WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Anguilla anguilla AZBK00000000.1 (AZBK01) 56 11 2 5 27 8 2 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Anguilla anguilla V15 trav AZBK01517804.1 2137 CRAEDTVTQPMGDMIALEGESVTLGCNYSTSYTPYLFWYIQHPNGFPKYILRRDTLTAGETVPGFERFDAQLNKASSSVPLTIPKVQLSDSAVYYCALR
Anguilla anguilla V14 trbv AZBK01502635.1 987 LSDATTITQEKAVVRREGDSVHIKCEQDGTDQQMYWYRQGHQNGLELIFFSQMDGLNTEKLVVEDRFTATRENRQCFHLNVTKLQPQDSAVYFCASS
Anguilla anguilla V13 igkv AZBK01501545.1 290 SMADIVLTQSPAQTAELGDTVSISCTASEFLGISLHWYLQKPGQAPKLLIDYATIPVVGIPDRFRGSVNGTEHTLIITGVQAEDAGDYYCQTADTSDTFP
Anguilla anguilla V12 ighv AZBK01490678.1 87 GHCVELTQPGSVVVKPGQPLTISCKVSGYSVTDSSYATGWIRQPTGKALEWIGRMWGDGVLEYKDSLKSKFTISRDTSSSTVTLQGSSLQTGDTAVYYCARY
Anguilla anguilla V11 trgv AZBK01454529.1 138 ADALSLVQKTISVTATVGDTAVLTCEATGLSSSDYVHWYQKKEGEPFKRVLYIDFGGRKVHDSTLAQKNSFSVEKSNPPYDLRIDSVEMAHAATYYCASWD
Anguilla anguilla V10 ighv AZBK01443839.1 222 GFCVELTQTGSMAINPGGASSVSCKVSYSVSSYATHWIRQPAGKALEWIGGIGSGGGTAYKDSLKHKFTISRDTSSSTVTLRGSNQQTGDTAVYYCA
Anguilla anguilla V9 ighv AZBK01430686.1 112 GHCFELTQPGSMVVKPGQSLTISCKLSGYPVTGSYSTDWIRQPAGKALEWIGQYYGTDHPYRYRYKDSLKSKFTISIDTSSNTISLQGSSLQTGDTAVYYCARD
Anguilla anguilla V8 trav AZBK01326451.1 722 TVVTQKPPVLSVSKGDTATMDCNLGTVTDWSTYWYKQVPGGVPQFVLYFYHSDSSPTYGAGFSSPRFTSNHQTTSDYRLIIKNVEAGDSAVYYCATWDSSVDEYV
Anguilla anguilla V7 igkv AZBK01269980.1 54 SMADIVLTQSPAARSVQLGETVSISCTASQSVYHSSYSKHTLHWYLQKPGQAPKLLIYDATTRQSGIPDRFSGSGSETRFTLKITGVQAEDAGDYYCQQGKSWP
Anguilla anguilla V6 iglv AZBK01255027.1 885 LEAVLILTQEKSLSVSPGSNVKISCILSESYHISWYQKKPGSSPRFLVVDSTRGTGVSSRFTSSKTGNNDYLHIDKVTADDEAVYYCACVGCQ
Anguilla anguilla V5 ighv AZBK01243852.1 42 AHCDITLTESAPQMKKPGDSVRLSCKITGFSLSSDSVHWVRQAPNKGLQWVGYYVESSDDRFKVTEDSSNSIAYLDITNLQSSDTAVYYCARETQ
Anguilla anguilla V4 trav AZBK01197712.1 44 TVVTQKPPVLSVSKGDTATMDCNLGTVTDSSTYWYKQVPGGVPQFVLFFHHTHNAPNYGAGFSYPRFTSNHQTTSDYRLIIQTVEAGDSAVYYCKTWDSSAKEYV
Anguilla anguilla V3 trav AZBK01178127.1 101 STGAINVQQSPIAQFVKPGEGMKLTCQHDDSNYDRMYWYQQLNGQQALELVGFLYLEDVNQDKEYKGKFNLSGNAKSKGFLTISNLNAEDSGTYFCAAS
