEADYYCSSWYSSSSA
Lynx pardinus V130 iglv FIZN01040620.1 242 IWAQSGPNQPSSVSGALGQRVTISCTGVGSYVGWYQQIPGMAPKTIIYDNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSSWDNSVK
Lynx pardinus V169 trav FIZN01050259.1 3378 GTGAQSLTQPDGHITVSEGARLELSCNYSSSGTTYLFWYVQHPNQGLQLLLKYLSGPSDALVQGIKGFEAEFKKSEKAFHLRKHSAHWSDSAKYFCAVS
Lynx pardinus V170 trav FIZN01050259.1 8964 MTGLMVKQSPPDLSLQEGLSCTLQCNFSTSVTRVQWFRQNPGGHLIHLFYIPSGTKQNGRLRSTTVVEDRRSLLYISSLRTTDSAIYFCAGAE
Lynx pardinus V171 trav FIZN01050260.1 4262 KSGQEQVKQGPPSLIVQEGAFSTLNCTYENTAFDYFVWYRQYPGQGPALLLAVFSVKRTKEDGRFTVFVSESAKQFSLHIMASQPGDSATYFCAAS
Lynx pardinus V172 trav FIZN01050260.1 18896 VCSVLDVNQYPLSLHVHEGENTNFTCHFPTSSFYGLQWYRWEPAKSPKFLFTIALNGDEKEEGRVKVTLDTKKGSSSLYIKGSQPEDAATYLCALT
Lynx pardinus V173 trav FIZN01050260.1 25946 VNGQEIKQIPQFLLLQEGENFTIYCNSSKTLNSLQWYKQRPGGSPVLLITLVKSGDVKQERLTAWFGDTRKNSLLHMVATQTADSGVYFCTGAQCSQ
Lynx pardinus V174 trav FIZN01050260.1 28310 GTGAQSVTQPDAQVLVSEGAHLELKCNYSSSGTTYVFWYVQYPNQGLQLLLKYISGDTLVKGINGFEAEFKKSETSFHLRKSPALGSDAAEYFCAVS
Lynx pardinus V175 trav FIZN01050261.1 4560 LRVQMNVEQSPGVLNLQEGRNTSMMCNYSSIITSAQWFQQNPEGHLVSLSYITSGMQRKGRLIFTLNFQERNSHLRITDSQPGDSGTYFCTVE
Lynx pardinus V176 trav FIZN01050261.1 10164 VNSQQNADQQQVKQTPSLSVQEREISILNCDYNNNMFDYFIWYKKYPAKSLEFVISIRSIVDKKEDERFTVYLNKSAKHLSLHIAASQPGDSALYFCAAN
Lynx pardinus V177 trdv FIZN01050263.1 4731 SGMAEKVIQMQNTVIIQEGKAATMECKYETSWSNYYTLYWYKQPPSGRMHFLIYQDESKPNAKQGRLSMNFQKTEKSIALTISLVQLADSAVYFCALSS
Lynx pardinus V178 trav FIZN01050263.1 7854 IMSDAETTQPNAMESTEEESVRLPCNHSTISGSEYIHWYRQIPHHGPEYLIHGLKDNVTNGMASLTIAKDRKSSTLVLPRVTLRDAAVYYCITR
Lynx pardinus V179 trav FIZN01050264.1 5309 VSSQELEQSPRSLIIQEGEDFTINCSSSKTFYTLGWYRQKNGEGLSSLMMLQKSGEEKSHEKITAKLDEKKQQTSLHITASQPSHSGIYLCAGD
Lynx pardinus V182 trav FIZN01050265.1 28417 SSMAQKVTQTQPEMSVHEAETVTLDCTFDTSDSNYYLFWYKQPPSREMVLIIRQEAYKQENATNNRFSVNFQKADKSFSLRISAAQLGDAAMYLCALME
Lynx pardinus V183 trav FIZN01050267.1 2469 SSMAQKVTQTQPEMSVHEAETVTLDCTFDTSDSNYYLFWYKQPPSREMVLIIRQEAYKQENATNNRFSVNFQKADKSFSLRISAAQLEDAAMYLCALME
Lynx pardinus V184 trav FIZN01050268.1 17737 ASGKNGVEQSPQSLTAQEGNFVTINCSFSVGMTTLHWLQQNPGGGIVSLVILSLEMKKKGRIRATINTEELHSSLYITASQPRDSAIYLCAVE
Lynx pardinus V185 trdv FIZN01050270.1 5180 SSNTQSVTQTPGPVNKQEGESVSLHCSFTLSYTYYVMSWFRQLSNGKMTEIINLYSTSTNTKKGRYSISHQKGNKAVSLTITGLMPTDSGVYFCAVGEA
