WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Anoplopoma fimbria AWGY00000000.1 (AWGY01) 4 0 0 0 1 3 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Anoplopoma fimbria V3 trbv AWGY01153110.1 1602 ESVSFEQSSSQVVKAGTEELRISCSHDDSNLQVMLWYQHRESGRSMSLIGYTVLKGEPSYEEQFKDSRFQIKAEDTRKGSLIIRSVNSSDSAVYFCAASTQ
Anoplopoma fimbria V2 trbv AWGY01112824.1 329 SSLSEQVHQTPADMFTKPEEKAKIYCSHSIQNYDRILWYRQFKNMQLQLLGHIIATSANTEAGMGVKIEGNANKDKKCTLTIERLALNSSAVYFCAAR
Anoplopoma fimbria V1 trav AWGY01100673.1 858 IQSAAVKQDTGVISANVGDNVTLHCFYNTQVAMHFSWYRQTLGGKPELLSNFYKYDNPSKVFPWLEKNPRFSVQRKEGMNHLNISDVHLSDSATYFCG
Anoplopoma fimbria V0 trbv AWGY01058781.1 868 SDVDQTPKLCEKQGGSATITCSHTKGSGYYQMYWYRQRPGETLKLVVITIANTKPVFEPDFRGEKFSATKPNAESGTFTVEKLQPEDEGLYFCAVSQHSDTGDLDS