Anguilla anguilla V2 ighv AZBK01047962.1 29 LDAITLTSSPAQAKSPGGSVKVSCQVSGYALTDYGTSWIRKRPGKAMEWMGIIWGGGSIDSPAQFKSRFTISRDSSNVLYLDISSLQTEDTAVYYCAR
Anguilla anguilla V1 trav AZBK01046796.1 203 VRSNVAITPKILWGNLGDLALMNCNHTLGAAYNRMYWYKQNPPEGIQLIVFTLPNTNPEFGDFSKDRYVAEKAVPEIGSLTVKKLEAEDSGTYFCAVS
Anguilla anguilla V0 trav AZBK01027599.1 121 GLLGNLIQPDTLVRAKIGDTVTLPCLYPAQELPDISWLKQPLGQKPQLMVVLINYQTDPVFFNEFKNSTRFSAKTKQGSFNLTVSQVEPSDSATYYCA
Anguilla anguilla V53 trav AZBK01772953.1 1542 DSLQEGITSAANAVHALEGNRVTLSCNYTSAVIAGGSLHWYRQYPNSKPEFLILILGSRVNEVKNEFTVRHEKVNNFVHLEISSAKVTDSALYYCALQ
Anguilla anguilla V52 trav AZBK01772949.1 348 DSSQDEITAVKAKVHVLEGNSVSLSCTYTAAVESLYWYRQYPRSKPEYLVFVVSSDRTEGPFTAKHDRNNKTVVLAISVAGMTDSALYYCALK
Anguilla anguilla V51 trav AZBK01615631.1 567 NSFEDAITPIANAVHALEGSSVMLSCNYTGLANNLQWYRQFPRSKPEFLLLIMESSLYIRRADPPYPRLSTELDKNNKTVHLEISSVEVADSALYYCALE
Anguilla anguilla V50 trav AZBK01615629.1 45 DSFQYGITSIANTVQALESSSVTLSCNYTGVNAGDRLQWYRQYPSSKPEFLILILRNKEREDNNGFTVKHENEKNLVDLEISSAEVTDSALYYCALQ
Anguilla anguilla V49 trav AZBK01615625.1 12 DSFQDEITPAAKEVHVLEGNNVTLSCTYTAAATYLHWYRQYAQSKPEFLILVAGTLSKKDKKGRFIVTNDKESKHVLLEISSAEVTDSALYYCALQ
Anguilla anguilla V48 trav AZBK01615623.1 2826 HSLGQDTITSTSKEKHVSDGSSVTLSCNYSAGSVNSLQWYRQHPGSKPEFLILTYSEPKTDKQFTIKHDKNNKFVHLEISSAKVADSALYYCALR
Anguilla anguilla V47 trbv AZBK01613520.1 234 ITVQQSPSSLFGKLNDDVQLTCQHDDSTYYTMLWYQQAKGKQSLELIGFLNYDRVNQDEKYERKFKLTGNGDKKGSLFISKLNAEDSGTYFCAAS
Anguilla anguilla V46 trav AZBK01613518.1 224 LSEAITVQQSPSSLFGKLSDDVQLTCQHDDSNYNTMLWYQQVKGQQDLELVGLLLYAAVTQDEKYKGKFNLTGNGDKKGFLLISKLSAEDRGTYFCAAS
Anguilla anguilla V45 trav AZBK01613515.1 1376 AITVQQSPSSLFGNISDHVQLTCQHDDSNYNRMYWYQQAKGKQSLELVGFLVHAEVTQDEKYKGKFNLTGNGNKRGSLLISQLSAEDSGTYFCAAS
Anguilla anguilla V44 trbv AZBK01613515.1 2865 VQCQSQQKVSQWPSQTVLTQGSSVKFQCNQSGSETYMYWYRQQSLTGLQLVIFSVHMNEPERGENISDRFISTRPKTESITLTISQAEESDTGVYFCAAS
Anguilla anguilla V43 iglv AZBK01588795.1 1872 LEAVVTLTQEKSVAVSLGSSVKISCISSKSNWHMSWYQKKPGSSPRFLIIGTTRATGLESRFTYSKTDNIYLHIDKVTSEDEAVYYCACADCGA