Lynx pardinus V186 trdv FIZN01050270.1 20332 SSNTQSITQSPSSVQEKEGESVTLVCRFTLNFDYYVMSWYQQLSNGKMTEIIYLVSTSTNTREGRYSVSHWARDKTLRLTITGLMPTDSGIYFCALGKA
Lynx pardinus V187 trdv FIZN01050270.1 32899 SSNTQSVTQYPSSVHKQEGESANLFCRFTLSYTYYVMSWFQQPSNGKMTEIIYLYSDSTNTKKGRYSVSYQARDKALRLTITGLMPTDSGVYFCAVGEA
Lynx pardinus V188 trdv FIZN01050271.1 4362 SSNTQSVTQTPSPVNTQEGESVSLHCSFTLSYTHYVMSWFQKLSNGRMTEIINLYSGNTNTRKGRYSVSHQKGNKALSLTITGLMPTDSGVYFCAVGET
Lynx pardinus V189 trdv FIZN01050271.1 20422 SSNTQGITQSPSSVKEKEGASVTLNCRFTLSYTYYVMRWYQQFSNRKMTEIIYLYSASTNTRTGRYSVSHQKGNKAVSLTITGLMPTDSGLYFCAVGEA
Lynx pardinus V190 trav FIZN01050273.1 1584 GPCKTEIIQSSNITAIIGTDVEFPCQYNIPDKNFESVYWYLQRANQRFTYIGHTSQGTVELEHYQLFVNRKLLSSTLTIKHVQPRDKAIYYCAV
Lynx pardinus V191 trdv FIZN01050274.1 109 VSLDIVLKPDTETLTVLVGEPATFRCSITGGDWKNYQVSWYKKNEDNSLTLVYRLSNSSNANISSNFKGNIDAIKGQCILDIQRATIKDTGTYYCASD
Lynx pardinus V203 trgv FIZN01052378.1 1935 GVAAISLTQQAVVVGRVGSSATLSCQASAYVSYIHWYLYQEGTAPKRILMLDMSRLYVQRYGGLKPDKIDAKKGKESNSCELSVKKLQKSDEGVYYCAAWE
Lynx pardinus V204 trgv FIZN01052382.1 8925 SWAAISLEQPSMVVAQAGRSATLWCKASTKVSYIHWYHHQEGAAPKRLLRLDMSGKFVQRDGGLKADKVNAKRGKGSNSCDLSVLKLEKSDEGVYYCAAWE
Lynx pardinus V208 iglv FIZN01052829.1 2545 SLSQPVVTQPASLSASLGTTARLTCTLSRDINVGSYNIHWYQQNPGSPPRYLLYYYSDSSTQLGPGVPTRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Lynx pardinus V209 iglv FIZN01053243.1 9527 SVASYVLTQPPSVSVNLGQTARITCGGNNIGSKNAYWYQQKPGQAPMLVIYYSSNRPSGIPDRFSGTNSGNTATLTISGAQAEDEADYYCQVWDGSSD
Lynx pardinus V211 ighv FIZN01055844.1 49 VQCDVQLVESGGDLAKPGGSLRLTCVASGFTFSGYWMSWVRQAPGKGLQWVSAIGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLKTEDTATYYCAS
Lynx pardinus V252 ighv FIZN01066822.1 6164 VLSQLTLRESGPGLVKPSQSLSLTCVVSGGSVTSSYYWNWIRQRPGRGLEWLGYWSGSTSYNPAFQGRISITADTAQSQFSLQLSSMTTEDTAVYYCAR
Lynx pardinus V277 trgv FIZN01076381.1 10716 GLGQGKLEQPEISISRARGKSAHISCKMSTEVIDRAIHWYRQKPDQEIEHLTLISTQPVRVSLGGKSDKLEASKNAHTSTATLKINFLEQEDEAVYFCACWDW
Lynx pardinus V278 trgv FIZN01076382.1 1197 TNGGIFITQFIPSITKKKGNTAFLECQVKTGVLKKNVNIHWYRQRPDQPLKRILYISSNENVVHEQGISEEKYEARKRQRDLPASLRIHKISEDDAGLYYCACWD
Lynx pardinus V312 ighv FIZN01083150.1 1933 VQCDMQLVESGGDLAKPGGSLRLTCVASGFTFSSYGMSWVHQAPGKGLQWVAAISGSGGSTDYAGSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAR
Lynx pardinus V314 trav FIZN01084174.1 298 GVRGMDVEQTPAALSLQEGASSILRCNFSSSVNNVQWFRQNPGGGGLTRLFYIVSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Lynx pardinus V315 ighv FIZN01084991.1 153 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYEMNWVRQAPGKGLQWVAYISSSGGSTYYADSVKGRFTISRDNAKNTLYLQMNNLKTEDTATYYCAR
Lynx pardinus V363 trav FIZN01095460.1 8488 GLRAQSVSQPDQVTVAEGDPVTVKCNYSVSGSPYLFWYIQHRNQGLRFLLKYITGANLVKGNYGFEAEFNKSQTSFHLKKPSVLGSDSAVYFCAVT
Lynx pardinus V364 trav FIZN01095460.1 11042 GTGAQSVTQPDVHITVSEGAPLELRCNYSSSVQVYLFWYVQHPNQGLRLLLKYISGDILVKGTKGFEAEFRKSEKAFHLRKPAVQWSDTAKYFCAVS
Lynx pardinus V365 trav FIZN01095460.1 16105 TLSLAKTTQPVFIESYEGQEVNIPCNHTNIATNEYIYWYRQFPNQGLQFVIQGFKTNVENEVASLFISADRTSSTLSLPRAALRDTAVYYCTVSD
Lynx pardinus V366 trav FIZN01095460.1 17830 GVRGMDVEQTPAALSLQEGASSTLRCNFSSAVNNVQWFRQNPGGGGLTRLFYIVSGMKQDGRLNCTVNAKDRHSSLHIRASQQEDSATYLCAVQ
Lynx pardinus V367 trav FIZN01095460.1 23667 MSRGEEVKQHPSFLSVWEGDSFVINCTYTDSASTYFFWYKQQPGKVLQLLIYTLSSMDKKQEQRLTVLLNKKDKHLSLQVTRTHPGDSATYFCAVR
Lynx pardinus V368 trav FIZN01095460.1 43853 DTSAQSVTQLDGHVTVSEKAHLELRCNYSYGATPNLFWYVQYPNQGLQLLLKYFSGPPNVLVQGIKGFQAEFRKNETSFHLKKHLAHWSDSAKYFCAAS
Lynx pardinus V369 trav FIZN01095460.1 48822 GSKGDSVTQMEGQMTLSERASLTVNCSYETTQYPALFWYVQYPGEGPQLLLKASKANEKGSSKGFEATYHKEPNSFHLKKSSVQVSDSAVYYCALR
Lynx pardinus V370 trav FIZN01095460.1 56026 DTGAQSVTQPDVHVTVSEGAPLELRCNYSSSGTPYLFWYMQHPNQGLQFLLKYFSGDTLVKGIKGFEAEFKNHETTFHLRKSRALGSDAAKYFCAVR
Lynx pardinus V371 trav FIZN01095461.1 11525 GVRGMDVEQTPAALSLQEGASSTLRCNFSSAVNNVQWFRQNPGGGGLTRLFYIVSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Lynx pardinus V372 trav FIZN01095461.1 17466 LSRGENVEQSPSTLSVQEGNSSVITCSYSDSASYYFPWYKQEFGKGPQLIIDIHSSVAKKEDQRLTVLLNKTAKHLSLHIAAAQPADSAVYFCAAS
Lynx pardinus V374 iglv FIZN01096109.1 520 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSHISSNFVNWYQQLPGTTPKAIILWDDSRPSGVPERFSGSKSGSTGTLTITGLQAEDEADYYCSAWDDSLR
Lynx pardinus V375 iglv FIZN01096109.1 24833 SWAQSVLTQPPSVSGSLGQRVTISCTGSSSNIGRGNYVSWYQQLSGTAPKLLIYRNSNRPSGVPDRFSGSKSGSTGSLTITGLQAEDEADYYCSAWDSSLSA
Lynx pardinus V376 iglv FIZN01096110.1 9988 SWAQSVLTQPPSVSGTLGQRITISCTGSSSNIGGGNDVSWYQQVPGMGPKTVIYWDNSKPSGVPDRFSGSKSGSSGTLTITGLQAEDEADYYCSAWDDSLS
