WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Echinops telfairi AAIY00000000.2 (AAIY02) 192 82 19 30 38 14 5 4
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Echinops telfairi V49 trav AAIY02036603.1 712 TMGQDVQQPPALMALEGASVKVNCTFQTTGFNGLSWYQQSDGGAPVFLAYNVLDGLEKKGHFSSFLSCSNTYSYLLLTGLQIKDSASYFCAVR
Echinops telfairi V50 trav AAIY02036612.1 8010 GVRGMKVEQSPSSLSLQAGASSTLRCNYSATVSSVQWFRQKPGGGLIRLFFIVSDTKQNGRLKSTINPKELYSTLHITASRLEDSATYLCAAE
Echinops telfairi V51 trav AAIY02036613.1 562 LGRGEKVEQSPSLLSVQEGDSSSFNCTYTNSASEYFFWYKQEPGKGPQFLIRILMNEDKKEDQRFTALLNKKEKHLSLLIKEALSVDSATYFCAAR
Echinops telfairi V52 trav AAIY02036613.1 12031 MARGAQVEQSPSLWSVQEGESSSFNCTYTGITPNYFFWYKQEPGKSPQFLTYIPTNEDKKEDQRFTVLLNKKDKHFSLLIKDAFPGDSATYFCA
Echinops telfairi V53 trav AAIY02036613.1 22768 LGRGEKVEQSPSLLSVQEGDSSSFNCTYTDSATTYFFWYKQEPGKGPQFLIHILSTEDKKEDKKLIVLLNKKEKHLSLFIKDSRRGDSATYFCAVR
Echinops telfairi V54 trav AAIY02036617.1 6472 FGGGEEVEQSPSLLSIQEGDSSSFNCTYTSSTSDYFVWYKQVPGKGPQFLTRIFLSEEKIEDQGFIVLLNKKEKYFSLLIKDALPGDSATYFCAAR
Echinops telfairi V55 trav AAIY02036617.1 11830 LGRGEKVEQSPSLLSVQEGDSSSFNCTYTDASQYFVWYKQEPGKGPQVLIRILSNEDKKEDQRFTALLNKKEKLLSLLIKDALPGDSATYFCAAS
Echinops telfairi V56 trav AAIY02036617.1 16799 LGRGEKVEQSPSLLSVQEGDSSSFNCTYTSSTSDYFFWYKQEPGKGPQFLIRIISNEEKAEDQRLTVLLNKRDKHFSLLIKDAHAGDSATYFCAVR
Echinops telfairi V57 trav AAIY02036620.1 1107 LGRGEKVEQSPSLLSVQEGDSSSFNCTYTDASQYFVWYKQEPGKGPQVLIRILSNEDKKEDQRFTALLNKKEKLLSLLIKDALPGDSATYFCAAS
Echinops telfairi V58 trav AAIY02036621.1 1864 LGRGEKVEQSPSFLSVQEGDSSSFNCTYTSSSSDYFFWYKQELGKGPQFLIRIYLNEEKTEDQGFTILLNKRDKQFSLLIKEAHPGDSATYFCAVR
Echinops telfairi V59 trav AAIY02036623.1 7090 LGRGEKVEQSPSLLSVQEGDSSSFNCTYTDSAATYFFWYKQEPGKGPQFLIRIVSNEEKTEDKRFTALLNKKAKYLSLLIKEALPGDSATYFCAVR
Echinops telfairi V60 trav AAIY02036624.1 3589 LGRGEKVEQSPSLLSVQEGDSSSFNCTYTNDASQYFFWYKQEPGKGPQFHIRILSNEDKKEDQRFTALLNKKEKHLSLLIKDALPGDSATYFCAAS
Echinops telfairi V61 trav AAIY02036625.1 4136 VDSQKVQQSPLALSIQEGENATLMCNFTSSPSVVQWYRQDPERGLVFLVLIRENMVENWEGRLRITFERTLKQSSLQIPASQPSDSATYLCAV
Echinops telfairi V62 trav AAIY02036626.1 785 DARAQSVTQPDVHISVFEDALLELRCNYSYGGVPSLYWYVKYPNESLQLLLKYLSGDTLVKGIKDFEAELKKSESSFNLRKQFAHWTDSAEYFCAVS
Echinops telfairi V63 trav AAIY02036626.1 15305 GNDGDTVTQTEGQVTLSEGVYLMLNCSYTTTQYPTLFWYVQYADEGLQLLLKATKADEKGRNKGFEATYKKETSSFHLEKAAVQESDSAVYYCALT
Echinops telfairi V64 trav AAIY02036628.1 11223 GSNGNTVTQTEGQVTLSEGIYLMLNCSYTSTGYPSLFWYVQYPNEGLQLLLKATKADEKGRNKGFEATYKKETSSFHLEKAAVQESDSAVYYCVLS
Echinops telfairi V65 trav AAIY02036630.1 784 GVRGMKVEQSPSSLRLQAGASSTLRCNYSAAVNSVQWFRQKPGGGLIRLFFIVSDTKQNGRLKSTINPKELYSTLHITASRLEDSATYLCAAE
Echinops telfairi V66 trav AAIY02036632.1 5415 MCQGKDVEQHPSDLHALEGSSPVINCTYSNSASTFFPWYKQEPGKGPQLIIDIRSNAVRNQDGRLTVLLDKKERHLSLHITAAQPGDSAVYFCAAS
Echinops telfairi V67 trav AAIY02036632.1 11049 ISVAKKVTQPQAAMKVEEEDAVTLNCTYDTSDGSFSLFWYKQPSSGEMIFLIRQDSYSQQNAREGRYSLNFQKASKSINLVISASQLGDSAVYFCALRE
Echinops telfairi V68 trav AAIY02036632.1 19906 VTSEDYSVAQDEGQVIVSKGAFLTINCTYTAKGYPTLFWYVQYAGEGLQLLLKATKADEKGRNKGFEATYKKETSSFHLEKAAVQESDSAVYYCVLS
Echinops telfairi V69 trav AAIY02036633.1 4192 TASQQKKVEQSPGSLSIPEGAIVSLNCTYEDRASQYFMWYRHFPWKGPELLMSIYSNGDKVEGRFTAQLNKGSQHVSLIITDSQPSDSATYLCAV
Echinops telfairi V70 trav AAIY02036633.1 8767 GTRAQLVTQLDVQVAVPEGAPLELRCNYSTSVTPYLFWYVQYPSQSPQLLLKYTSGNTEVKGSKGFEATFKKSETSFPLRKRSAHWSDSAEYFCALS
Echinops telfairi V71 trav AAIY02036633.1 15803 GTSAQTVTQPEDHIFLLEGASVEVGCNYSYSGSPILSWYVKYPSKTHQLLLTHISGRSAKGFTADLDKSKISFHLKKLSVQVEDSAIYYCALT
Echinops telfairi V72 trdv AAIY02036638.1 3740 SSLTQEVTQDQTAISVVETEAVTLNCVYKTQDTNYALFWYKQPPSGEMIFLIRQESYNEKMVQQPRYSLNFQKASRYINLTILASQLEDSAVYFCALR