Anguilla anguilla V42 trav AZBK01580013.1 2083 DVIQTPKQAVMKTGESVEISCSHKDNNLQYLYWYWQLPGKGIELIAYILTNQKATFEKDFNDRTERYEIKKPEVLSGSFRIKVLQISDSAVYFCAAT
Anguilla anguilla V41 trav AZBK01558884.1 940 DSFQDGITSVANAVHALEGSSVALSCNYTASLTGGSLHWYRQYPRSKPEFLILIIRTEEREEKDGRIVNHDKANNYVDLELSSVKVTDSALYYCALQ
Anguilla anguilla V40 trav AZBK01551157.1 1373 CRAEDTVIQSTQDVIAIEGQSVTLGCTYSTIGTQIDLFWYIQYPNDFLKYMLRRDKFTAGETAPGFKRFDAHLNKTSSSVPLTIQKVQLSDSAVYYCALK
Anguilla anguilla V39 ighv AZBK01550967.1 1040 VNCQTLTESEPAVKTPGKSHTLTCTASGFTFGDYHMHWIRQAPGKGLEWLAGIRNDGGETWCANLFKEIFTISRDNRKNQLYLQMNRLTAEDTAVYYCARE
Anguilla anguilla V38 trav AZBK01533014.1 1719 ESFQDEITPAAKEVHGLEGNSVSLSCTYTAAVNSLYWYRQYPRSTLEYLVSVVSTDRTEGPFTAKHDKNSKTVHLEISSVVVKDSALYYCALQ
Anguilla anguilla V37 trav AZBK01531040.1 604 ESIGQDAITSTSEKEHVLDGSSVTLSCNYSAVNPRNLQWYRQHPGSRPEFLILIYATSEEKPDKWFTVKHDKKNRRVHLEISSAEVTDSALYYCALE
Anguilla anguilla V36 ighv AZBK01523485.1 419 LSTGEVKLLSKREEEQVSMECTFRTSSSDFYIFYWYRQYPGSALQIILYRGYSSHTSSFAQGRFDATADKSSGKTILTISKLIPEDTAFYYCALVQ
Anguilla anguilla V35 trbv AZBK01503557.1 1231 VQCQSQQKVSQWPSQTVVTQGSSVELQCSQSGSDQNMYWYRQQSSTGLPLVIHSVHMSEPEKGENISSRFTSTRPKRENISLAISQVEESDTGVYFCAAS
Anguilla anguilla V34 trav AZBK01500748.1 27 DSFQDELTPETKEVHILEGNNVKLSCTYTAAAEYLHWYRQYPRSKPEFLILVLATVNKKDIKGQFTVTNDKDSKHVLLEISSAEVTDSGLYYCALR
Anguilla anguilla V33 ighv AZBK01492807.1 293 VQGEIVLTESEAVVKRPGDSHKLTCTASGFTFSNHYMAWIRQAPGKGLEWLASIHGDSSYIYYNPSVKGRFTISRDNSKNQLYLQMNGLTAEDTAVYYCARD
Anguilla anguilla V32 trav AZBK01482560.1 60 VSFQDEITPTAKEVHVLEGNNVKLSCTYRAAANTLHWYRQSPRSKPEFLILVLGTVNKTDIKGQFTVTNDKDKKHVHLEISSAKVADSALYYCALQ
Anguilla anguilla V31 trav AZBK01482185.1 43 TVVTQKPPVLSVSKTDTATMDCNLGTVTDNVAYWHKQVPGGVPQYVLHFHRTHSSPTYGAGFSSSHFTSKCQTNSDCQLIISNVEAGDSAVYYC
Anguilla anguilla V30 igkv AZBK01480214.1 81 SMAYIVPTQSPASQSVQLGDTVSINCTVSQSSGCYPNWYLLKPGQAPKLLIYHSTTRQTGIPDRFSGSGYGPEFTLKITGIQVEDAGDYYCQQYD
Anguilla anguilla V29 ighv AZBK01453211.1 33 VQGKIVLTESEAVVKRPGDSHKLTCTASGFTFSNYWMGWIRQAHGKGLEWVAQISEGSSYTYYAKSVLERFTISGDNSKNQLYLQMNGLTAEDTAVYYCARD
Anguilla anguilla V28 ighv AZBK01452616.1 134 VQGEIVLTESEAVVKRPGDSHKLTCTASGFTFSKHHIAWIRQAPGKGLEWVAQISESGSYTYYANSVEGRFTISRDNSKNQLYLQMNRLTAEDTAVYYCARRD
