WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Amphilophus citrinellus CCOE00000000.1 (CCOE01) 95 36 1 16 11 27 2 2
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Amphilophus citrinellus V35 trbv CCOE01000109.1 1202806 SSSSDQVYQTPANIYTQGEDAKISCSHSVTNYNTILWYKQSMKQLQLLGYMRFGTSSLETGVNVGIDGGAEEKDNCTLTIKEPKLNSSGVYFCAAS
Amphilophus citrinellus V34 trav CCOE01000088.1 28278 VSCEQLTPDKDEDSSLEGSTVTLSCKYTKGAADYFFWYRKYAGKAPEFLISHLESGDLIAAPSSSTLSVGIRKDETKMDLQISSAAVTDSAVYYCAVK
Amphilophus citrinellus V33 trbv CCOE01005249.1 270 SSSSDEVNQTPADIYAREDAEIICSHSNPNYDQILWYKQSKTELQLLGYMYAGKGSPETGVNVAIDGGANKGEKCTLTIKEIELSSSGVYFCAARYHSAA
Amphilophus citrinellus V32 igkv CCOE01003223.1 282 CSSQVTVTQPSVVTFTPGSSVTLTCRTNRAVAGCGDGQCMFWYQQKSEQTPKLLIRHVSIRHSGTPARFSGSGRSSDFSLTISGAQTEDAAVYYCKSIHVINSANV
Amphilophus citrinellus V31 igkv CCOE01002988.1 1993 SRGQITVTQPGAVISAVGGSVTIKCRTSQSVYVSGSSHFLAWYQQKDGGVPKPLIYLASTRYSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Amphilophus citrinellus V30 ighv CCOE01002773.1 275 VWCDIRLNQPPSEVKRPGETVKISCVTSGYTMTSNGMNWIRQKPGRALEWMGWINTDTTAATYASSFQNRFTFTQDVPSSTQYLEIKSLTAEDSAVYFCAR
Amphilophus citrinellus V29 ighv CCOE01002534.1 87 VKCEQLTQPASVTMQPGQPLTVTCQVSYSVSSYYTAWIRQPAGKGLEWIGMAAVGSTTHYKDSLKSKFSISADSSSKTVTLSGQNVQPEDTAVYYCARL
Amphilophus citrinellus V28 igkv CCOE01002353.1 1526 VDAVIVLTQTPAVYTVSPGQEAVLNCNIERYDGNSIGWYKQVPGGVPQFVLRFHHFHRSLSFGAGFSSDRFNSKSSSKTDNQFIIKRAETGDCAVYYCQTWDSADEIV
Amphilophus citrinellus V27 ighv CCOE01002234.1 12308 VYSIDLIQPDSVVVQPRQSMTITCRVSGYSLTDSNYATSWMRQRGGKQMDWILTMWADGSAAKNDALKNKFSISRDTSAGTVTITGQNLQPEDTAVYYCARN
Amphilophus citrinellus V26 ighv CCOE01002234.1 7229 VKCEQLTQPASMSVQPGQRVTITCQVSYSLSSYYTSWIRQPAGKALEWFSRDTTVKDSLKNKFSVELDSSSNTVTLTGQNLQPEDTAVYYCARQ
Amphilophus citrinellus V25 ighv CCOE01002234.1 5039 VYSIDLIQPDSVIVQPGQSLTITCRVSGYSLTDSSYGTCWIRQHAGKPLDWILCMWYDGSNSKNDALKNKFSVSRDTSAGTVTITGQNLQPEDTAVYYCARE
Amphilophus citrinellus V24 ighv CCOE01001964.1 7686 VRCAELIQPPSVTVQSGQRLTITCQVSYSLSDSRTNWIRQLAGKEMEWIGSVHIGHDTLYKDSLKNKFSISSDSSSKTVTLQGQNVLSEDTAVYYCARG
Amphilophus citrinellus V23 trav CCOE01001843.1 20517 SSEDLLTPSKDVVMSLEGDAVTLSCKYSGLVQALFWYQQKSSSPPQFLIADYSEKTERLTFKKDQENSEFHLEISSAAVTDSAVYYCALR