Echinops telfairi V73 trav AAIY02036639.1 578 KTNGGDSVTQTEGVVTLPEGAPMVLNCSYQSSYSDIDLFWYVQYLNEAPRVLLRSSRGSQKTEHQGFQANLVKSETSFHLQRRSLRLSDAAVYYCVLR
Echinops telfairi V74 trav AAIY02036644.1 1519 SSGEDQVEQSPQALILQEGDNSTLTCTYSVSNFRGLQWYKQDPGEGPELLLILYSVGDEKYKERLRATLSKKESILHVTDSKPEDSATYFCAV
Echinops telfairi V75 trav AAIY02036647.1 4201 VSSKQEVQQSPPALKAQEGDDVVLNCSYTDSALYFLQWYRQAPGEGLTSLILMQSNQKELMSGRVKALLDKSSRKSALYIISSQTGDSATYLCAV
Echinops telfairi V76 trav AAIY02036648.1 8679 VRGMQVEQSPPVLSLQEGASCTLQCNFSTTANNVQWFRQNPEGRLINLFYISSGTKRSGRLNATTVVKERYTALHISSSQTTDSATYLCAVEPQCCP
Echinops telfairi V77 trav AAIY02036648.1 28195 GVSGQQKSDPQQNPPSLIAQEGGTSVLSCAYENSAFDYFLWYRQYPGQGPVFLLAIRSVASQNEQGRFTVFFNKTAKHISLHIVASQPGDSATYLCAAS
Echinops telfairi V78 trav AAIY02036654.1 140 VNGQQLEQTPLFLLIQEGGNFTTHCNSSSSLNSLQWYKQKSGGNPVFLIMLTKAGDVKKQGSLTAQFGKTRKDSTLHILAARAADVGTYFCAG
Echinops telfairi V79 trav AAIY02036658.1 16766 RSTRQLEQSPRVLSLQEGESALMYCNSSTVFPTFQWYRLQPGAGPVLLMMLTKGGELKEQKRLKVQFDEARKASSLHITAVRSEDAAFYLCAG
Echinops telfairi V80 trav AAIY02036660.1 3514 IRVEMKVEQSPQVLILPEGRNASSICNISVAIQSVQWFRQNPGGRLLPLFYIASGMKEKGRLKSILNTKDRYSHLYIRDAQPEDAATYFCAAVE
Echinops telfairi V81 trdv AAIY02036662.1 16064 CSKAEKVNQIQTTVTVQEGGAATLGCTYETTWNAYILYWYKQPPSGGMVFLIRQGYSDPNAKQGHYSVNFQKANKSIHLTISSLQLVDTAKYFCVLWA
Echinops telfairi V82 trav AAIY02036663.1 8128 NPGDAKATQPNSIESTEGERVNLPCNHSTISGNEYIYWYRQILNQGPEYVIHGLKNNETNKVASLIIPAGRKSSTLILPHVTVRDAAVYHCMVR
Echinops telfairi V83 trav AAIY02036663.1 16125 VYGQELKQSPQSMTIQEGEGFTIHCNSSQTIYALYWYKQKPGAQPIFLMRLSSGGSEKSQKKVTARLDAKKQQSSLHVTASELSHSGVYLCAAE
Echinops telfairi V84 trav AAIY02036666.1 1825 AWIRPQEPEVSTTEGESVTLLCNYSTTVSLVRLYWYRHYPAQAPEYILYRSWRSTGKGTGTGEAGLGRGRFDSKATTGMTNLYIRSLVPADTATYFCAMTE
Echinops telfairi V85 trav AAIY02036667.1 1507 VSGNMVIQSPPSLVVQEGDAATLNCTYQVAAFGGLLWYEQKDQALVNLFRLFPRDTEKTSGRLSSTLDQKEFLSILFVTASQPRDSATYFCAV
Echinops telfairi V86 trav AAIY02036668.1 1440 PEGAAWIRPQEPEVSTTEGESVTLLCNYSTTVSLVRLYWYRHYPAQAPKYILYRSWGSKGKRDANFALERFYSTVTASMTHLYIRSLVPADTATYFCVMRE
Echinops telfairi V88 trav AAIY02036670.1 5043 SGVAQTVTQSQRQVSVQEAETVTLNCTYDTRESNYYLFWYKQSPSGEMVFIIRQEAFKKQNATENRYSANFQKTDKFFGLRISGSQLRDAAVYFCAFSG
Echinops telfairi V89 trav AAIY02036678.1 15644 SSSGSSVTQRDTIVVSEGASVVMNCTYTSKGYPTLFWYVQYPNKALQFLQEEMMKNSKNFGLRDLKEKNSPIEKHSVQVSDSAAYYCLLRDTVP
Echinops telfairi V90 trdv AAIY02036682.1 3840 YSKAQSAHQSITVMSEQEGQSLTLSCHFTISLSHYVMYWYRQPSSRELAPIIHLLPGNGNSRKGRYSVVFRKADNTLSLTISALVPTDSAIYFCAYADT
Echinops telfairi V311 igkv AAIY02160546.1 26775 CGGQIILSQAPENLETLQDAFVSITCRTSSGVGTSMAWYQQKHREAPRLLIFGASALAAGTPARFRGSGSGRDFSLSIHGVHAEDTGLYYCQ
Echinops telfairi V312 igkv AAIY02160546.1 30496 SSGDIVMTQTPLTLPATLEQVATISCKSSKSLVGSDGRTYLHWYQQKPGQAPRLLISLVSNRVTGVPDRFSGSGAVSDFTLKISRVAADDIGVYYCQHAVELP
Echinops telfairi V314 igkv AAIY02160546.1 45082 SNGDIVMTQTPLTLPVTLGQVATISCKSSKSLVYSNGKTYLHWYQQKPGQAPRLLISMVSNRVTGVPDRFSGSGAVSDFTLKISRVEADDTGVYYCQQALELP
Echinops telfairi V315 igkv AAIY02160546.1 61767 SSGDIVMTQTPLTLPLTLGQVATISCKSSQSLVHSNGNTYLHWYQQKPGKAPRLLIYRVSNRDTGVPDRFSGSGAVSDFSLKISGVQAEDIAVYYCMQH
Echinops telfairi V316 igkv AAIY02160546.1 73055 SSGDIVMTQTPLTLPVTLGQVATISCKSSQSLVHSDGNTYLYWYQQKPGQAPRLLIYTVSNRFTGVSDRFSGSGAVSDFSLKISGVQADDAAVYFCMQA
Echinops telfairi V317 igkv AAIY02160548.1 802 SSGDIVMTQTPLTLPVTLGQVATISCKSSQSLAHSDGNTYLYWFQQKPGKAPRLLIYRVSNRFTGVPDRFSGSGAVSDFSLKISGVQADDAAVYYCLQAIQLP
Echinops telfairi V318 igkv AAIY02160548.1 8424 SSGDIVMTQTPLTLPVTLGQVATVSCKSSQSLVGSDGRSYLHWYQQKPGQAPWLLISMVSNRFTGVPDRFSGSGAGSDFTLKISRVEADDTGVYYCQHDI