Lynx pardinus V377 iglv FIZN01096111.1 19226 SWAQSMLTQPPSVSGALGQMVTISCSGSTNSIDIYGVNWYQQLPGKALKLLIYGSSDRPSGVPDRFSGSTSGNTGSLTITGLQAEDKADYYCQSLDITQGA
Lynx pardinus V378 iglv FIZN01096111.1 35936 SWAQSRLTQPPSVSGSLGQRVTISCAGSSSNIGGYAVNWHQQFPGMAPKTIIYGNSNRPSGVPDRFSGSKSGNTGTLTITGLQAEDEADYYCSSWDSSGSA
Lynx pardinus V407 igkv FIZN01105248.1 1175 ACGAITMTQSPGSLAGSPGQQVTMNCRASQSVSSYLAWYQQKPGQHPKLLIYSASTRASGVPDRFSGSGSGTDFTLTISNLQAEDVAGYYCQQYSSSP
Lynx pardinus V427 iglv FIZN01112250.1 114 SLSQPVVTQPASLSASLGATARLTCTLSRDINVGGYYIYWYQQNPGSPPRYLLYYYSDSSTQLGPGVPTRFSGSKDASANAGLLLISGLQLEDEADYYCAI
Lynx pardinus V428 iglv FIZN01112326.1 278 IWAQSGPNQPTSVSGALGQRVTISCTGVGSWVDWYQQIPGMAPKTIIYNNNNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSLWDSSGSA
Lynx pardinus V429 iglv FIZN01115099.1 68 SWAQSELTQPPSVSGGLGQTVTISCAGSVNNIGIVGVNWYQQFPGKAPKLLISAYSNQPSRVSGRFSGSTSGNTGSLTITGLQAEDEADYYCQSLDITQGA
Lynx pardinus V453 iglv FIZN01004904.1 25030 SVASYELTQPPSVSVNLGQTTRITCGENNIGNKDAYWYQQKSGQAPMLIIYEDSKRPSGIPDRFSGTNSGNMATLTISGARAEDEADYYCQVWDSSSD
Lynx pardinus V454 iglv FIZN01004904.1 17567 SVTSNRLTQPPSISVALGEMARITCEGNNIGNTYVSWYQQKPNQVPLMIIYQASNRPSGIPDRFSGSNSGNTATLTVSGARAEDKADYYCLSADSSSN
Lynx pardinus V455 iglv FIZN01004905.1 26403 SVASYELTQPPTVSVNLGQTARITCGGNNIGSNYAYWYQQKSGQAPVLIIYEDSKRPSGIPDRFSGTNSGNTATLTISRAQAEDEADYYCQSYGSNYV
Lynx pardinus V456 iglv FIZN01004905.1 11226 SIASYVLTQPPSVSVSLGQTARITCGGNNIESKSVHWYQQKSGQTPVLIIYNDSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDSSSD
Lynx pardinus V457 iglv FIZN01004909.1 42893 SVASYELTQPPTVSVNLGQTARITCGGNNIGSNYAYWYQQKSGQAPVLIIYEDSKRPSGIPDRFSGTNSGNTATLTISRAQAEDEADYYCQSYGSNYV
Lynx pardinus V458 iglv FIZN01004909.1 23504 FVASSEVTQPPSVSVALGQTARITCSGDMMEKKYTNWHQQKPGQAPIQIIYKDSERPSGIPDRFSSSSSGKTVTLTISGARAEDEADYYCQSYDISSN
Lynx pardinus V459 iglv FIZN01004913.1 15815 SVASYVLTQPPTVSVNLGQTARITCGGNNIGSNYAYWYQQKSGQAPVLIIYEDSNRPSGIPDRFSGTNSGNTATLTISGARAEDEADYYCQVWDSGN
Lynx pardinus V460 iglv FIZN01004914.1 7362 SWAQSVLNQPPSVSGDLGRTVTISCAGSSNDIGRYNYISWYQQLEGTPPKLLIYNVNSRPSGIPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYASSNT
Lynx pardinus V461 iglv FIZN01004921.1 924 SWAQSVLTQPPSVSGALGQTVTISCAGGANNIGIVGVIWYQQLPGKAPKLLIYANSNQPSGVSGRFSGSMSGNTGSLTITGLQAEDEADYYCQSVDITQGA
Lynx pardinus V483 iglv FIZN01010143.1 1450 SWAQSVLTQPPSVSGALGQTVTISCTGSANNIGRIGVNWYQQLPGKAPKLLIYGNNRRPSSVSDTFSGSKSGNTGSLTITGLQAEDEADYYCTSADPFQSA