Amphilophus citrinellus V22 ighv CCOE01001675.1 1725236 QSMESIPTSLVVKRPGETLSLSCRGSGFTFTCCTMHWIRQQQGKALEWIGIGFSNPSSNRYVSSLAGRIEISRDDTNSMVHLRLSNLKAEDSAVYYCAKY
Amphilophus citrinellus V21 ighv CCOE01001675.1 1723483 LNGQAMESIPSTPVIKKPQEALSLSCRGSGFDFGQSGMHWIRQPAGKTLEWMGLIWYDASKTIYANSVEGRIEITRDNSNSMMYLRLSNLKPEDSAVYYCAR
Amphilophus citrinellus V20 ighv CCOE01001675.1 1720771 QSMESIPSSPVVKRPGETLSLSCRGSGFTFTCCGMSWIRQQPGKALEWIGVGHIPSSSNRYVSSLTGRIEISRDDSSSMVYLRLSNLKPEDSAVYYCA
Amphilophus citrinellus V19 ighv CCOE01001675.1 1713394 SPVVKRPGETLSLSCRGSGFTFTCCAMNWIRQQPGKALEWIGIGYSASSSNSYASSLRGRVEISRDDSNSMTYLRLSNLKPEDSAVYYCAR
Amphilophus citrinellus V18 iglv CCOE01001459.1 22334 VSGVTVVTQKPVVSVRRGETATMDCNLGTVTNDVVRWYKQIPGGVPQFVLVFHRTHSSPTYGSGFSAPKFTSTYQSTTDYRLIINNVEKGDSAVYYCKIWDSSVNEYV
Amphilophus citrinellus V17 trbv CCOE01001311.1 82418 LSKYSVHQTPTALIKDPGEEIQINCSHSNSDFDMIQWYKQSPGKNDMVLLGYARFTYTTVEDPFENTYYVSGVGSSLSSFQIPKLREPEDSAVYFCAASA
Amphilophus citrinellus V16 trbv CCOE01001311.1 45812 TVLSSLVIQQSPAHLLIKPDQQGARLECYHGDNDYLYMFWYQYKTAAGGQRTMDLIGRLYYQNPALEKNFESRFNITGHSTGKAQLVISNINPADTAHYFCAAS
Amphilophus citrinellus V15 trbv CCOE01001311.1 38889 VSESVLITQWPRYISSSSNGSAEMHCYQNDTEYQYLYWYRQLRGKGFQLVVATVAGISQFEEGFKSGFQAGKKEKQWSLTITSIQEEDEAVYFCAAR
Amphilophus citrinellus V14 trav CCOE01001311.1 35895 GISLGIQVHQSPSAVFREVGGEVQLTCTHEKSDYRVMLWYQRSPGDAALKLLGYGYTEFKNNSVEEPFRKHFKLAGDLKGDTKHGSLSIIDVKAPEHTATYFCAASQ
Amphilophus citrinellus V13 trbv CCOE01001311.1 29756 VCVGLEVRQSPSEVITNVGSTMQIFCTHEQTDYRVMLWYQQPPGDTAMKLIGFLEYKAVTFEEQYKNHFNITGDLGGNTAKKSSLNIRGIGHEHSAVYYCAARK
Amphilophus citrinellus V12 trbv CCOE01001311.1 27962 VCLGVEVNQTPLEVFRRPGENVQLVCSHGKTDYMLMHWYQKSPGDQALKRIGHLYYGNKDYEESSKQHFNITGDLSGEKAKNASLFIVDLKAPEHSAVYYCAASF
Amphilophus citrinellus V11 trbv CCOE01001311.1 24168 VCWGFEVHQSPSEFITNVGSKVQIFCSHEKTDYRVMLWYQQPPGGTAMKLIGYLNVNSVKLEESEKNDFDMSGDLSGNAEKNGSLIVKAAQQEHSAVYYCAASK
Amphilophus citrinellus V10 trbv CCOE01001311.1 16285 SSFSDQVVQTPPELYKKQEQTAEISCSHRIDNYNVILWYKQAKNSQLQLLGYMVGTSKFPEPGVNVQINGDANIRQKCTLTIEDLTLNSSAVYFCAAS