Echinops telfairi V319 igkv AAIY02160549.1 7781 TSGDIVMTQTPLTLPVTLGQVATISCKSSQSLVHSNGNTYLQWYQQKPGKVPRLLIHRVSNRVSGVPDRFSGSGAVSDFSLKISGVEADDATVYYCMQE
Echinops telfairi V320 igkv AAIY02160549.1 31759 SRGAIVMTQTPASLLIVPGEPATISCKASESVVHDNGNTYLHWYRQIRGQTIEPLIYDVSKRAAGVHEKFSGSGSVSDFTLKISKVEAEDAAVYYCQQYRKYP
Echinops telfairi V322 igkv AAIY02160549.1 54484 ARCDIVMTQSPSLLSANLGETATLTCRASQSVGSWLHWYQQTPGKIPKLLIYKASNLQSGVSTRFSGSGSGTDFTLTISNLQPEDVGTYYCQQSNSYP
Echinops telfairi V323 igkv AAIY02160550.1 8514 AHGLIVMTQSPPFLFVSLRESVSMNCEADKDASDYVTWYQKKPGQPPKILIYDADNNYAGVPARFTGIQSGRKFILTISNIEAGDAADYYCQQDYEVP
Echinops telfairi V324 igkv AAIY02160550.1 16241 SRGAIVMTQTPASLLIIPGEPATISCKASESVVHDNGNTYLHWYQQKPGQTIRCLIYGVSKRAPGVPERFSGSGSVTDFTPKISKVEAEDAAVYYCQQYKQHP
Echinops telfairi V325 igkv AAIY02160551.1 1115 TTREVVMTQSPASLSLSPGDRATLTCTASQSVGTYIAWYQQKPGQAPRLLITGASSRATGIPARFSGSGSGTDFTLTISSLEPEDTASYHCLEASGSWS
Echinops telfairi V326 igkv AAIY02160551.1 20350 TTGEVVMTQSPASLSLSSGDRATLTCTASQSVGTYLAWYQQKPGQAPRLLIYGASSRATGIPARFSGSGSRTDFTLTISSLEPEDLAVYYCQQYSNG
Echinops telfairi V327 igkv AAIY02160551.1 24601 IRAETLLTQAPAFLSASLGDNVEITCKASQDIDDDVHWYQQKPGEAPKLIIKYVSTLISGVPSRFSGSGYGIDFTMKINNIESEDYAHYFCQQDDNIP
Echinops telfairi V328 igkv AAIY02160551.1 31957 SSGENMLTQSPASLAVSPKERITINCKASSSVGTSYLHWYQQKPGASPKLLMYSTSNPASGTPARFSGSGSGTDYSLTISSVEAEDAASYYCQQWQSNP
Echinops telfairi V329 igkv AAIY02160551.1 69516 SSGEIVLTQSPASLAVSPGERVTINCKASSSVSTNYLHWYQQKPGASPKLLIYRTSNPASGTPARFSGSGSGTDYSLTISSVEAEDAASYYCQQWYSN
Echinops telfairi V414 ighv AAIY02202287.1 14109 AAGAVWSRGEETGASLRISCKTSGYSFTGSWISWIRQTPGKGLAWIGRIDPEYSQRKYNPSFQGKVAISTDNSISTVYLQWSSLKGSDTAMYYCAR
Echinops telfairi V450 trbv AAIY02229586.1 507 VGAQMVRQWPVVQVRPVGSPLFLQCFVTGTSNPNLYWYWQPAGGSPQLFFFSINKGDIQTHGPGHLSASRPQDGEFTLSADALQLGDAGVYLCAWG
Echinops telfairi V502 ighv AAIY02260962.1 2489 IPSQVQLQESGAGLVKPFQKLSLTCTVSGYSITSSYRWSWIRQPSGKGLKWMGHIYYSIGNKYYNPSFQSRLSITRDTLKNQFFLQLSSMTAEDTALYYCAR
Echinops telfairi V510 ighv AAIY02262997.1 4881 YQCEVQLVESGGDLINPGGSLRLSCAASGFTFSNFWMTWVHQAPGKGLQWVSTITNSGDTYYIDSVKSRFTVSRDNSKNTLYLQMDSLKAEDMAMYYCAG
Echinops telfairi V511 ighv AAIY02262999.1 10352 VLAQVQLQESGPGLVKPSQTLSLTCTISGFSLTSYDVYWTRQSPEKGLEWVGAIWSGGGTRYNSALQSRVSITRDISKGEVYLKLSSVIPEDTAMYYCAR
Echinops telfairi V512 ighv AAIY02263010.1 5308 VLAQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYYVHWIRQAPGKGLEWVGVIDTDGSTYYNPALQSRVRITRDTSKSQVYLKLSSVNPEDTAMYYCAR
Echinops telfairi V513 ighv AAIY02263145.1 1620 VLSQVQLQESGPGLVKPSQKLSLTCTVSSFSITSTGYSWNWIRQTSGKGLQWMGYIDYNGGTYYNPSFQSRLSITRDTSKNQFSLQLSSVTAEDTAMYYCAR
Echinops telfairi V514 ighv AAIY02263145.1 28301 VLSQVQLQVSDPGLVKPSQKLSLSCTLSGYSITSDYSWNWIRHPSGKGLQWMGNIWHTGNTYYNPSFQSQLSITRDTSKNQFSLQQSSVTAEYTAMYYCARG
Echinops telfairi V515 ighv AAIY02263145.1 38993 ALAQVQLQESGPQMVRPLQTLTLSCTITGDSVSSTSAAWNWIRQRPGSSLQWMGRTYYRTKWYREYTPSLKDRLVINPDTSKNQFSLQLSSVTAEDTAMYYCAGE
Echinops telfairi V516 ighv AAIY02263151.1 44 GLAQVQLQESGPQMVRPSQTLTLTCTIAGDTVSSTSATWDWIRQRPGSSLQWMGRTLYSSKWYREYSPSLKDHLIINPDTSKNQFSLQLSSVTAEDTAMYYCAR
Echinops telfairi V517 ighv AAIY02263157.1 11280 VHCEVQLVESGGDLRKPGGSLRLSCVGTGFTFSSYGIHWIRQAPKKALEWVAVIWHDGSKTVYADSVKDRFIISRDNSKSTAYLQMNSLRTEDTAMYYCAR
Echinops telfairi V518 ighv AAIY02263765.1 12591 VLAQVQLQESGPGLVKPSQTVSLTCAVSGFSLTSYGVNWIRQAPEKGLEWIGVIAYDGKTYYNPALKSRVSITRDTSKSQVSLKLSSVNPEDTAVYYCAR
Echinops telfairi V519 ighv AAIY02263765.1 18728 VQCEVKLVETGGDVRKPAGSLRLSCAASEFTFSDYWMSWVRQAPGKGLQWLATIKYDSGSIYYTESVKGRFTISRDNSKNTVYLQMDSLKAEDTAMYYCARV
Echinops telfairi V520 ighv AAIY02263767.1 179 VLAQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVNWIRQAPGKGLQWVGDIWGGGSTHYNPALQSRVSITRDTSKSQVYLKLNSVIPEDTSVYYCAR