Lynx pardinus V484 iglv FIZN01010144.1 474 SWAQSDLTQPPSVSGALGQTVTISCAGSANIGIVGVNWYQQFPGKAPKLLISAYSNQPSRVSGRFSGSTSGNTGSLTITGLQAEDEADYYCTSADSVESV
Lynx pardinus V485 iglv FIZN01010148.1 5432 SMASYVLTQPPSVSMNLGKTARITCGGNNIGSKYAYWYQQKPGRAPMMIIYDDSKRSSRTPDRFSGTNSGNTATLTISGAQAEDEANYYCQVWDGNSD
Lynx pardinus V486 ighv FIZN01010164.1 415 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSDYNMDWVRQAPGKGLQWVAYISSSGGSTSYEDSVKGRFTISRDNSKNTLYLQMNNLKTEDMATYYCAR
Lynx pardinus V487 iglv FIZN01010736.1 825 IWAQSGPNQPSSVSGALGQRVTISCTGVGSWVDWYQQIPGMAPNTIIYGNSNRPSGVPDRFSGSKSGSTATLTITGLQAEDEADYYCSSWDSSGRA
Lynx pardinus V488 iglv FIZN01010999.1 855 SVASYVLTQPPSVSVNLGQTARITCGGNNIGSNYAYWYQQKSGQAPVLIIYEDSNRPSGIPDRFSGTNSGNTATLTISRAQAEDEADYYCQSYGSNYV
Lynx pardinus V521 trbv FIZN01020390.1 3975 VSAQTIHQWPPVRVRLVGSLLSLECIVKGESNPYLYWYRQAEGGPPQLLFYSLNIHQVDPEAPRNFTASRPQDGQFILSSQKLLLSDSGFYLCAWS
Lynx pardinus V536 trav FIZN01023683.1 7574 LSRGENVEQSPSTLSVQEGNSCVITCSYSDSASVYFPWYKQELGKGPQLIIDIRSSVAKKEDQRLTVLLNKTAKHLSLHIAAAQPADSAVYFCAAS
Lynx pardinus V537 trav FIZN01023683.1 3246 SSISQKVTQAPPAMLVQEKEAVILECTYDTSDPNYSLLWYKQPSRGEMIFLVRQDSYNQQNATEGRYSLNFQKARKSIHLVISASQLEDSAVYFCALRS
Lynx pardinus V538 trav FIZN01023684.1 7472 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVNSVQWFRQNPGGGSPTRLFYITSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVE
Lynx pardinus V539 trav FIZN01023685.1 822 QTHGDSVTQMEGPVTLSEGESLTINCTYSTAVSPNLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATYDGKSKTFHLVKSLVQASDSAVYYCVLS
Lynx pardinus V540 trav FIZN01023686.1 5166 GVRGMDVEQTPAALSLQEGASSTLRCNFSSAVNNVQWFRQNPGGGGLTRLFYIASGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Lynx pardinus V541 trav FIZN01023688.1 16003 QTHGDSVTQMEGPVTLSEGEYLTINCTYSTTGTPTLFWYVQYPGEGPQLLLKAFRDTEKGSHKGFEATYNRKSKTFHLEKSSVQVSDSAVYYCALM
Lynx pardinus V542 trav FIZN01023688.1 10110 DTGAQSVTQPDVHVTVSEGAPLELRCNYSSSGTPYLFWYMQHPNQGLQFLLKYFSGDTLVKGIKGFEAEFKNHETTFHLRKSRALGSDAAKYFCAVR
Lynx pardinus V543 trav FIZN01023688.1 497 GVRGMDVEQTPAALSLQEGASSTLRCNFSSSVNNVQWFRQNPGGGGLTRLFYIVSGMKQDGRLNCTVNTKDRHSSLHIRASQQEDSATYLCAVQ
Lynx pardinus V544 trav FIZN01023692.1 3933 RTHGDSVTQMEGPVTLSEGEPLTINCTYSTAVSPNLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATLQSKSKTFHLEKSSVQASDSAVYYCALT
