WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Sebastes rubrivinctus AUPQ00000000.1 (AUPQ01) 28 5 3 5 7 6 2 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Sebastes rubrivinctus V26 igkv AUPQ01129740.1 88 SRGQVTVTQPGAVSSALGRSVSMKCKISHTVINSDSVEWYQQKQGEAPKLLIYYAINRVSATPDRFTGSGSNSDFTLTISGVQTEDAAVYYCKG
Sebastes rubrivinctus V25 trav AUPQ01125923.1 404 VKGETLTQPASVTVQPGQRLTITCQVSYSVSDYYTAWIRQPAGKRLEWISRDEDVKDSLKNKFSVNLDSSSNTVTLKGQNVQPEDSAVYYCARE
Sebastes rubrivinctus V24 igkv AUPQ01114892.1 82 SRGQVTVTQPGAVISALGRSVSITCRTSPSVRVWSNYHLLAWYQQKDGVAPKLLIHYASTRASGIPGRFTGSGSNSDFTLTISGVQAEDAAFYYCQS
Sebastes rubrivinctus V23 igkv AUPQ01114811.1 1091 SRGQVTVSQPGAVSSALAPSVSITCRTSQTVYNSDYLAWYQQKDGETPKLLIYRATSRASGIPDRFTSSGSNSDFTLTVSGVQTEVAAVYYCQSFHVINSQYV
Sebastes rubrivinctus V22 trbv AUPQ01112148.1 152 LTAGDVVTQTDILWKDEGDNATMSCSHTKGVGYRQMYWYRQRPGETMKLIVFTTTSNENHDFGDFSKDRFAATKTEDKSGTFTVKDLQPEDKGLYFCAVS
Sebastes rubrivinctus V21 trbv AUPQ01102119.1 193 LTAGDDVTQTDILWKDEGDNATMSCSHTKGPRYFQMYWYRQRPGESIKLIVLISMGEKDHDINDYTLKKYAANKPDLVSGTFTVKDLQPEDIGLYFCAVS
Sebastes rubrivinctus V20 trgv AUPQ01072037.1 1086 KLVTQTPAVHTVSTGQQVVLNCNIQRADNYYVSWYKQVPGEAPQYVLSFHHSASSPSFGSGFSSDRFNSKSSSNIDYQFIIKQTEAGDSAVYYCDKWVTSVNEYV
Sebastes rubrivinctus V19 trav AUPQ01068438.1 572 VCLSLDVHQSPSDVITKPGDKVQISCSYDKTDYRVMLWYQRSPGDTAMKLIGYLNVQAVTKEEPYKEHFNISGDLSVNTVKTGSLIIQVTGREQGAVYYCAASR
Sebastes rubrivinctus V17 iglv AUPQ01067136.1 2741 VSGVTVVTQKPPVVAVRKGETSTMDCNLGTVTNERACWYKQTPGGVPQYVLCFYHSWSSVRYGSGFSSPKFTSTHQSTSDYRLTINNVEEGDSAVYYCATW
Sebastes rubrivinctus V16 trav AUPQ01059331.1 1069 EDRVNQTTGDVIATEGHTLTLDCTFETSRTSPYLFWYKQEVQDSPKYMLKSFSNNVDKAPEFQKDRFDARINKKSVPLRIQKLQLSDSAVYYCALQPTVTG
Sebastes rubrivinctus V15 ighv AUPQ01053848.1 1944 LNGQALESIPSTSVVKTPEEALSLSCRGTGFDFSQSGMHWIRQPEGKALEWMGLIYYDASKTVYASNVQGRTEITRDNSNSMTYLRLSNLKPEDSAVYYCA
Sebastes rubrivinctus V14 ighv AUPQ01017473.1 848 VSLGLDVRQSSSDLITTPGDKVHIFCSHDKTDYRVILWYQRSPGDTAMKLIGYLSNTDVTMEEPHKEDFDMSGDLTGSTAKNGSLIVNLVKQEHGAVYYCAARE
Sebastes rubrivinctus V13 ighv AUPQ01007578.1 3316 LSPCEEVHQGPPAILGRLHDSATISCSHSIGSYDTMLWYQQPTGDSELKLIGYVFYSSPIVEKPFSDNFKVTGDGSKKAELHVLKLRHPEDSGVYYCAAAATVV
Sebastes rubrivinctus V12 trav AUPQ01134494.1 836 SSIGVKIDQPPSIISREGEPSVTMQCEQDDSDYYYMYWYRQSSSSGEIQMVTSSLSNNAWSIEAPFNKSKYTMSRPAVLQSSLQIHPVEAADSAVYYCASRR
Sebastes rubrivinctus V11 trbv AUPQ01134494.1 132 ESVTFEQSSSQVVKDGTEELRINCSHDDSNLNRMLWYQHQQSGRSMIFIGYTVLQGTPDYEDQFKDSRFQIEGGTKRGSLIIRKVNSSDSAVYFCAASTQ
Sebastes rubrivinctus V10 iglv AUPQ01124550.1 7 VSGVTVVTQKPPVVTVRKGETSNMDCNLGTVTNSAARWYKQTPGGVPQYILRFHHSYSSAYYGSGFSSPKFTSTHQSTSDYRLIINNVEEGDSAVYYCKTW
Sebastes rubrivinctus V9 ighv AUPQ01122323.1 1161 AQGQSLTSSEPVVSRAGQAVTLSCKVEGLALTWLHWIRQKPGRGLEWIGRIDSGTGTIFAQSLQGQFTITKDTSRNLVYLQVKSLRQEDSAVYYCARQ
Sebastes rubrivinctus V8 trgv AUPQ01103881.1 4626 IVLIQTPAVHTVSTGQQSVLKCNIQRDDRYYVRWYKQVPGEAPQYVLRFHHSKSSPDFGSGFSSDRFDSKSSSNIDYQFIIKQMEAGDSAVYYCNAWDNSTMEYV
Sebastes rubrivinctus V7 iglv AUPQ01103881.1 73 VSGVAVVTQKPPVVTVRKGETATMDCNLETLTGSAARWYKQTPGGVPQYMLSLHHSISSPEYGSGYSSPKFTSTHQSQTDYRLIINNVEEGDSAVYYCKTF
Sebastes rubrivinctus V6 trbv AUPQ01083475.1 7177 FSFCVKIHQPSSILIHEGGPAVTFQCEQDDSEYLYMFWYRRISSGRIQMVTYSLGKDVWNVEAPFNKSKYSMSRPAVLQSSLQIHPVEAADSAVYYCASRR
Sebastes rubrivinctus V5 trav AUPQ01079354.1 843 FTDGSDVTQTPLVWLDEGQSATMNCSHTKDGTFYQMYWYRQLPGEGMKQIVFTQPSSPHQYESGFTEEKFPAKKSDAQTGSLSVERLQPEDSGVYFCAVS
Sebastes rubrivinctus V4 igkv AUPQ01068174.1 335 CSGQVTVTQPPVVTSTPGSTVSLTCNTSPAVYRHSRYGDYMNWYQQKSGQPPKFLIRFVSTRESGTAARFSGSGSSSDFTLTISGVQTEDGAVYYCQSAHEIYSGGV
Sebastes rubrivinctus V3 trbv AUPQ01066935.1 1794 ASLSGSVLQTPPFIIKRTGESVASEINCSHSITNYDVILWYKQDEHKALKLLGNLNVEFVNIEKDAVGKISFDGDGRKHSRLDVSDLSLNDSGVYFCAASQHSAADS
Sebastes rubrivinctus V2 trbv AUPQ01065981.1 813 ASLSGSVLQTPPFIIKRTDESVASEINCSHNITNYDVILWYKQDEHKALKLLGYLNVNYPYPEDDVKGKISFDGNGREHSSLNISDLSLSDSGVYFCAASQHSAADS
Sebastes rubrivinctus V1 igkv AUPQ01021868.1 597 SRGQVTVTQPGAVSSALGRSVSITCRTSQDIHSNYLAWYQQKYGETPKLFIYTTSTRASGIPDRFTGSGSNSDFTLTISGVQTEDAAVYYCQSFHVINSQYV
Sebastes rubrivinctus V0 trav AUPQ01008619.1 1955 YLSAVIQSAAVKQVTGVVSASVGDNVTLHCFHGGSQVAMHFSWYRQALGGGPELLSIVYKFDEPSKVYTWMEKNPRFSVQRKIGVNHLHISDLHVSDSATYLCGS
Sebastes rubrivinctus V27 trav AUPQ01133694.1 506 VSLGLDVRQSPSELITKPGDKVLIFCSHDKTDYRVILWYQRSPGDTAMKLIGYLNYQDVTMEGPYKEHFNMSGNLGGDAVKNGSLIIQVIGREQGAVYYCAASK
Sebastes rubrivinctus V18 ighv AUPQ01068437.1 485 VSLGLDVRQSSSDLITTPGDKVHIFCSHDKTDYRVILWYQRSPGDTAMKLIEYLSHTDVTMEEPHKEDFDMSGDLTGSTAKNGSLIVNLVKQEHGAVYYCAARE