Echinops telfairi V521 ighv AAIY02263834.1 20625 VLSQVQLQESGPGLLKPSQKLSLTCTVSGYSITNGYRWNWIRQSLGKGLQWMGYIDYDGDTYYNPSFQSRLSITRDTSKNQFSLQLSSVTPEDTAMYYCARG
Echinops telfairi V522 ighv AAIY02263834.1 48047 VQCEVQLVESGGNLRKPGGSLRLSCAASGFTFSSYSMNWVCQAPGKGLQWVAYISGYGSSYIYYTDSVKGRFTISRDNSKNTLYLQMNSLKAEDTATYYCAR
Echinops telfairi V523 ighv AAIY02263834.1 57874 LVTPSQTLSLTYAVSGFSITTSGYCWGEPATGKGLQWTGNICASGNTYYSPSFKSRSSVSRDTASNQFSLQLNSLTAEDIAMYYCVRNTGRGS
Echinops telfairi V524 ighv AAIY02263841.1 2986 ILSQVQLQESGPGLVKPSQKLSLTCTVSGSSITSSGYCWSWIRQPSGKGLQWMGVICYRGGTSYNPSFQSRLSISRDTSKNQFSLQLSSVTAEDSAVYYCAR
Echinops telfairi V526 ighv AAIY02264083.1 7059 VQSQVQLQESGPGLVKPSQKLSLTCTVSGVSITSSGSYWSWIHQTSGKGLQWMGNIWYNGGIHYNPSFQSRLSITRDTSKNQFFLQLNSVTAEDTAMYYCAREG
Echinops telfairi V527 ighv AAIY02264084.1 1341 GLAQVQLQESGPQMVRPSQTLTLTCTITGDSVFSTSATWDWIRKRPGSSLQWMGRTYYRSKWYREYTPSLKDNLIINPDTSKNQFSLQLSSMTADDTAMYYCARE
Echinops telfairi V528 ighv AAIY02264193.1 6927 VLAEVQLQESGPGLVKPSQTLSLTCAVSGLSLTSYDVNWIRQAPGKGLEWVGAIWGGGGTDYNPALQSRVNITRDTSKSQVYLKLNSVNPDDTAIYYCAG
Echinops telfairi V529 ighv AAIY02264648.1 725 VLSQVQLQESGPGLVKPSQKLSLTCTVSGYSITSVYCWSWIRQPSGKGLQWMGCIDYDGDTDYNPSFQSRLSITRDTSKNQFSLQLSSVTAEDTAMYYCGR
Echinops telfairi V530 ighv AAIY02264889.1 2100 GLAQVQLQESGPQMVRPSQTLTLTCTITGDSVASTSATWDWIRQHPGSGLQWMGRTYYRSNWNREYLPSLKDRLVINPDTSKNQFSLQLSSVTAEDTAVYYCAR
Echinops telfairi V531 ighv AAIY02264890.1 3492 GLAQVQLQESGPQVVRPSQTLTLTCTITGDSVSSTSATWDWIRQRPGSGLEWMGRTYYRSKWYRDYVPSLKDRLVINPDTSKNQFSLQLSSVTAEDRAVYYCARE
Echinops telfairi V532 ighv AAIY02265565.1 11354 VLAQVQLQESGPGLVKPSQTLSLTCAVSGFSLTSNGVHWINQAPGKRLYWVGVIWSGGSTLYNPALQSRVRIIRDTSKSQVSLKLSSVNPEDTAMYYCAR
Echinops telfairi V533 ighv AAIY02266661.1 7333 VQCEEQLLESGGDLRKPGESLRLSCAASGFTFSSYAMSWVRQAPGKGLQWVTTISSTGGATYYTDSVKGRFTISRDNAKNTLYLQMNSLKAEDTAMYYCAR
Echinops telfairi V536 ighv AAIY02273938.1 1376 GLAQVQLQESGPQMVRPSQTLTLTCTIAGDTVSSTSATWDWIRQRPGSSLQWMGRTLYSSKWYREYSPSLKDHLIINPDTSKNQFSLQLSSVTAEDTAMYYCAR
Echinops telfairi V539 ighv AAIY02275721.1 196 VQCEVQLVESGGDLTKPGGSLRLSCAASGFTFSDHYMSWIRQAPGKGLQWVAEISSTDRITYYTDSVKGRFTISRDNSKNTLYLQMNSLKPEDTAMYYCAR
Echinops telfairi V540 iglv AAIY02277357.1 218 SWAKSVLSQPPSVSGNLGQKVTISCTGSSSNIGGGNYVHWYQQLPGTAPKLLIYGNNKRPSGVSDRFSGSVSGNSGSLTITGLQPEDEADYYCESYD
Echinops telfairi V596 trdv AAIY02036702.1 1522 KAMLCDKVTQNSMEQRVGLGSEVTLLCTYDVGSSNPILYWYRVRPDHSLQFVLYRYNTQSRHADFTQGRFSVKHSQTQKTFHLVISSVKTEDAAMYYCAWD
Echinops telfairi V789 igkv AAIY02160551.1 52025 SSGEIMLTQSPASVAVSPGERVTINCKASSSVSTSYLHWYQQHPGASPKLLIYSTSNPASGTPARFSGSGSGTDYSLTISSVEAEDAASYYCQQVDSSP
Echinops telfairi V790 igkv AAIY02160551.1 39558 SAGQILLTQEAESLAVSPGEGVSISCRASQSLLYTDGKHYLSWYQQKPGQPIKVLVYHASTRANGVPTRFSGSGAGTDFSLTISSLQPEDTADYYCLQTLKSP
Echinops telfairi V791 igkv AAIY02160552.1 39615 ASGDIVMTQSPSSLAASAGETVTMNCKSSQSLLYASNQKNYLAWYQHKAGQAPKLLIHWASTRVSGVPDRFSGSGSQTDFTLTISGLQAEDLGDYYCQQYYST
Echinops telfairi V792 igkv AAIY02160552.1 30264 ANGDIMMTQSPASLAASPGETVTLNCKSSQSVSNYLSWYQQKPGQTPKLLIYRASNQATGVPSRFRGSGSGTDFSLTISSLQAEDVADYYCQ
Echinops telfairi V793 igkv AAIY02160552.1 17034 SNGEIMLTQSPASLAVSPGERVTINCKASSSVSSSYLNWYQQKPGASPKTLMYSTSNPASGTPARFSGSGSGTDYSLTISSVEAEDAASYYCQQWYSN
Echinops telfairi V794 igkv AAIY02160552.1 2774 SSGEIVLTQSPASLAVSPGERVTINCKASSSVGTSYLHWYQQKPGASPKLLIYRTSNPASGTPARFSGSGSGTDYSLTISSVEAGDAASYYCQQWSSNP
Echinops telfairi V795 igkv AAIY02160553.1 12547 ASGDIVMTQSPSSLAASAGETVTMNCKSSQSLLYASNQKNYLAWYQHKAGQAPKLLIHWASTRVSGVPDRFSGSGSQTDFTLTISGLQAEDLADYYCKQHLSYP
Echinops telfairi V796 igkv AAIY02160554.1 7499 ASGDIVMTQSPASRAASTGETVTINCKSSQSIGNNVAWYQQKPGQAPRLLIYGASSLQSGVPSRFRGSGSGTDFTLTISSLQPEDVADYYCQQHQSYP