Lynx pardinus V545 trav FIZN01023693.1 5554 QTHGDSVTQMEGPVTLSEGESLTINCTYSTAVSPNLFWYVQYPGEGPQLLLKAFRDKEKGSHKGFEATYDGKSKSFHLEKASVQASDSAVYYCAAS
Lynx pardinus V593 trav FIZN01035572.1 22031 AHAQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEF
Lynx pardinus V605 iglv FIZN01039125.1 4674 IWAQSGLTQPSSVSGALGQRVTISCTGVGSYVGWYQQIPGMAPKTIIYDNSNRPSGVPDRFSGSKSGSTGTLTITGLQAEDEADYYCSAWDDSLS
Lynx pardinus V606 trgv FIZN01040514.1 712 GVAAISVEQPAVVVARAGSWATLPCKASTSVSYIHWYRHQEGTAPKRILMLDMSSSYVTRDGVLTADKVHAKKGKDSTSSNLLLLKLAKSDEGVYYCAVWEKQ
Lynx pardinus V607 ighv FIZN01040814.1 325 VHSQVLLVQSGAEVRKPGASVKIFCKASGYSFTDYYMYWVRQAPAQGFEWMGRIDPEDGSTSYAQKFQGRLTLTADTSTNTAYMELSSLRSTDTAVYYCAR
Lynx pardinus V628 trbv FIZN01047609.1 49975 HTGAGVLQSPRHKVTKRGWYVDLRCDPISGHAGLYWYRQAVGQGPEFLVSFLNKDKVDSSGMPSNDRFQVNRSEGSYSILRIQRAEPGDSAVYLCASSP
Lynx pardinus V629 trbv FIZN01047609.1 40167 PVEAGVTQTPRYLIKARGQQGSLRCSPISGHSSVSWYQQALNQGPQIIFEFFEYTQRTKGNFPDRFSGQQFHDYTSELHVSSLEPTDSAVYLCASSL
Lynx pardinus V630 trbv FIZN01047609.1 34939 HTGAGVLQSPQHKVTKRDRDVDLRCDPISGHVGLYWYRQAVGQGPEFLVSFQNENKVDSSGMPSNDRFQVNRSEGSYSILRIQRAEPGDSAVYLCASSL
Lynx pardinus V631 trbv FIZN01047609.1 28245 PAGAGVTQSPRHLVKGSGGKAVLKCRPMSGHRSVSWYQQAPGQGPQFLIELFDQETREKGNLPSRFSVEQFSDYSSQLNMSSLELGDSASYLCASSL
Lynx pardinus V632 trbv FIZN01047609.1 23312 PMDAEITQNPRYKVTGTGKRVILKCDQTENYDYMYWYRQDPGHGLKLIYYSNGFDSINKGDVPDGYTVSRKNMEDFPLVLESATSSQTSVYFCANSY
Lynx pardinus V633 trbv FIZN01047609.1 10707 PTDAGVTQTPRHKVTMKGQTVTLRCEPISGHASLYWYRQTSGQGLKQLVYFNNQAPIDDSGMPSDRFSAKMPEKSPSTLEIQRTEPGDSATYLCASSL
Lynx pardinus V634 trbv FIZN01047610.1 19126 PGDTAVTQTPKHLVAATGSKGTLKCEQRLGHNAMYWYKQSARRPPKLMFAYSYKELAGNDSVPSRFTPECSDSSHLHLHVAALQPEDSAVYLCASSE
Lynx pardinus V635 trbv FIZN01047610.1 4942 PVDSGLTQTPRHLVKARGQQVTLSCFPISGHLSLYWYQQAVGQGPQLLIQYYNREERGKGNLPERFSAQQFPDSHSELNMSSLELMDSALYLCASSP
Lynx pardinus V636 trbv FIZN01047610.1 337 PVNAGITQTPRFQILGTGQSMTLRCEQDKDHDYMSWYRQDPGHGLQLIHYSVGAGTTERGEISNGYNVSRSNTKNFPLTLASATPSQTSVYFCASSD
Lynx pardinus V637 trbv FIZN01047611.1 3002 PLDTAVSQTPKYLIAQMGTEKFLQCEQKLSHDAMYWYKQDSKKLLKIMFAYNNKELIHNETVPSRFSPKSPDKARLNLRVSALETGDSAVYLCASS
Lynx pardinus V657 trdv FIZN01050276.1 31236 RGVLCDQVTQSPPYQTVASGSKVTLFCTYHTTYSNPDLYWYRIRPDRSFQFILYRDNTRSKDADFTQGRFWVWHSQCQKIFHLVISVEPEDSATYYCTIY