Amphilophus citrinellus V9 trbv CCOE01001311.1 10025 VCEGLEVRQSPPEIITDVGSKVQIFCSHEKTDYRMMLWYQQIPGNTAMKLIGFLYFKDVTFEDQNKDHFNITGDMSGNTAKHGSLIVKIPQQEHSAVYYCAARE
Amphilophus citrinellus V8 trbv CCOE01001311.1 8102 LSLSDHVHQTPADMYKTSKETAKIECLQNIDDNHDRILWYKQSKSQMQFLGYMLTSKGFPEPGLNVTIDGSASKNQICTLTIERLNLSSSAVYFCAAS
Amphilophus citrinellus V7 ighv CCOE01001228.1 9713 VGSQTLTQSEAVVKRPGESHKLTCTGSGISFRSSWMAWIRQAPGKGLEWIAIIQYHNEYIYYSQSVQGRFIISRDNSREQLYLQMNSLKTEDSAVYYCARE
Amphilophus citrinellus V6 trdv CCOE01001109.1 9754 AGDTISPEQAEVTKTEGQPVTLTCSYETTYTHPELHWYRYHSDLQATQFILWKGGKLDTTEYIPNRRQYGSQTTDTSATLTIKALTLADTALYYCALR
Amphilophus citrinellus V5 ighv CCOE01000843.1 11622 VDGQTLTESEPAVKRPGESHRLTCKGSGYSFGDYHMHWVRQAPGKGLEWIAYISRGGSTTYYSQSVQGRFTIFRDNSRQQLYLQMNSLKTEDLAVYYCA
Amphilophus citrinellus V4 trav CCOE01000706.1 6292 SSEDLLTLSKDVVMSLEGDAVTLSCKYSGIVNNLYWYQQKSSSAPQLLITQFSEKTKGLRFRKDQEKSEFHLEISSAAVTDSAVYYCALQ
Amphilophus citrinellus V3 trav CCOE01000703.1 146205 NVLQPKGDETAAEGSTVTLHCLYNSSSTQTSLFWYKQDGNNSPKFILSRFSGNEGTTADEFKERFSSTLDSTSRSVPLKIQKLQLSDSAVYYCALR
Amphilophus citrinellus V2 trdv CCOE01000703.1 6155 GDTISPQQAEVTEIEGQPVTLTCSYQTDSGYPLLYWYRHHSDLQAPQFILWKGGKLSSDSDYIPDTQYESETSPISTTLTIKALTLADTALYYCALR
Amphilophus citrinellus V1 trbv CCOE01000701.1 293132 RTDESNVTQTPMLWINQGDNATIDCSHTKGATYYQMYWYRQLPGEPMKQMVLTVARSKPDFEPDFRDEKFSTIKTDALSGTLIVKNLVPGDQGLYFCAVSEHSDT
Amphilophus citrinellus V0 ighv CCOE01000162.1 11381 VNGQTVTQSEAVVKRPGESHKLTCTGSNIEFSSYWMAWIRQAPGKGLEWIAIIESDSDRKYYSQSVQGRFSVSRDNSREQLYLQMNNMKTEDSAVYYCARR
Amphilophus citrinellus V71 ighv CCOE01001832.1 19699 TDGQTLTESEAAVKRPGESHRLTCTYSGFSSDIYVAAWIRQAAGKGLEWIAWIRYDSNEIYYSQSVRGRFTISRDNSRKQVYLQMGSLRTEDSAVYYCASY
Amphilophus citrinellus V70 ighv CCOE01001832.1 24425 TEGQTLTESEPVVKRPGESHRLTCTYSGFGGNYWNAWIRQAAGKGLEWVATISATSSSIYYSQSFRGRFTISRDNSREQVYLQMSSLTTEDSAVYYCARE
Amphilophus citrinellus V69 ighv CCOE01001832.1 25172 TEGQTLTESEPVVKRPGESHRLTCTYSGFGGNYWNAWIRQAAGKGLEWVATISATSSSIYYSQSFRGRFTISRDNSREQVYLQMSSLTTEDSAVYYCARE
Amphilophus citrinellus V68 ighv CCOE01001832.1 28659 VKCEQLTQPGSETVQPGHNLTITCQVSYSVGNWYTAWIRQPAGKELEWIGMQFTGGFLYKDLKFPIDLDTSSNTVTLNGQSMQPEDTAVYYCAR