Echinops telfairi V797 igkv AAIY02160556.1 51242 ASGDIVMTQSPASRAASTGETVTMNCKSSQSVNSYVAWYQQKRGQPPRLLIYGASSLQSGVPSRFTGSGSGTDFSLTISSLQPEDVADYYCQQYKSDP
Echinops telfairi V798 igkv AAIY02160556.1 23446 ANGDIVMTQSPASRAASTGETVTINCKSSQSISNDVAWYQQKPGQAPRLLIYGASSLESGVPSRFRGNGYGIDFSLTISSLQPEDVADYYCQQAYSSP
Echinops telfairi V799 igkv AAIY02160556.1 13857 ANGDIMMTQSPASLAASPGETVTLNCKSSQSVYNNLNWYQQKPGQAPKLLIYGASNQATGVPSRFRGSGSGTDFTLTISSLQAEDVADYYCQQGY
Echinops telfairi V800 igkv AAIY02160559.1 6696 ASGDIVMTQSPAFLAASPGETVTMNCKSSQSVNNYLSWFQQTPGQAPKLLIYGASNQATGVPSRFRGSGSGTDYTLTISSLQAEDVADYYCQQDYSFSL
Echinops telfairi V801 trgv AAIY02161068.1 839 GLAQLKLEQPALSISKATRKSAHITCKVSSGNFANRVIYWYRLKPNQAIEYLIGVLSTSTPAQVSLGKKSKTLEASKNVQTSTSILKINYVEKEDEAMYYCAGW
Echinops telfairi V802 trgv AAIY02161070.1 20287 GLAQLKLEQPDLSITKATRKSAHITCKVSSDNFANRVIHWYRLKPNRVIEHLMFVTSTSTPVQVSLGESRKKLEASKNVRTSTSTLKINSVEEEDEAVYYCACW
Echinops telfairi V803 trgv AAIY02161070.1 8234 GVHALQVEQTQLSVCTARRKSVDIYCSVSETNFATEAVHWYRQKSNQALEHLIHITSTTTPAHRRLGNRDNKIEARKDSPSSTSILTINFIEEDDAAVYYCAGW
Echinops telfairi V804 trgv AAIY02161071.1 6624 GLGLQKLEQPQISICTARKKSVAIYCTVSSTSFKNEVIHWYRLKPSGAMEHLIEITSTEHPVQRSLGNKSNKIVARKYSHSSTSFLTIHFIEEEDAAVYYCAGWY
Echinops telfairi V805 trgv AAIY02161074.1 10839 DQSDIRLEQPAYVHGRRRSSVALQCQVRSTVRYIHWYRHQEGKAPERLLYLDMFQSDIRWDSGLKAEKITAMEAKDGRSCTLWVQKLEKSDEGVYYCAAWH
Echinops telfairi V819 ighv AAIY02168327.1 5697 NDSEVHLVQSGAEVKKPGASVKISCKTSGYSLTSYLIGWVRQTPGHRFEWMGEISTSNGGTRYPSKFQSSIAMTRETSQSTASMELRGLSSEDMAMYYCRR
Echinops telfairi V902 trbv AAIY02229596.1 4019 LEDATVTQSPGHKVLGRGKALTLDCSQDMNHFVMYWYRQDPGHGLRLIYYSTGVGSFEKGDIPEGYRVSRKEMRDFPLTLPVASPNQSSVYLCASSE
Echinops telfairi V903 trbv AAIY02229596.1 352 AASGALVSQEPRRAICPQGASVTIQCRVDVQVSVIFWYRQLPGRSLQVMATANQGSDATYESGFSKDKFPISRPILTFSNLTVRQGSPADSGFYLCST
Echinops telfairi V904 trbv AAIY02229598.1 6267 SMDNGIIQTPRIRIVQIGRSITLECSQVKSHDYMYWYRQDSGLGLSLIYYSIDVDDISKGEAAEGYSVSRKKLTEFPLSLGAATPNQTALYFCASSF
Echinops telfairi V905 trbv AAIY02229602.1 6226 SKDTEVTQTPGRLVRGAKQKARMECDPIKGHVYVSWYRQRPGEELKFLISFSNREPVDSSGMPAKRFSAKCPPDSACHMEIEPTEPGDSAVYFCASSQ
Echinops telfairi V906 trbv AAIY02229606.1 4217 SKDTEVTQTPGRLVRGAKQKARMECVPIKGHSYVYWYHQKPGEELKLLVYLVNEKVVDSSGMPDNRFSAKCPQDLPCHMEIEPTEPGDSAVYFCASSE
Echinops telfairi V907 trbv AAIY02229612.1 7081 SKDTEVTQTPGWLVRGAKQKARMECVPIKGHNYIYWYHQKLGGELKFLIYFRNEDALDTSGMPEKRFSAKCPPNSACHMEIEPTEPGDSAVYFCASSQ
Echinops telfairi V908 trbv AAIY02229617.1 3298 SMAAKVTQSPTYQLTRVGRPVTLSCSQSLNHDAMYWYQQKPSQPPKLLLYFYDKQLNKETDTSDNFQASRHNTSFCDLGIRSPGVGDSAVYLCASSR
Echinops telfairi V909 trbv AAIY02229619.1 28200 LTGAAVTQTPRHRVTKRSQVLAYTCDPISGHHFLFWYQQTLGQGLEFSMYFLNLEATDTSVAHGAQFSVERPQCSTSTLGIEPAERRDLAVYLCASSL
Echinops telfairi V910 trbv AAIY02229623.1 4881 LTGAGVTQTPRHRVTKWGQAVALTCDPILGHPHLFWYPQPLGQGAEFLMYFDNKDAVDTSGMPGARFSADRPEGSSSALRIQPAGLGDSAVYLCASSL
Echinops telfairi V911 trbv AAIY02229625.1 8362 STDIGVTQTPRHLVSGVGSSRSLHCTQRLGHNAMYWYRQAPGEGPKLMFSYNYKDLTANETVPSRFSPQYKDSTQLSLHVDTLEPGDSAVYLCASSQ
Echinops telfairi V912 trbv AAIY02229625.1 6771 YSALGVSQSPRHLVSQMERMVVLQCDPIPGHLALYWYRQSPGQKVEFLSYFYRETLSEKSKTLGDRFSLERPGGSSSTLKIQPVRPGDSAVYLCASAQ
Echinops telfairi V913 trbv AAIY02229625.1 3994 PLDSAISQTPKYLLTQMGSRGSLHCEQTLGHEVMLWYRQTLGGAPRVLFSYNNRILIDNQSVPSRFSPECPDKDHLHLHVDALEPSDSDVYLCASS
Echinops telfairi V915 ighv AAIY02230033.1 14577 VLAQVQLQESGPGLVKPSQTLSLTCAVSGFSLTSYNVNWVRQAPGKGLEWIGVIWGNGGTRYNPALQSRVSITRDPSKSQVYFKLNSVIPEDTAVYYCAR
Echinops telfairi V917 ighv AAIY02230492.1 39031 VCAQVQLVQSGAEVKRPGESLRISCKTSWFSFTGSWIDWIRQTPAKGLEWIGMIRPSDVDTRYNPSFQGKDTISTDNSISTMHLQWSSLKGSDMATYYCAG