Lynx pardinus V669 ighv FIZN01055900.1 469 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSSYYMSWVRQAPGKGLQWVANIYTDGSSTYYEDSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAT
Lynx pardinus V723 trgv FIZN01076377.1 142829 GVAAISVEQPAVVVARAGSWATLPCKASTSVSYIHWYRHQEGTAPKRILMLDMSSSYVTRDGVLTADKVHAKKGKDSTSSNLLLLKLAKSDEGVYYCAVWEKQ
Lynx pardinus V724 trgv FIZN01076377.1 137777 GVAAISLTQQAVAVGRVGSSATLSCQASAYVSYIHWYLYQEGTDPKRILMLDMSRLYVERYGGLEVDKIDAKKGKENNSCELSVKKLQKSDEGVYYCAAWE
Lynx pardinus V750 ighv FIZN01083339.1 1795 VQCDVQLVESGGDLVKPGGSLRLTCVASGFTFSGYWMSWVRQAPGKGLQWVAEISGSGGSTNYADSMKDQFTISRDNSKNTLYLQMNNLKTEDTATYYCVR
Lynx pardinus V752 iglv FIZN01083890.1 441 SWAQSVVTKPSAVSKPVNKSVTISCTGSKSKVGAGGVSWYQQLPGSVPKVLIYGSSARPAGVPSRLSGSRSGNVASLCISSLQAEDEADYYCSVW
Lynx pardinus V753 trav FIZN01084423.1 716 RTHGDSVTQMEGPVTLSEGEPLTINCTYSTAVSPNLFWYVQYPGEGPQLLLKALRDKEKGSHKGFEATLQSKSKTFHLEKSSVQASDSAVYYCALT
Lynx pardinus V813 igkv FIZN01105248.1 62632 SRGDIVMTQTPLSLPVTPGEPASISCRASQSLLHSDGNTYLNWYLQKPGQSPRRLIYLVSNRASGVPDRFSGSGSGTDFTLRISRVEADDFGVYYCGQALQYP
Lynx pardinus V814 igkv FIZN01105248.1 57734 SGGWHVLTQAPETLAASRDSFVSITCRSSTEVGTSMAWYQQKPNEAPKLLIFGASARAAGTPSRFWGSGSGSDFSLTIHGVEAEDIGIYYCQ
Lynx pardinus V815 igkv FIZN01105248.1 48098 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLHSDGNTYLHWYLQKPGQSPRLLIYRVSNRASGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCLQG
Lynx pardinus V816 igkv FIZN01105248.1 34001 SSGEVVLTQSPAFLSKTLKEKATITCRANQGISTNLHWYQQKPNQAPKLLVKYASQSVSGAPSRFSGSGSGTDFTLTISSLEPEDAATYYCQQSNNFP
Lynx pardinus V817 igkv FIZN01105248.1 23242 SSGDVVMTQTPLSLPVTPGEPASISCRASQSLLDSDGNTYLSWYLQKPGQSPRRLIYLVSNRASGVPDRFSGSGSGTDFTLRISRVEADDFGVYYCYQG
Lynx pardinus V818 igkv FIZN01105248.1 16810 AGGTAELTQSPTHLSVSLRDSVSVICRASESVSDYLSWYQQKPGQPPKLIIYDADNLESGVSDRFSGIQSGTEFILKISTVEADDAAAYYCQQGYALP
Lynx pardinus V819 igkv FIZN01105249.1 44793 SGGWHVLTQAPETLAASRDSFVSITCRSSTEVGTSMAWYQQKPNEAPKLLIFGASARAAGTPSRFRGSGSGSDFSLTIHGVEAEDIGIYYCQ
Lynx pardinus V820 igkv FIZN01105249.1 36071 ASCEIQMTQSPSSLSASPGDRVTITCRASQNVNTWLDWFQQKPGKVPKLLIYRASTLQTGVSSRFSGSGSGTDFTLTIGSLEPEDAATYYCQQSNNFP
Lynx pardinus V821 igkv FIZN01105249.1 29141 AGGTAELTQSPTHLSVSLRDSVSIICRASESVSDYLSWYQQKPGQPPKLIIYDADNLESGVSDRFSGIQSGTEFILKISTVEADDAAAYYCQQGYALP