Amphilophus citrinellus V67 ighv CCOE01001832.1 30057 TDGQTVTESESVVKRPGESHRLTCTYSGFSSDIHVAWIRQAPGKGLEWMAWIRNDGSDIFYSQSVRGRFTISRDNSRKQVYLQMSSLTTEDSALYYCARE
Amphilophus citrinellus V66 ighv CCOE01001832.1 31522 VKCEQLTQPASVTVQPGQSLTITCQVSYSMSTWRTHWVREPVGKGLEWIGSAHGGHSTYYKDSLKNTFTISLDTSRNRVTLNGQNVQPEDTAVYYCARQ
Amphilophus citrinellus V65 ighv CCOE01001832.1 38174 TEGQTLTESEPVVKRPGESHRLTCTYSGFSSDIHAAWIRQAAGKVPEWIAWIQSDSSNIYYSQSVRGRFTISRDNSRKQVYLQMNSLTTEDSAVYYCARE
Amphilophus citrinellus V64 ighv CCOE01001832.1 50527 VKCEWLTQPASVTVQPGLTITCQVSYSVGSYRTAWIRQPAEKGLEWIVIGGVGYTTYYKDSLKNKFSISFDSSSKTATFTGQNVQPEDSAVYYCARE
Amphilophus citrinellus V63 ighv CCOE01001832.1 53124 IEGQTLTESEPVVKRPGESHRLTCTYSGFSGDYNKVWIRQTAGKGPEWIAFIGIGSINMYYSQSVRGRFTISRDNSRKQVYLQMSSLTAEDSAVYYCARE
Amphilophus citrinellus V62 ighv CCOE01001832.1 64697 TEGQTLTESEPVVKRPGESHRLTCTYSGFSSHYWNAWIRQAPGKGLKFVATISDSSSSIYYSQSVQGRFTISRDNSRQQVYLQMNSLTTEDSAVYYCA
Amphilophus citrinellus V61 ighv CCOE01001406.1 7549 VYSIDLTQADSMVVQPGQSLAITCRVYSVTDGSYATGWVRQCGGKPMEWIFHQWGGGSFYKNDALKNKFSYSRDTSAGIVTITGQNLRPEDTAVYYCVRVTCR
Amphilophus citrinellus V60 trav CCOE01000489.1 4189291 KVIQPAGDVTAAEGDTVTLGCTFETTDAGPALFWYKQKMNGLPQLLLQRFFITQDDSEAEERIDAKVNKKDKSVPLKIQKLQLSDSAVYYCALR
Amphilophus citrinellus V59 trav CCOE01000472.1 271459 FCCSVKIIQPQFMFSRVGDKSVTLQCEQDNNEYLYMLWYRHADTGQMQLLTYSVNKGIEATEAPFSEAKYSMSRPEVCNSTLHIKQVEAGDSAVYYCASRL
Amphilophus citrinellus V58 trav CCOE01000472.1 280521 GCVGIKVHQTPPALIKKPGDKVQLVCTHNLSEYRVILWYQQAAGQTDMKYIGHVNYKDVTMEESYKQNFNISGDLSTSDTKNVSLVFKPTGAQDSAVYYCAASV
Amphilophus citrinellus V57 trbv CCOE01000472.1 281919 LIWTQSVTQTPSLLLNSGHYAQMDCRHNLHGSYYHMYWFQQLPGQGLRLIVHMLPYKPPDFGNFSQDKYSASKTVSESGSFTVKHVEPSDSGVYLCAVS
Amphilophus citrinellus V56 trbv CCOE01000472.1 284764 ASLSDRVHQTPADIYKYPDQTATLRCLHTISSYNRIFWYKQSESGQLQLLGYMVGDSPTLEAGVSVIIDGNANANQNCILTIENLQQDSSAVFFCAAS
Amphilophus citrinellus V55 igkv CCOE01000288.1 2648362 LTSQLTVTQPPVATSSLGSEVTLTCNINPKVRTWSDGTSRVHWYQQKSGETPKLVMKNGKNPTSEFSSRFSGQGDGVNTYLTITRVQAEDGAVYYCQAYEEINSAWVC
Amphilophus citrinellus V54 igkv CCOE01000288.1 2651566 SDASPSVTQSPAFKAVSLGQTVSLSCTASKGVDDDLSWYLQKPGQPPKLLFYKISSRQSGTPSHFSSSGSEPDFTLTISGVQADDAGVYYCMGAYVGLC