Echinops telfairi V953 ighv AAIY02246339.1 5699 GLAQVQLQESGPHMVRPSQTLTLTCTIMWDSVSSTSASWDWTRQRPGSGLEWMGRTYYRSKWYRDYAPSLKDRLVIDPDTSKNQFSLQLSSVTAEDTATYYCARE
Echinops telfairi V964 iglv AAIY02252482.1 3660 SVVSYELTQSPSVSVALGQTASIPCKGNSIGDKYVQWYQQNSGQPPKMVIFEDSKRPTGIPDRFSGSNSGNTATLTISRAQADDDADYYCQVWDGSA
Echinops telfairi V965 iglv AAIY02252499.1 11478 SWAQSALTQPPSASGTLGQKVTLSCSGSSNDIGKYNLVSWYQQHPGTAPKPLIYDVNKRPSGIPDRFTGSKSGNTASLTISGLQAEDEADYYCASYAGSNT
Echinops telfairi V966 iglv AAIY02252499.1 336 SWAQSALTQPPSASGTLGETVTLSCSGSSNDIGGYDYVSWYQQHPDTAPKPLIYEVNQRPSGIPDRFTGSKSSNTASLTVSGLQAEDEANYYCASYAGSGT
Echinops telfairi V967 iglv AAIY02252501.1 2112 SWAQSALTQPPSASGTLGETVTLSCSGSSNDVGKYTAVSWYQQHPGTAPRPLIYQVNKRPSGIPDRFTGSKSGNTASLTISGLQAEDEADYYCASYAVSNT
Echinops telfairi V968 iglv AAIY02252504.1 11784 GSVTSYELTQPRSVSVALGQTATLTCSGELLPEKYSYWYQQKPGQPRQAPVQVIYKDSERPSGIPDRFSGSSSGTTATLTISRAQVEDEADYYCQSADSNSN
Echinops telfairi V969 iglv AAIY02252504.1 5632 GSVTSYELTQPRSVSVALGQTVTLNCSGELLPKKYCHWYQQKPSQPPQAPVQVIYKDSERPSGIPDRFSGSSSGTTATLTISRAQVEDEADYYCQSADSNSN
Echinops telfairi V970 iglv AAIY02252528.1 8211 SLSQPVLTQSPSASASLGASTKLTCTLSSAHSTYTIEWFQQRAEKSPRFVMRVGSSGMVGSRGDGIPDRFSGSSSGADRYLTITNVQAEDEADYFCGADYSGGY
Echinops telfairi V976 iglv AAIY02253857.1 1354 TSSQPLVTQESSVAVSAGGTVTLTCGSSTGAVTNGHYPYWYQQKSGQAPRTLIYDTNNKLSWTPAWFSGSLLGGKAALTLSGTQPEDEADYYCSLWY
Echinops telfairi V977 iglv AAIY02253861.1 18785 TSSQAVVTQEPSLTVSYGGTVTLTCGSSTGAVTNDHYPYWFQQKPWQAPRTLIYDTNIKHPWTPARFSGSLLGGKAALTLSGAQPEDEAEYHCWLVYS
Echinops telfairi V978 iglv AAIY02253861.1 13763 SLSQPVLTQSPSASASLGASAKLTCTLSSAHSTYTIEWYQQRAEKSPRFMMAVGSSGMVGSRGDGIPDRFSGSSSGADRYLTITNVQAEDEADYFCGAGY
Echinops telfairi V979 iglv AAIY02253861.1 7805 SLSQSQPVLTQSPSASASLGASAKLTCTLSSAHSTYRIEWFQQRAEKSPRFVMAVGSSGMTGSRGDGIPDRFSGSSSGADRYLTITNVQAEDEADYICGVS
Echinops telfairi V980 iglv AAIY02253879.1 19180 SWAQSVLTQPPSVSGNLGQQVTISCTGSSNNIGSSTVRWYQQLPGTAPKALIYDNNKRPSGVPDRFLGSKSGNSGSLTITGLQVEDEANYYCHSYDK
Echinops telfairi V981 iglv AAIY02253879.1 3071 TAQVVVTQEASRTTTAGGTVTLTCGSSAGTVTTNNEASWIQQQSLHTPKGLIAHATNRVPGVPVRFSGSLVGGKATLTITGAQIEDEAKYYCAL
Echinops telfairi V982 iglv AAIY02253883.1 729 TSSQAVVTQETPQTMSLGGTVTLTCGSSTGAVTNGHYPYWFQQKSGQVPTRLIYNTNSKYSWTPAQFSGSLLGGKAVLTLSGAQAEDEAEYYCSVWYSDH
Echinops telfairi V983 iglv AAIY02253889.1 2040 AMSQAVVTQDPSLTTTPGGTVTLTCGSSAGAVTSSNYPAWVQQNRYQVPRGLIGSTSNKVPGVPARFSGSLQGDKAVLTITGAQMEDEADYYCALWFSNH
Echinops telfairi V984 iglv AAIY02253893.1 3958 SWAEVMFTQPHSVKGTPGQEVRISCIRSSGNIENNYVYWYQQHPGSAPINVIYKYNQRPSGIPARFSGSMDSSSNTAWLTISALQPEDEADYYCLSGYDNY
Echinops telfairi V991 ighv AAIY02260213.1 5970 VFSQITLKESGPGLVKPTQTLSLTCTFSGFSLSTTGIGVGWIRQPTEKALEWLALIYWDDDKRYSSSLKSRLSISKDTSKNQVFLSMTNMAPSDTAMYYCARR
Echinops telfairi V992 ighv AAIY02260230.1 5098 VLSQVQLQESDPGLGKPSQKLSLTCTVSGFSITSSSCWHWIRQPSVKGLQWMGRICSDGSTYYNPSFQSRLSITRDTLKNQFSLQLNYMTAEDTATYYCAR
Echinops telfairi V993 ighv AAIY02260245.1 1202 ILSQVQPQESWPGLVKPSQQLFLSCTVSGVSITSTGYNWNWICPTSENGLQWMGYRDYDDGPDYSLSFLSQLSVTRDTSRNQFSLQLSSDMAVYYCAG
Echinops telfairi V995 ighv AAIY02260277.1 5946 VLAQVQLQESDPGLVKLSQTPSFTCAVSGFSLSSYHVTWVHQALGKGLERIGVIRNNGDTKHTPVLESQLSFTRDTSQNHVSLKLSSVNPEDTAMYYCAR
Echinops telfairi V997 ighv AAIY02260894.1 5542 VLSLVQLQESGPGLVKPSQKLSLTCAVSGFSITSSGYSWNWIRHTSGKGLQWMGNIWDDGNTYYNPSFQSRLSVTSDTSKNQFSLQLSSVTAEDTAMYYCARG
Echinops telfairi V998 ighv AAIY02260903.1 7597 VLSQVQLQESDPGLVKPSQKLSLTCTVSGVSITSSSYCWNWIQQTSGKGLQWMGEICYDGNTYYNPSFQSRLSVTRDTSKNQFSLQLSSVTAEDTAIYYCAR
Echinops telfairi V999 ighv AAIY02260906.1 9841 VLAQVQLQEWGPGLVKPSQTLSLTCAAYGFSLTSTGVHWIRQSPGKVLEWLGVVWGGGSTDYNPAFQSRVSITRDTSKSQVSLKLSSVNPEDTAMYYCAR