Lynx pardinus V822 igkv FIZN01105249.1 7214 SGADVVMTQTPLSLPVTPGEPASISCRASQSLLHSNGNTYLHWYLQKPGQSPRRLIYKVSNRASGVPDRFSGSGSGTDFTLRISRVEADDVGVYYCQQSTKYP
Lynx pardinus V849 trav FIZN01111094.1 14758 LCGEDRVRQSPQTLRLREGDSVSLNCSYTVSLFTGLQWLRQNPGKGPELLFLLYSVSEEKQKERLKATVLKQGSSLHITASKPEDSATYLCAVE
Lynx pardinus V850 trav FIZN01111094.1 2190 VSSKQEVMQSPEALNVQEGDSVVLNCSYTGSTFYSLQWFRQDPGKGLTVLLLIQSAQREETSGRIKASLDKPSKHSALYIAASQPSDSATYLCAIE
Lynx pardinus V851 trav FIZN01111095.1 9174 ASMAQKVTQAQPAISMPEKEAVTLDCVYEASGYTYYLFWYKRPPSGEMILLIYQESYSEQNATEGRYSLNFQKPDRSISLTITALQLRDSAVYFCALR
Lynx pardinus V852 trav FIZN01111097.1 51345 RTHGDSVTQMEGPVTIPERKSLTINCTYSTTWTPTLFWYVQYPRESPQLLLKALRDKETGSHKGFEATYDGKSKSFHLEKASVQASDSAVYYCAAS
Lynx pardinus V853 trav FIZN01111097.1 43567 VSGKNQVEQHPPSQIIQEGENCTFQCNYTVSPFSHLKWYKQGTGRSPAFLIIMTDNDSKNPSGRYTVTLDATSKHSSLHVTAAQLSDSAVYICVVS
Lynx pardinus V854 trav FIZN01111097.1 30685 MRRSHQNEVKQSPVPLTVLEGVTAFLNCSYSDSASQYFVWYRQYSGKGPEFLMHMYSNGEKEEGRFTGLLNKASRHLSLFIRDSQLSDSATYLCAV
Lynx pardinus V855 trav FIZN01111097.1 26716 GTGAQSVTQPDAQVLVSEGAHLELKCNYSSSGTTYVFWYMQYPNQGLQLLLKYISGDTLVKGINGFEAEFKKSETSFHLRKSPALGSDAAKYFCAVS
Lynx pardinus V856 trav FIZN01111097.1 16242 VNSQQEQDHQTLSIQEGENATMNCSYKTSINYLQWYKQDWGRGLVLLILIRLNEREKNSGRLRVTLNTSLKSSSLSITASQTADTATYFCATD
Lynx pardinus V857 trav FIZN01111097.1 10018 GINGDSVTQTEGSVTLFEGTPLTLNCTYQSSYTVFVFWYVQHQNKAPQLLLKSLSENQRAEHHGFHASLVKSDSSFHLQKRSVRMSDSAVYYCVLG
Lynx pardinus V860 iglv FIZN01111245.1 2037 SLSQPVVTQPASLSASLGATARLTCTLSRDINVGGYYIYWYQQNPGSPPRYLLYYYSDSSTQLGPGVPTRFSGSKDASANAGLLLISGLQPEDEADYYCAI
Lynx pardinus V861 iglv FIZN01111247.1 5663 SWTQSVVTQPSEVSKPVNKSVTISCTGSSSNVGAGGVSWYQQLPGSVPKVLIYGSSARPAGVPSRFTGSSSGNVASLSISSLQAEDEADYYCSVW
Lynx pardinus V862 iglv FIZN01111248.1 4971 SWAKSVLTQPPLVSGALGQTVTISCTVNDSSFWAGEFIHWYQQLPGAAPKLLIYGNNNRSSGVPSRFSGSKSGNSHSLTITGLQPEDEADYYCQYFDDRVI
Lynx pardinus V863 iglv FIZN01111249.1 765 ALSQPVVTQPASLSASLGATARLTCTLSRDMSVGSKSIYWYQQKPGSPPRYFLYYYSDSSNELGPGVPNRVSGSKDASANAGLLLISGLQPEDEADYYCAI
Lynx pardinus V864 ighv FIZN01113646.1 531 VHSKVLLVQSGAEVRKPWASVKIFCKVFGYSFTDYYMHWMLQAPAQGFEWMGSIDPEDGATSYAQKFQGRLTLTADTSTNTAYMELSSVRSADTAMYYCAR
Lynx pardinus V865 ighv FIZN01113803.1 469 VQCDMQLVESGGDLVKPGGSLRLTCVASGFTFSDYDMNWVRQAPGKGLQWVAAISYNGGSTYYADSVKGRFTISRDNAKNTLYLQMNSLKTEDTATYYCAK