Amphilophus citrinellus V53 igkv CCOE01000288.1 2651566 SDASPSVTQSPAFKAVSLGQTVSLSCTASKGVDDDLSWYLQKPGQPPKLLFYKISSRQSGTPSHFSSSGSEPDFTLTISGVQADDAGVYYCMGAYVGLC
Amphilophus citrinellus V52 igkv CCOE01000288.1 2653143 CSSQVTVTQPPVVTFTPGSTVTLTCRTNQAVLRYDDGDDAMFWYQQKSGQTPKLLIKYAKTLQSGTPARFNGSGSSSDFSMTISGAQAEDAAVYYCQSIHKINSANV
Amphilophus citrinellus V51 igkv CCOE01000288.1 2659064 CSSQVTVTQPPVVTSAPGSSVTLTCRTNQAVYRWDSGDEGMFWYQQKSGQTPKLLIKHIKQLQSGTPARFSGSGSSSDFSMTISGVQPEDAAVYYCEN
Amphilophus citrinellus V50 trbv CCOE01000195.1 24452 QTSSLKSSSSVHQDRHFLSVKSGDSVTLHCSSKSEGAPRFYWYKQTLGEKPKLISTFYKYEKNTFHNEFKSDLRFTLDTKTGQNHLIISDLRISDSASYFCICSY
Amphilophus citrinellus V49 trbv CCOE01000109.1 1158493 KVESVNFEQSSARVVNKGTKELRIDCSHDDSSLAAMLWYQQSAQSMSLIGFTVLQGEPTYENHFKDRFQIIRNNTMKGCLIIRNLSLSDSAVYLCAA
Amphilophus citrinellus V48 trav CCOE01000109.1 1169068 FPDFSHGVKIQQSPFIFSHEGTQNVTLQCEQDDNSHYYMYWYRQSSSGKLELVTFSLSQGSWNIEAPFEKSKYTMSRPSILNSTLQIHNVEAGDSALYYCASSI
Amphilophus citrinellus V47 trbv CCOE01000109.1 1171918 ESVNFQPSYPRIVGETDTVEITCSHDDGGLNVMLWYQQKESGLLSLIGYNYIGSESVNEEQFKDRFEIKRNGAQAGALNINSVIPSDSAVYFCAA
Amphilophus citrinellus V46 trbv CCOE01000109.1 1172463 QVSAVTFQQSPPQIVAEKSEVQIECSHNDATLPLMLWYQHIKQSQSMILIGYGYQNVPQTFEGQFEEHFKLRRGSSTSGTLIIERAEVSHSAVYFCAASTQ
Amphilophus citrinellus V45 trav CCOE01000109.1 1175152 FSLGVQLHQSPSSVIKKAGADVQICCTHGKSDHRVMLWYQQSPGQRALKLIGYGYATFNNDSVEAPFRKHFRLAGDLEGAKKNGSLTIVDLKPLEHTATYFCAAREA
Amphilophus citrinellus V44 trbv CCOE01000109.1 1175819 DISLGVQVHQSPSAAIRNAGDDVQIICTHGKTDYRVMLWYQQSPGDTALKLIGYVDYSTIGYEGAFKKHYNITGDLSGNTAKNGSLFIRSLKESEHSAVYYCAARY
Amphilophus citrinellus V43 trbv CCOE01000109.1 1181750 SSVSHNVRQTPDESFVTSEETDAKISCVHHIQDYTRILWYKQSQNNQMQLLGYMHLDKEYPEPGVNVTMTGRAAKGETCTLTIKGLNPKSSAVYFCAAS
Amphilophus citrinellus V42 trbv CCOE01000109.1 1183037 SPLSDKVHQTPVESFVTSEETDAKISCIHHIQDYNRIYWYKQSQNNQLQLLGYMNVNNQYPETGVNVTMTGRATKGESCTLIIKGLNPKSSAVYFCAAS
Amphilophus citrinellus V41 trbv CCOE01000109.1 1184493 SSLSDKVHQTPAESFYTSEETDAKISCTHHIQDYTQIYWYKQSENNQLQLLGYMNVNKENPETGVNVTMTGRATKGETCTLTIKGLNPKSSAVYFCAAS
Amphilophus citrinellus V40 trbv CCOE01000109.1 1185827 SSFTNQVHQIPANIYTRGEEAKIHCSHNITSYNQILWYKQSRKQLQLLGYMVLTAGNPEPGVNVVMDGNANQGQNCTLTIKEINLNSSGVYFCAARYHSA