Echinops telfairi V1000 ighv AAIY02260910.1 1800 VLSQVQLQESGPGLVKPSQKLTLTCTVSGVSITNSGYYWNWIRQASGKGLQWMGDIDYDGDTDYHQSFQSRLSVTRDTSKNQFSLELSSVTAEDTAVYYCAR
Echinops telfairi V1001 ighv AAIY02260912.1 1299 VQCEVQLVESGGDLRKPGGSLTLSCATSGFTFSDYYISWIGQFPGQRLEWVGFIRNAANGQTTEYASSVKGRFTISRDNAKSVAYLQMNGLKQEDTAMYYCV
Echinops telfairi V1002 ighv AAIY02260915.1 1802 APSRVGSSTCEAVTEALTCTVSGFSITSSGYCWHWIRQPSGKGLQWMGQICYDGNTYYNPPFQSRLSVTRDTSKNQFSLQLSSVTAEDTAMYYCAR
Echinops telfairi V1003 ighv AAIY02260923.1 4274 VFAQITLKESSPGLLKPTQTLSLTCTFSGFSLSTTGIAVGWIRQPPEKALEWVALIYWDDDKRYNASLKSRLSISKDTSKNQDFLSMTNTDPTDTAMYYCA
Echinops telfairi V1004 ighv AAIY02260947.1 8332 LVKRSQQLSLTCTVSGVSSTSTGYDWNWICQTSENGLQWMGYRDYDGGTDYNPSFLSRPSVARDTLRNQFSMQLSSVTAEDTAVYYCTWSTVRGSQ
Echinops telfairi V1005 ighv AAIY02261603.1 1837 ILSQVQLQESGPGLVKPSEKLSLTCTVSGFSITSSGYCWNWIRQPSGKGLQWMGRICYEGSTNYNPSFQCRLSITRDTSKNQFFLQLSSVTAEDTAMYYCAG
Echinops telfairi V1006 ighv AAIY02261609.1 2416 VLCEVHLVESGGDVTQPGTSLSLSCKASGFTFSDYAMQWVRQAPGKGLEWVALVSQPSGSTQQYSPSVQGRFTISRDNPTNTVSLKMTDLKAEDTAMYYCTR
Echinops telfairi V1007 ighv AAIY02261615.1 8437 VQCEVNLVESGGDLTKPAGSLRLSCAVSGFDFSQYWMSWVRQAPEKGLQWVTQISNSGGSTYYTDAVKGRFTITRDNSKNTLYLQMDQLKAEDTAIYYCAR
Echinops telfairi V1008 ighv AAIY02261620.1 2946 VLAQVQLQESGPGLVKPSQTLSLTCAVSGFSLTSNGVHWINQAPGKRLYWVGVIWSGGSTLYNPALQSRVRIIRDTSKSQVSLKLSSVNPEDTAMYYCAR
Echinops telfairi V1009 ighv AAIY02261621.1 3235 VRSEPTLQESGPGLVKPSATLSLTCSVSGDSITSSYYWNWIRQHPQRGLEWMGYWTGSTSYNPAFQGRISITTDTAKNQFFLQLSSVTAEDTAIYYCAR
Echinops telfairi V1010 ighv AAIY02261626.1 5486 VLAQVQLQESGPGLVKPSETLSLTCSVSGFSLTSNGVQWARQAPGKGMEWVGGIWNTGSTYYNPALQSRVSITRDTSKSQVYLKLSSVNPEDTAVYYCAR
Echinops telfairi V1011 ighv AAIY02261627.1 5137 QLQESGPGLVKPYQKLSFTCTVSGVSITSSSYCWHWIHQTSGKGLQWMGEICYDGNTYYNSPFQSRLSVTRDTSTNQFSLKLSSVTAEDTAIYYCAR
Echinops telfairi V1014 ighv AAIY02261668.1 9611 VCAQVQLVQSGSELKRPGESLGNSCKLSGYSFTRNWIHWIKQIPGKGLEWIGMIYPGESDPRYNPSFPGKVTISTDNSISTMYLQWSSLRDSDTAMYYCAR
Echinops telfairi V1016 ighv AAIY02262259.1 11388 VLAQVQLQESGPGLEKPSQTLSLTCAIFGFSLTSYNVNWICQAPGKGLEWIGIIIYDGKTYYNSSLQSRVSITKDTSKSQVSLKLNSVNPEDTAVYYCAR
Echinops telfairi V1017 ighv AAIY02262260.1 4263 VQSQMQLQESGPGLVKPSQKLSLTCTISGFSITNSGYYWSWIRQTSGKGLQWMGHLRYDGATYYNPSFQSRLSITRDTSKNQFFLQLSSVTSEDRAVYYCAR
Echinops telfairi V1018 ighv AAIY02262264.1 3289 VQCEVQLVESGGDLRKPGGSLKLSCVASGFTFSSYWMSWVRQAPGKGLQWVARINTDGGSTYYTDSIKGRFTISRDNSKNTLYLQMNSLKPEDTATYYCAS
Echinops telfairi V1019 ighv AAIY02262265.1 3815 FQCEVQLVESGGYLRKTGGSLRLSCAASGFTFSSYWMDWVRQAPGKGLQWVANINTGDGSTYDTDSVKGLFTISRDNSKNTLYLQMNSLKPEDTATYYCAR
Echinops telfairi V1020 ighv AAIY02262267.1 758 VLAQVQLQESGPGLVKPSQTVSLTCTVSGFSLTSSDVYWTRQAPEKGLEWVGAIWSIGATRYNSALQSRVSITQDTSKGKVYLKLSSVIPEHTAMYYCAR
Echinops telfairi V1021 ighv AAIY02262269.1 1473 VLSQVQLQESGPGLVKPSQTLSLTCTVSSFSITSSGYYWNWIRQTSGKGLQWMGYIGYDGGTYYNPSFQSRLSITRDTSKNQFSLQLSSVTAEDTAVYYCAR
Echinops telfairi V1022 ighv AAIY02262281.1 1487 VCAQVQLVQSGAEVKRPGESLRISCKTSGFSFTSYYLSWIKQTPGKGLEWIGRIDPENSETRYNPSFQGKVTISTDNSISTMYLQWGSLKDSDTAMYYCA
Echinops telfairi V1023 ighv AAIY02262767.1 1144 VLTQVQLQESGPRLVKPSQTLSLTCTVSGFSLTSYDVNWIRQAPGKGLQWVGDIWGGGSTHYNPALQSRVSITRDTSKSQVYLKLNSVIPEDTAVYYCAR
Echinops telfairi V1025 ighv AAIY02263199.1 7111 ALSEVQLQELGPGLVKPSQNLSLTCTVSGFSITSSGYLWNWIRQMSGKGLQRMGGICYDGDTNYIPYFRNRISITRDTSKNQFSLQLSSVTAEDTTMYYCAR
Echinops telfairi V1026 ighv AAIY02263908.1 5326 IQCEVQLVESGGDLRKPGGSLRLSCAASGFTFSSNWMSWVRQAPGKGLQWVANINYDGGSAYYTDSVKGRFTISRDNSKNTLYLQMESLKAEDTATYYCAR
Echinops telfairi V1027 ighv AAIY02263910.1 1474 VLAQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVHWIRQAPGKGLEWVGIIYTGGSTRYNPALQSRVSITRDTSKSHVYLKLSSVNPEDTAMYYCAR