Anguilla anguilla V27 ighv AZBK01237991.1 502 GHCVELTQPGSMVLTPGQSLTISCKVSGYSLTDSSYCTHWIRQPAGKALEWVGCVCGDGNTYYKDSLKSTFTVSRDTSSSTVSLKGSSLQTGDTAVYYCARE
Anguilla anguilla V26 trav AZBK01226627.1 666 KVSQSTGDVFAIEGESVTLGCNYSTSDASPYFFWYIQYPNAFPKYMLRRHVYGSKDTAPEFKERFDAHLNKTSSSVPLTIQKVQLSDSAVYYCALR
Anguilla anguilla V25 trav AZBK01226067.1 19 VRSNVAITPRILWGNLGDLAQMDCSHKLGVAYTQMYWYKQNPPEGIQLIVFTTLGGSPEFGDFSKDRYVAEKAVAERGSLTVKKLEAEDSGTYFCAVS
Anguilla anguilla V24 trdv AZBK01809016.1 970 DSFQDGITSMSNAMEALEGSSVELSCNYTDSNIAGGSLQWYRQYPRSKPEYLLLISGFNVRKDENGFIITHEKANNLVHLEISSAKVADSALYYCALR
Anguilla anguilla V22 igkv AZBK01635536.1 866 TSADIILTQSPTMESVTVGGSVTLNCRSSSSDFTSSLAWYLKRPGETHKILFYYLGNRAPGTPPRFTDSRSGTNFMLKISGVLAEDAGDYYCQ
Anguilla anguilla V21 trbv AZBK01630903.1 3569 AVPGTIVTQTPRQCVKNSEESIDIFCTHSDSNLRYMNWYRQLPGRGIELIANIVTNEDPNFETGFDKRRYSIVYTSSGDFKGLFKISPLKSVDSGTYFCAAT
Anguilla anguilla V20 trbv AZBK01630902.1 4961 YSGAITVEQTPSSLFGNPRDDVQLICKHDDSSYLYMYWYQQVQGQQALELIGFLNYDVVNKEEKYKEKFNLSGHAKQKGYLDISNLSVEDSGTYFCAAS
Anguilla anguilla V19 trbv AZBK01630902.1 3540 ITVEQTPSSLFGNPRDHVQLTCEHDDSSYQYMYWYQQVQGQQALELIGFLRYDVVDQDEKYKGKFNLTGHAKEKGSLDITSLSVEDSGTYFCAAS
Anguilla anguilla V18 trav AZBK01602430.1 2495 DSFQDGITSVTNVVHALDSSHVTLSCNYTSSNSGDSLHWYRQYPSSKPEFLILIHKYKDKDEKDGWIVKLDKANNRVDLELSSAEVTDSALYYCALQ
Anguilla anguilla V17 trav AZBK01567012.1 247 VSGLVVVTQKLPVLSVSKGDTATMDCNLGTNDAARWYKQVPGGAPRFVLYFYHQSSSPTYGDGFSSNRFTSSHQSTSDYRLIIKNVEAGDSAVYYC
Anguilla anguilla V16 trbv AZBK01559866.1 420 SVVCITVLQSPPELVLHRGEAVTLTCSHDDKNFDKLYWYKQTDGAGLELQGYLSFKQPYTEVGSFNVSGDGEKEGFLKSSAVTAEESGVYFCAVSK
Anguilla anguilla V55 trgv AZBK01845971.1 1932 LWYEAFTYMSVTEGQRAVLDCLLQADSSTGTVSWYRQVPGEGPQLVLSYSTHNTSQVSYGHQFNSSRFTVLTKANETYQHQLLITATEEHDTAVYYCGLTKL
Anguilla anguilla V54 trav AZBK01772955.1 95 DSFQYGITSATNAVHAMEGSNVTLSCNYTGANSGDSLQWYRQYSSSKPEFLILIYSSKEREAKDGFTVINEKEKNLVHLELSSAELTDSALYYCALRPTVTGN
Anguilla anguilla V23 igkv AZBK01683914.1 5137 SLGQITVTQTPAVKSAVPGARVTLNCKTSTSNNLGSDVYWYQQKAGEAPKLLVKKISSRESGISDRFSGSGSGTDFTLTISEARPEDAGVYYCYANFGAPN