Amphilophus citrinellus V39 trbv CCOE01000109.1 1187906 SSLLNQVQQTPADIYYRAEKTAKIECLHSIQHYDKILWYKQPKNDQMQFLGYMNVKDGYPETGANVQINGSATQGGTCTLTITRLTVNSSAVYFCAASYHSAI
Amphilophus citrinellus V38 trbv CCOE01000109.1 1195837 SSLSDQVHQTPANIYTRGEEDAKIICSHSITDYYQILWYKQSKKQLKLLGYMQYSKSFPESGVNVTMDGSAEENKKCTLTIRELNLNSSGVYFCAAS
Amphilophus citrinellus V37 trbv CCOE01000109.1 1198225 SSLSDQVHQTPANIYTRGEEDTKVHCKHSISGYYQILWYKQSKKQLQLLGYMQYSNGVPESGVNVAMDGSAEQNKMCTLTIRELNLNSSGVYFCAASNHSAA
Amphilophus citrinellus V36 trbv CCOE01000109.1 1199132 SSSSDQVHQTPADIFTQGEDAKIICSHNIPTHNQILWYKQSKNQLQLLGYMRYSQSFPETGVNVTMDGSAEQNKNCTLMIKELTLSSSGVYFCATS
Amphilophus citrinellus V93 igkv CCOE01004957.1 1053 CSSQVTVTQPPVVTFTPGSTVTLTCKTNPAVYVWSDGDSNVHWYQQKSGEAPKLVIKLGKNPTSQFSSRFSGRGDGVNAVMTISTVQNDDAAVYYCKSVHSGPV
Amphilophus citrinellus V92 trgv CCOE01002777.1 5935 QLIQDDLTLTRRVGEKVSFRCGGTEQCVTDWVHWYQKKEIFRKILEINKKTNEIVSVKNHPQKDDFSAVNKQSGCELKIDKVKPDHSATYYCICWVSA
Amphilophus citrinellus V91 igkv CCOE01002396.1 4948 SRGQITVTQPGAVSSAVGGSVNIKCRTSQDVYGSDRLAWYQQKDGRAPKLLIYYASSRASGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Amphilophus citrinellus V90 ighv CCOE01002366.1 3870 HGQTLTQSEPVVKKPGESHSLTCTTSGLSFSSWWMAWIRQAPGKELEWIAADVNGGTNYYSQSVRGRFTVSRDNSREQLFLQMSSLKTEDSAVYYCA
Amphilophus citrinellus V89 ighv CCOE01002366.1 6563 THAQTLTESESVVKRPGESHTLTCTASGLTISSNYMAWIRQAPGKGLEWIAWHDSGSGSRRFYSQSVTGRFTISRDDSRQLLQLQMNSLKTEDSAVYYCARD
Amphilophus citrinellus V88 igkv CCOE01002189.1 9492 SSGQITLTQSPGAQSVAAGQSVSITCTSSYSTSYLHWYLQKPGEAPKLLIYYSTTRQSGVSDRFSGARSDAVYTLTIRGVQAADSGVYYCQQGTSFP
Amphilophus citrinellus V87 trgv CCOE01002175.1 14505 ELSQEGLMLNRRVGENVCFSCGLTDQCVTDWVHWYQKKETLRKILEINKKTNAIVSVKNHPQKDDFSAVKKQSGCELKIERVKLDHSATYYCSCYKSA
Amphilophus citrinellus V86 igkv CCOE01002159.1 603 SDASPSVTQAPAFKAVSLGQTVSLNCTASEGVDDYISWYQQKPGQPPKLLFYKISEPESGTPSHFSSSGSEPDFTLTISGVQADDAAVYYCMGVYEGPV
Amphilophus citrinellus V85 igkv CCOE01002159.1 7175 CSSQITVTQPPVVTFTPGSTVTLTCRTNPAVHVYSDGDIRLSWYQQKSGEAPKLVIYYGTKPTSEFSSRFSGRGDGANAVMTISGVQNDDAAVYYCQSAHEINSAWV