Echinops telfairi V1029 ighv AAIY02264037.1 4307 VQCEVKLVETGGDVRKPAGSLRLSCAASEFTFSDYWMSWVRQAPGKGLQWLATIKYDSGSIYYTESVKGRFTISRDNSKNTVYLQMDSLKAEDTAMYYCARV
Echinops telfairi V1030 ighv AAIY02264045.1 1436 VCAQVQLVQSGAEIKRPGESLRISCKTSGFSFTSCYLHWIRQAPGKGLEWIGRIDPEDSDTRYNPSFQGKVTISTDNSISTMYLQWGSLKDSDMTMYYCVR
Echinops telfairi V1031 ighv AAIY02264099.1 1519 VQSEVKLVESGGDLTKPGGSLRLSCAASGITFSDYYMHWIRQAPGKGLQWLAEISNTGGSTYYTDSVKGRFTISRDNSKNTLYLQMNSLKAEDTATYYCA
Echinops telfairi V1033 ighv AAIY02264101.1 2238 VQCEVQLVESGGDLTKPGGSLRLSCAASGFTFSDYSMSWIRQAPGKGLQWVAAISSTGGSTFYTDSVKGRFTISRDNSKNTLYLQTNSLKPEDTATYYCA
Echinops telfairi V1035 ighv AAIY02264144.1 1717 VQCEVQLLESGGDLLKPGGSLRLSCAASGFTFSDYDMNWVRQAPGKGLQWVAEISSTGGSTYYTDSVNGRFTISRDNSKNTLYLQMNSLKPADTAMYYCAR
Echinops telfairi V1036 ighv AAIY02264146.1 1490 VQCEVQLLESGGDLRKPGGSLRLSCAASGFTFSSYYMSWIRQAPGKGLQWVATISHTGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLKAEDTAMYYCA
Echinops telfairi V1037 ighv AAIY02264160.1 11853 VQCEVKLVESGGDLTKPGGSLRLSCAASGFTFSDYGMNWVHQAPGKGLQWVAYINYDGSYIEYTDSVKGRFTISRDNSKNTLYLQMNNLKTEDTATYYCA
Echinops telfairi V1038 ighv AAIY02264264.1 5777 VHCELQLVESGGDLRKPGGSLRLSCVGTGFTFSSYGIHWIRQAPEKALEWVAVIWHDGSKTVYADSVKDRFIISRDNSKSTAYLQMNSLRTEDTAMYYCAR
Echinops telfairi V1040 ighv AAIY02264323.1 9230 VQCEVQLVESGGDLTKPGESLRLSCAASGFTFSDYYMNWFRQAPEKGLQWVARISNTGGNTYYTDSVKGRFTISRDNSKNTLNLQMNSLKAENTATYYCAR
Echinops telfairi V1041 ighv AAIY02264323.1 4516 VLSQVQLQEAGPGLVKPSQELSLTCTVSGYSITSGYCWSWIHLPSGKWLQWMGHISANVNNYNPFFKSQRSITRDISKNQFSLQLSSVTAEDTAMYYCAR
Echinops telfairi V1042 ighv AAIY02264330.1 1558 PGLVKPSQKLSLTCTVSGYSITSGYCWSWIHQPSGKGLQWMGCIRYDGDTDYNLSFQSRLSINRDTSKNQFSLQLSSVTAEDTALYYCAGISV
Echinops telfairi V1043 ighv AAIY02264433.1 800 VQCEIQLVESGGDLRKPGESLRLSCAASGFTFSDHWMYWIRQFPGKGLQWVAEISNTGGSTYYTDSVKGRFTISRDNSKNTLYLQMNSLEPEDTATYYCAR
Echinops telfairi V1044 ighv AAIY02264435.1 6012 VQCEVQLVESGGDLRKPGGSLRLSCAASGFTFSNSVMHWVRQAPGKGLQWVAYISGDGSYIKYTDSVKGLFTISRDNSKNTLYLQMNSLKTENTTTYYCAS
Echinops telfairi V1045 ighv AAIY02264436.1 2740 RGGAMECEGDLRQPEASLRLSPAASAFTVCIYHMHWVSPAPAKGRQWVAYINTVGKTSHTDSPRANSPSPETMVRTYYNFTLMDNLKFEDTAVYFCAKD
Echinops telfairi V1047 iglv AAIY02264561.1 745 SWAQSVLTQPSAMSESVGKTVTISCTGGSSNVGRGYPDWFQQLPGASPKLLIYDSDKRPSGVPARFAGSRSGNSAFLTISGLQPEDEASYYCTAWDNSIN
Echinops telfairi V1048 iglv AAIY02264563.1 414 SWAQSVLTQPPSVSGNLGQKVTISCTGSSSNFEDYGVHWYQQLPGTAPKLLIYNDNERPSGVSDRFSGSMSGNSGSLAISGLQAEDEGSYFCQSYDDNLG
Echinops telfairi V1049 ighv AAIY02264776.1 2247 VLSLVQLQEAGPGLVKPSQKLSLTCTVSGFSITSSGYCWNWIRQPSGKGLQWMGCIDYDGDTYYNPSFQSRLSITRDTSKNQFSLQLSSVTPEDTAMYYCAR
Echinops telfairi V1050 ighv AAIY02264926.1 3563 VCAQVQLVQSGAEVKRPGESLRISCKTSGYSFTKNWIHWIKQIPGKGLEWIGMFYPGDSDPRYNPSFQGKVTISKDNSISTVYLQWSSLKDSDMAMYYCAR
Echinops telfairi V1052 ighv AAIY02265231.1 2104 VQCEVQLVESGGDLRKPGGSLRLSCEASGFTFSSYGMSWIRQPPKKGLQWVAYINSDGSYTKYTDSVNGRFTISRDNSKNTLYLQMNSLKPDDTATYYCAR
Echinops telfairi V1053 ighv AAIY02265234.1 1078 VLSQVQLQESGPGLVKPSQKVSLTCTVSGYSITSGYCWSWIRQPSGKGLQWMSFIRYDGNTYYNPSFQSRLSITRDTWQNQFSLPLSSVTAEDMAMYYCAR
Echinops telfairi V1054 ighv AAIY02266779.1 2012 VCGQVQLVQSGAEVKRPGESLRISCKTSGYSFTGSWIYWIRQAPGKSLEWIGMIYPSDSDTRYNPSFQGKVAISTDNSISTVYLQWSSLKDSDMAMYYCAR
Echinops telfairi V1055 igkv AAIY02268521.1 1101 SSGDIVMTQTPLTLPVTLGQVATISCKSSQSLAHSDGNTYLYWFQQKPGKAPRLLIYRVSNRATGVPDRFSGSGAVSDFSLKISGVQADDAAVYYCMQAIQYP
Echinops telfairi V1057 ighv AAIY02273006.1 2643 ILSQVQLQESGPGLVKPSQKLSLTCTVSGFSITSSGYCWNWIRQPSGKGLQWMGVICYSGGTSYNPSFQSRLSISRDTSKNQFSLQLSSVTAEDMAVYYCAR
Echinops telfairi V1058 trbv AAIY02274434.1 1343 PRLAAQVSQHPRRAICKSSTSVKIECHATGIQATTVLWYRQAPGQSFTQIATSTQGSDATYEQGFSKARFPVSHPNLTFSALTVTGVQPEDSSVYFCAVS