Amphilophus citrinellus V84 igkv CCOE01002147.1 2327 SSGEIILTQTPEAQSVVPGQTVSIRCKSSTLIGDDINWYLQKSGEALKLLIYDTTARQSGVPDHFRATAVQTDFTLIISGVQAEDAGVYYCQ
Amphilophus citrinellus V83 igkv CCOE01002043.1 7746 SRGQYTVTQPGAVSSAVGGSVTINCRTSQKVNLWDNNQLLAWYQQKDGKPLKRLIYYASRRDSGISDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Amphilophus citrinellus V82 ighv CCOE01002033.1 4177 VYGQTLTQSELTVKRPGESHRLTCTASGFTFSDYRTVWVRQTPGKALEWIAYIRFDSVYIFYSQSVQGRFTIFRDNSQQQLYLQMSSLKTEDSAVYYCARY
Amphilophus citrinellus V81 trav CCOE01002033.1 7526 VYSIDHIQPDSVVLQPGQSLTITCRVSGYSLTDGNYGTCWIRQHTGKTLDWILCMWSDGSNSKNDALKNKFSVSRDTSAGTVTIRGQNLQPEDTAVYFCAHYHTVIQ
Amphilophus citrinellus V80 ighv CCOE01002033.1 10642 SMAVQPGQSLTITCRVSGYSLTSYGTCWIRQHAGKAMGWILCIWTDGSNSKNDALKTKFSYSRDTSAGTVIITGQNLQPEDKVVYYCARE
Amphilophus citrinellus V79 ighv CCOE01002033.1 12938 VKCEQVTQPASVTVQPGQSLTITCQVSYSVESYWTHWIRQPAGKGLEWIGRAASGYTPVYKDSLRNKFSISTDSSSITVTLNGQNVQSEDSAVYYCARQ
Amphilophus citrinellus V78 ighv CCOE01001994.1 13343 VDVQTLTESEPVIKRPGESHRLTCTASGFTFSHYEMAWVRQAPGKGLKWVASMYSSVSYSQSVRGWFTIYRDNSRQQVYLQMNSLKTEDSAVYYCA
Amphilophus citrinellus V77 igkv CCOE01001976.1 17567 CSSQVTVTQPPVVTFTPRSSVTLTCRTNQDVYRDSDDDDYIFWYQQKSGQTPKLLIRYVKTLQSGTPARFSGRGSGSDFSMTISGAQTEDAAVYYCQS
Amphilophus citrinellus V76 ighv CCOE01001966.1 26021 TEGQTLTESEPVVKRPGESHTLTCTYSGFSGDIYAAWIRQAAGKGLEWIAFIYDDSSGISYSQSVRGRFTISRDNSRKQVYLQMSSLTTEDSAVYYCARE
Amphilophus citrinellus V75 ighv CCOE01001966.1 30401 GKCEQLTQEASVTVQPGQRLTLTCQVSYSVSGYYTAWIRQPAGKGLEWIGIAAVGYTTYYKDSLKSKFSISTDSSSKTVTLTGQNVQPEDTAVYYCARE
Amphilophus citrinellus V74 ighv CCOE01001966.1 33541 VRCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTGWIRQPAGKRLEWIGRVAGSSTDYKDSLKSKFSISADSSSNTVTLIGQNVQPEDSAVYYCARE
Amphilophus citrinellus V73 ighv CCOE01001832.1 13133 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSWHTAWIRQPAGKELEFIQSARVGHPTNYKDSLKNKFSIDLQSSSNTVTLNGQNVQPEDTAVYYCA
Amphilophus citrinellus V94 ighv CCOE01005850.1 812 VDGQTLTESEPAVKRPGESHRLTCTGSGYNFGDYGMHWIRQAPGKGLEWIAYIYNDGSSTFYSQSVQDRFTISRDNSRQQLYLQMNSLKTEDSAVYYCA
Amphilophus citrinellus V72 ighv CCOE01001832.1 18170 VNCEQLTQPASVTVQPGQRLTITCQVSYSLGYWTAWIRQPAGKILEWIGMKDTGSSLYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCAR