WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Astyanax mexicanus APWO00000000.1 (APWO01) 99 19 1 3 33 23 13 7
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Astyanax mexicanus V33 trdv APWO01068640.1 185 VFAADRIGPNDQETKVSWTEGESVTLKCSYDTSSEYVYLYWYRQYPNRALQYLLWRGARTYSGSDTADIRFQSTASRSHTELTIREVRLAETALYYCALRVYR
Astyanax mexicanus V32 trbv APWO01068372.1 3943 FSHSDQVTQTPLHLIRNHDVSVTIECSHTVSGYNQINWYKQTNGEGLALIGYLYATGTPQIEKDFQNKTGMSGNGGSRVVLTIKDLSASDSAVYFCAAS
Astyanax mexicanus V31 trav APWO01068372.1 1427 QTYDIQQSPSDLLINAGEYQELYCNHSVSSFRNILWYQQSIGDTSLKLIANVYYTSVHVDSSFVNRFNISGDGAKHSTLHLNKLRAAEDSAVYYCAASE
Astyanax mexicanus V30 ighv APWO01066389.1 1173 VGSVELNQPDFLTVRPGETLTISCKVSYSVTGYSTAWIRQPAGKALEWIGLIYYDADTRYKDSLKSKFSISRDTSSNTVMLRGQNLQSEDTAVYYCARL
Astyanax mexicanus V29 ighv APWO01066294.1 105 FQSQTFTQSESVVVKPGESHKLTCTGSGFSFSSLYLHWVRQAPGKGLEWIAYISTANSPIYYSQSVEGRFTISRSDSSSQLYLQMNNLKSEDTAVYYCAR
Astyanax mexicanus V28 trav APWO01064276.1 110 VSGGTVVTQNPPVLTATKGETTTMHCNLGTVTNYPAYWYKQVPGGVPQFVLSNYHGWSSPSYGSGFSSSRFTSTCSSLSDCNLIISNVEVGDSAVYYCITY
Astyanax mexicanus V27 trav APWO01064258.1 5080 RVEQPVRDVTRSEGTSVTLECNYQTSSTTPYLFWYIQRSHDFPKYILRRDEYSAGDNGTEFHERMSSAVQSTSVPLSIQKLSVRDSAVYYCALS
Astyanax mexicanus V26 ighv APWO01064079.1 3117 IHCIELTQPGSMVSTPGQSLSLTCKVSGYSVTDSSYCTDWIRQPAGKALEWITTICGSGATDTKSSLRSKFSIARDSSSSTVTLSGQNLQTEDTAVYYCARRS
Astyanax mexicanus V25 ighv APWO01064079.1 458 GVDCVELTQPGSLVVKPGESFSISCKISESSYCINWIRQPAGKALEWLGYLCSGGSTEIKDSVKSKISLSQDTSINTVYLRGQNFQTEDTAVYYCARE
Astyanax mexicanus V24 trdv APWO01063237.1 2972 NGSAQSIEPLKNNMQIHADQTVTLSCKYKGGGGQNNLFWYRQNPGSRPENLLMVIPGSGPQIKERFNATANETVVDLIISSTAVSDSALYYCALR
Astyanax mexicanus V23 igkv APWO01062270.1 2730 SIGQVTVTQSPAVKSALPGDTVTISCRTSPAVYNNNELHWYQQKPGEAPKLLIKETDQLQSGFPARFSGSGSGSDFTLTISGVQPEDAADYYCQSFHYIS
Astyanax mexicanus V22 ighv APWO01061164.1 2892 VHSQVVLTQSEQSVAVAPGGSHKLTCSCSGFSVGGTNMYWIRQAPGKGLEWIIRYYTDSYKSSAQEVQGRFTASKDSSNFYLHMTQLKPEDTAVYYCARE
Astyanax mexicanus V21 ighv APWO01061164.1 153 VHSYELTQPGSMIVCPGQSLTINCKVSYSVTSEHTGWIRQPAGKALEWIGYIASGWGTAYSDKLKNKFSISRDTGTNTITLQGQNLQTEDTAVYYCAR
Astyanax mexicanus V20 ighv APWO01061163.1 1377 LTQPGSMMVRPGQSLTINCKVSYSVTGYTTGWIRQPAGKALEWIGYINGAGYTVYSDKLKNKFSISRDTGTNTITLQGQNLQTEDTAVYYCARLSQ
Astyanax mexicanus V19 ighv APWO01061162.1 2678 VHSYELTQPGSMMVRPGQSLTINCKVSYSVTSYGTGWIRQPAGKALEWIGYISSGGSTRYSDKLKNKFSISRDTGTKTITLQGQNLQTEDTAVYYCAKG
Astyanax mexicanus V17 trav APWO01059738.1 2104 RVEQPVRDVTLSEGTSVTLECNYQTSSTQSDLFWYIQRSHDFPKYILRRNKYSAGDNGTEFHERMSSAVQSTSVPLSIQKLSVRDSAVYYCALR
Astyanax mexicanus V16 trav APWO01057272.1 4447 VITPSRDAVFAVEGQNVSLSCSYTVSGSNYALHWYRQYSGSSPQFLILDYAGVITKAQPPVPRISINHQKEKRKVDLIISSTAVSDSALYYCALQPTVTE
Astyanax mexicanus V15 trav APWO01049712.1 1196 RVEQPVRDVTRSEGTSVTLECNYQTSSTRPDLFWYIQRSHDFPKYILRRDTYSAGDNGTEFHERMSSAVQSNSQSTSVPLSIQKLSVRDSAVYYCALR
Astyanax mexicanus V14 trgv APWO01047590.1 4161 TVLGQTVEQPDLSWTKPEGKSAYITCKITGLSGGSYVHWYQHKDGEGPKRILYVKKDGTGLLYDPNHPDREDFSVSTGYNDLKVQSVKKSHSAVYYCACWVG
Astyanax mexicanus V13 trgv APWO01047590.1 3098 TVLGLTLEQPELSWTKPEGKTLYIDCKVTDLGSGNNVHWYQQKDGEALRRILYINNGGTTKTLDPNHPEKDDFTMSEGTYKLKVKAVKKIHAAVYYCACWD
Astyanax mexicanus V12 trgv APWO01047589.1 684 KVEQSVLFWIKPEGQSAYFNCKVTGLTKINNIHWYQQKHGEAMKSILYADSNRVVLNSKHPDAKDFSVQKDSYSLKVQTLKKSHSAVYYCSCWD
Astyanax mexicanus V11 trgv APWO01047588.1 9572 TVLGLIELKQTELSWTKSVSKTLYIKCKVTGLSSSNFVHWYQQKDGEAPRGILYVTYGTSPVRDLNHPDKEDFDVSKGAYDLKVESLKKIHSAVYYCACWD
Astyanax mexicanus V10 trgv APWO01047585.1 1214 FSAEKLEQKLMITKPASKLAILECKFSANCGNYIHWYQKKGDEIRRVQHVDVNNGNPINERGFEYLKSSRKGIQSFALNIPELKPEHSATYYCACWVGNHSKTQL
Astyanax mexicanus V9 ighv APWO01040922.1 4631 LEALKVIQEKAMSVKLAENIKISCTTDSSSSYTYTWYQQKPGESPKFLLVSSTRASGLASRFTYSGSGSQRYLNINGVEAEDEAVYYCA
Astyanax mexicanus V8 trav APWO01038539.1 1503 TAVQIKPGETLSLSCRGSGFTFSCCSMHWIRQQTGKPLEWMGYSGGSYAASFQGRTEITRDNSNSMVYLKLSGVTAEDSAVYYCARDSH
Astyanax mexicanus V7 trgv APWO01016822.1 779 GVLGLTVEQTQLSWTKPLGKTVYINCKVTGLADNHYVHWYHQKDGEALKRILYVNKQVTSTVHDPNYPEAKDFSVTLEKGDAGDTYALKLGAVKLNHAGVYYCAC
Astyanax mexicanus V6 trgv APWO01016821.1 8230 LGLTVEQQELSWTKQQYKTVYLNCKVTDLASNNYVHWYQQKDGEALKRILYVNKQATSTVHDPNHPEAKDFSVTLEKGDNYVLKVGSVKLNHAGVYYCAVWTS
Astyanax mexicanus V5 trgv APWO01016818.1 5244 GTLGLTVEQIELSWTKQQGKRVFINCKVGGLGDSNYVHWYHQKDGEALKRILYVNKAGSSTTPDPNYPEAKDFSVALDKGDYVLRVNAVKKSNEGVYYCACWDTS
Astyanax mexicanus V4 trgv APWO01016818.1 1893 GTLGVEVEQNELSWTKLLNKRVEIQCKVTGLQTSYVHWYHQKDGEGLTRIQYVNEAGNNFVHNSEFSVKKKGENYDLKLNEVKKSHEGVYYCACWDSS
Astyanax mexicanus V3 trgv APWO01016818.1 334 GTLGVEVEQNELSWTKLLNKRVDIKCRVTGLQTTYVHWYQQKDGEALTRMLYVNAAGTSPVYNPDRPEAEHFSVRLEGVTYVLKVSAVQMIHTGVYYCACWDRS
Astyanax mexicanus V2 trgv APWO01016814.1 5971 SVQGLIVEQEQFFWTKTENSTVSIKCRVTDMTDSVHWYQQKDGEALRRILYVNSVGSFVLDLNLPDVEEFTVARGTYDLKVLKLKKSHSAVYYCASWESG
Astyanax mexicanus V1 trgv APWO01016814.1 3246 GSLGLELEQNELSWTKPVNKRVDIKCRVTGLQTTYVHWYHQKDGEALVRMLYMDQSGSNPVYNPDHPEAKDFTVRRQGDVYFIKTNAVKKEHEGGYYCACWDS
Astyanax mexicanus V0 iglv APWO01003963.1 43181 GLSAYTLTQQKSMSVTLKSTVKILCTAENDNYHISWYQQKAGAGPQFLLRATDRADDLPSRFTYTDSGNQDYLNINGIEAEDEATYYCGCAFCGS
Astyanax mexicanus V71 trbv APWO01109660.1 881 STEGLSITQDPTLIIKDYGDSVKAECWHNDSTYYYMYWYKQGILGQIELIALSIGKGMSQIAAPFNESKYSMTRVEVKHGILEIQKLEAEDSAVYFCAASR
Astyanax mexicanus V70 trbv APWO01109659.1 813 RTDCVTFHQSSLLFANQTSMVTIKCSHDDRNLNLMYWYQQKTGSTAMKLISYGYATSDPTYEEGFNQRFKMNRQKTEEGDLTISEVFPSDSAVYFCAASLFQINTTA
Astyanax mexicanus V69 trav APWO01109658.1 2853 RTHCAKFEQSPSLFEEENEIVTIKCSHNDSSLLVMLWYQQKSGSTTMSLIGFGYATGNPTIEEGFKERFELKRNGTEKGDLIISKLVSSDSAVYYCAAK
Astyanax mexicanus V68 trav APWO01109656.1 1103 NCAKFKQTPSLFAEESDTATIKCSHDDNSLSVMLWYQQKSDSTAMSLIGFGYATGNPTIEEGFKERFEMKREGNMKGDLIISKLVSSDSAVYYCAAK
Astyanax mexicanus V67 trav APWO01109654.1 615 SVTVQQKTSILFAKETDTATIECSHDDKSYYTTLWYQQKRDSTAMDLIGFSVSTNKPNYEDGFDKRFKLSKDGDLKGELTISNLLQSDSAVYYCAVS
Astyanax mexicanus V66 trav APWO01109653.1 1326 SAMSAVKVEQNPTLFASKAATAVIPCSHNDSAYNYVFWYQQKSDSTAMDLIGYTVGTGNANKEKGFNDRFKLNRIKTTEGNLTISDLSQSDSAVYYCAAS
Astyanax mexicanus V65 trav APWO01109651.1 691 PSHCVLIEQPGHVMAKLAEEQVKITCRHNDSNLDVMLWYQQKRDSLAVALIGYSYATATPNHEPEFTNRFRHTRTGTLNGDLTISNLNASDSAVYYCAVR
Astyanax mexicanus V64 trav APWO01109650.1 8921 AAKTQPKVLQTPRDLVKYSGETAEFNCLHAVSGYDRMLWYKQSRFGGEDLKYLGNLFFGTSTSEENRFTLAGDGQFNGTLKIANLTVEDSADYLCAAY
Astyanax mexicanus V63 trbv APWO01109650.1 6169 PLYSSLIIQQSPAHVLGTPGQTEVKLSCRHGDTSYPYLYWYQQKTASSSMELIGFLQYENVFPEEKFKARFKLSGHAKADAFLVISNITVQDSAVYFCAAS
Astyanax mexicanus V62 trav APWO01109650.1 2204 CSEVIQKPLDVVKNKDDSMRLECSHSIQSYNTILWYKQSKSGELQLLGYLYRTNNNTESGWQKKVIISGNGASKGFIMVENLSSNDSAVYYCAVS
Astyanax mexicanus V61 trbv APWO01109650.1 474 LSVAVNINQSPLILIKEKGESAEIWCSNNNTDYDRMLWYKQTHQKLQLLGNLYTKVENTELDYQKKVKLQGNAVDNGSLTVMNVTSEDAAVYFCAVRR
Astyanax mexicanus V60 trbv APWO01109648.1 2087 SGVTQSPSILMVSNGKPAEMHCKHDMGSTYRYMYWFQQHQGKSMKLIATTTAFTEPDFGPFNGTKFSADKKEAESGSFTVNDVDSTDNAVYFCAVS
Astyanax mexicanus V59 trbv APWO01109647.1 5957 FSHSNRVDQSPLHVFKNKGENAKIDCSHSVPSYNQVNWYKQTQDQSLALIGYRLGMTSEVKEEDFKNKVDITGDGNNNVSLTIKDLSVSDSAVYFCAAY
Astyanax mexicanus V58 trbv APWO01109646.1 6287 FSHSNRVIQTPQHLITNHDGSAKIDCSQSVTNYNQINWYKQTRDLNLILMGYKIGTLEPKAEKEFQNKVEMSGDGNNNVSLTMKDLSASDSAVYFCAAY
Astyanax mexicanus V57 trbv APWO01109646.1 4208 GHQVDQFPSNIVKNQTESAEISCSHSVKDFEHILWFKQSEDKILTFLGYLNRNYPYPDAAFTGKIQLDGDGNSAATLTISNLMANDSAVYFCA
Astyanax mexicanus V56 trbv APWO01109645.1 5570 FSHSNSVTQTPLRLIIDRDGPATLECSHKEQNYDQIYWYKQQPQSPDLIFIGYIYGTSAPKYEGDFKDKVKMVGDGKTSLSLTIKDLSASDSAVYFCAAY
Astyanax mexicanus V55 trbv APWO01109645.1 2776 CAPSNKDVHQTPPHLVKNKDESAELQCSHAIQNHQVMLWYKQTEDKQLHLLGYLNTNFLYPEEALKNKIVLGGDGRNDGTLSIKSLQLNDSAVYFCAVR
Astyanax mexicanus V54 trav APWO01109645.1 487 FARADDVNQPQIIWGEKSRSATIECDHTKTKDYTQMYWYRQRGGESMKLVIFTASYMPKHEFGDGFDEEKYSATKTTVEEGSLTVKDLNSADSAVYFCAVS
Astyanax mexicanus V53 trbv APWO01109644.1 2469 FSHSNRVTQTPLHLIRNPAESAVIECSHTVSGYDRVGWYKQTTDSQSFTLIGYVYAKATPNKEAEFQDKVDISGDGNNDVTLSIKDLSASDSAVYFCAAY
Astyanax mexicanus V52 trav APWO01109644.1 340 NKNVHQSPPHLIKNPQESAKLQCSHAITNHDVMLWYKQIQDNQLHLLGYLNMNFVYPEEALKNKTELGGDGRNNGTITIKNLQLNDSAVYFCAVR
Astyanax mexicanus V51 trbv APWO01109643.1 12942 SAVCNVLQGPPDLIKNKNEDAEIKCAHTVTSYNQILWYKQDQTTGLKLMGYLYTNTKTKETGYENKIELNGDGRNNASMTLKSLSVDDSGVYFCAAS
Astyanax mexicanus V50 trbv APWO01109643.1 10671 SSSSDQVFQTPPDQFRKDGESAELHCSHSISGYNRILWYKQTRNQQLQLIGYLAYTQAFWEPEFINKTALSGSGDKNAKLTIKSLTSNDSAVYFCAAF
Astyanax mexicanus V49 trav APWO01109642.1 45782 QKHEVYQNPSQLFINPGESGELYCKHSINSYDTILWYQKSTGDTALKLIAYMYYKTPKIESSFETHFNVSGDGEKNSTLSLLNLRAAEDSAVYYCAAKE
Astyanax mexicanus V48 trav APWO01109642.1 43046 AEDVTQPSLICAETGQLVTIDCKHNKGRDYNQMYWYRQHRGESMKLVVFKASYAQNPEFGDEFDQKKYSTVKTVPESGSLTVDNLDSADSAVYFCAVK
Astyanax mexicanus V47 trav APWO01109642.1 40211 AQTVHQTPADLIKNPQESAKLQCSHSISGHDVMLWYKQTKDNQLHLLGYLNLNFKNPEEALKNKIDLDGDGRNDGTITIKSLQLNDSAVYFCAVRY
Astyanax mexicanus V45 trav APWO01109642.1 32936 QTQNKDVHQNPSELIINPGDNQGLNCSHSIPSYFMILWYQKFPGNTSLNLIGYVTNTNPTVESSFKDRFTVSGNGAKQSTLHLGKLKAEDSAVYYCAASQ
Astyanax mexicanus V44 trav APWO01109642.1 27738 ASIGKDVHQSPADVICPPQTAVNLICKHNIQNYDTVLWYQRRPGDTDLKLIGYVRMTTINTTEKEFEGHFKVSGDGESSVTLHILKARQVEDTALYFCAASY
Astyanax mexicanus V43 trav APWO01109642.1 24240 SSDGTSKVVQQIPSHFFKNQGESAEIKCVHNIQNYDRILWYKQTQNMDFTFIGYHVGVSGNLEANIRDAKISGKANMRQSFLSLTNLSPDTAAVYYCAAY
Astyanax mexicanus V42 trbv APWO01109642.1 21605 SAASNEVSQTPPRLFRKDGESAELWCSHDISSYNRILWYKQTGHRQLKLMGTLVATQPQPETEFIGKLELTGNGRSEGKLQIKALTSNDSAVYFCAAFTQC
Astyanax mexicanus V41 trbv APWO01109642.1 18667 SVLSSKVQQSPSDLIKSRGDSMELHCLHNISSYNVILWYKSRVDQELTLLGNLFMTNDNYEPAFKDKNIIIKGNALKDGTLIIKDLSVNDSAVYFCAAS
Astyanax mexicanus V40 trbv APWO01109642.1 16174 SALSSKVHQSPSDLIKSRGDSVELYCQHNISSYNVILWYKSRVEQELTLLGNLVMSTDSYVPAFKDKNIIIKGNAIKDGTLTIKDLSVKDNAVYFCAAS
Astyanax mexicanus V39 trbv APWO01109642.1 13736 SAVCNVLQGPPDLIKNNNEDAEIKCAHTVQSYNRILWYKQDQTTGFKLMGYLVITSIHKETGYENKIELSGDGRNNATLTIKSLSVDDSGVYFCAAY
Astyanax mexicanus V38 trbv APWO01109642.1 6262 SVSSTNVQQTPTDLIKSKGDSVELQCQHNISSYNVILWYKKNADQELVLLGYLWNKRNDKEPAFTNKIDLNGDATKNGFLTIKDLSVKDSAMYFCAAS
Astyanax mexicanus V37 trbv APWO01109642.1 2439 STVCNVLQGPPDLIKNKDEDAEIKCAHTVQSYNRILWYKQDQATGFKLTGYLNYQAPLIETEFKQKVNMSGDGRDNASLTIKSLSVDDSGVYFCAAY
Astyanax mexicanus V36 trbv APWO01109642.1 505 SAANNEVTQTPAHQFRKVGESAELQCSHSISTHNTILWYKQTRNKQLQLMAYAVYTQPYWEPEFVNKTALSGSGDKNVKLTFKALTSNDSAVYFCAAF
Astyanax mexicanus V35 trbv APWO01109640.1 1974 WSDVLQTPGRLFASQGRSAQLDCRHTLGASYYIMYWYKQQGQELKLLVNSVTNNKPDFGSSSEEKYAAEKTHYESGSLTVKDLTVNDSGLYFCAVG
Astyanax mexicanus V34 ighv APWO01071711.1 1233 TAVQIKPGETLSLSCRGSGFSFDCCNMHWIRQQTGKPLEWVGYISNLAGSKGYGESFQGRTEISRDNSKSMVYLKLSGVTAEDSAVYYCARQ
Astyanax mexicanus V97 trav APWO01109665.1 34 AQLLQVYQEPKQLILSHGSALKVSCFVNGTDYPNLYWYKWTQAAGFTLVFSSLSVGSVDPKSKDQFKSQRPEKLQITLESDGVGERDSAVWYCAAS
Astyanax mexicanus V96 trav APWO01109663.1 21028 AQLIQVQQDPVDLIVSPGSSLKVSCSITGTSNPYLYWYQWTPESGFTLVFTSLSKGSVNPSEKDRFKSRRPEDLQIVLESDGVGERDSAVWYCAAS
Astyanax mexicanus V95 ighv APWO01070192.1 257 VQCEELTQPSALSIRPGQSLTITCRVSYSVSSYGTGWIRQPAGKGLEWVSYVSTGGSLYYKDSLKSKFTASRETSSNTITLTGQNLQTEDTAVYYCARQ
Astyanax mexicanus V93 trdv APWO01065557.1 17 VFAADWVKPDDLSVSTTEGESVTLKCSYGSSSEGVQLYWYRQYPNRALQYLLLREARAWSGKNTADSRFESTASRSSTDLTVTVRLADTALYYCALRVY
Astyanax mexicanus V92 ighv APWO01065399.1 962 VFCATELIQPDSVLIRPAETLIITCRVSGASITDSSSHFGTAWIRQPAGKTLEWINTIDFEEDIYAKDSLKNKFSVSRETSSNTITLRGENLQTEDTAVYYCARRA
Astyanax mexicanus V91 igkv APWO01063514.1 193 ILGQTFTQSESVVIKPGESHKLTCTASGFTFSSYWAAVIRQVPGKGLEWVATISTSSTYIYYSQSVTGRFTISRSDSSSQLYLQMNSLKSEDPAVYYCTRE
Astyanax mexicanus V90 ighv APWO01063513.1 2041 VHCIELTQPGSMIVRTGQALIINCKISYTVRSDYTTWIRQPAGKALEWIGRIRIPGSIEYSNELKNKFTISSPETNTITLQGQNLQTEDTAVYYCARG
Astyanax mexicanus V89 ighv APWO01063511.1 1212 VHSEELTQPGSMMVRPGQSLTIHCKVSYSVRSYYTGWIRQPAGKALEWIGSIYSGNTDYSDKLKNKFSMSVDTGTNTVTLQGQNLQTEDTAVYYCA
Astyanax mexicanus V88 igkv APWO01062791.1 2143 SHQETQTPEFLSVKTEKSVSISCTGSSGVGDDMSWYLQKPGEAPKLLIHDGTTRWSGVPERFSGSYSGLNFQMSISGVQAEDAGDYYCLG
Astyanax mexicanus V87 trdv APWO01062002.1 1231 VFAADWIKPDDLSVSKTEGESVTLKCSYDSDSQYVLLYWYRQYPNRALQYLLYRGARSRSSYSNTADKRFASTASDSSTDLTVSVRLADTALYYCALRVG
Astyanax mexicanus V86 trdv APWO01057633.1 9937 VFAADWIKPDDLETDVSKTEGESVTLKCSYETSSEYVYLYWYRQYPNRALQYLLRRGAREYSGRDNADSRFESTATVSSTDLTVTVRLADTALYYCALRVG
Astyanax mexicanus V85 ighv APWO01057513.1 8846 VFSADWIRPDVLFESRTEGESVTLKCSYDSDSNAIRLYWFRQYPNRALQYLLFRGARSWSNDDTADSRFGSTTTRSSTDLTVTVRLADTALYYCALRVG
Astyanax mexicanus V84 ighv APWO01053683.1 1999 VTCQEIRMDQSPAQVKKPGERVKISCKISGYDMTSYLMHWIRQKPGEALQWIGRVNSGRSSDTKYADSMKDHFILTEDVPSSTQFLEAKSLRAEDTAVYYCARE
Astyanax mexicanus V83 ighv APWO01053678.1 4306 ATSAVELKQDAFKHVKPGESFTVTCEVSGYSVSDGSYTTDWIRHPPGKPMEWIGDSLGNLKDSLKSKFSISKDEGTSRVSLQAQSLQTEDTALYYCARYR
Astyanax mexicanus V82 trbv APWO01050215.1 4089 GSIKINIVSQNGLNFIQEGGDISLSCSFSSPEESSTAWFKQTPGEKPILISSAYHSGSAEYHNGFDKSGRFIASRQKNSFTLNILNAEPSDSATYFCSVSY
Astyanax mexicanus V81 trav APWO01004849.1 230 QTILTLHEDQRTSEGDNITLSCNYSTSSLSDTLQWYRQFPRSSPEFLLFILQQGSTSSLPPRLSAEVNTTTKRVDLIISSTAVSDSALYYCALQ
Astyanax mexicanus V80 trav APWO01112022.1 2219 TSNTISPVESEKQVSAGNRVTLSCSYTGSDPWLYWYRQYPSSKLDNLLYIYESGSVQGNPPPGFSAKVEDKVVHLKISSTAVSDSALYYCALR
Astyanax mexicanus V79 trav APWO01112020.1 878 GVNSISPVETEKQVSAGNRVTLSCSYTGSNVYRLHWYRQYPSSKLNFLLHITLSGSMSGNPPAGFSATIQSNTVNLEISSTAVSDSALYYCALQ
Astyanax mexicanus V78 trav APWO01112019.1 519 GVTSNTISPVESEKQVSAGNRVTLSCSYTGSNVYRLHWYRQYPSSKLDFLLYIYKAGDIGSNPSGFAAKVQDDSVDLEISSTAVSDSALYYCALE
Astyanax mexicanus V77 trav APWO01112015.1 1057 KTSDIIIQNTTSVTVNKGSSTTLSCSYTGSPYSLHWYRQKPGSRPEFLILIDEASEHINKAQPPDHRFFIKLHKKEKTWDLEISSTAVSDSALYYCALQ
Astyanax mexicanus V76 trdv APWO01112004.1 1139 ADTIYPDQSSISISEGRSITLSCSYTGSPRDLHWYQQKPGSRPEFLVLINEASGTNVTAQQLDPRLSIILQKNNKKVDLEISSTAVSDSALYYCALQPTVTE
Astyanax mexicanus V75 trdv APWO01112002.1 293 VTADYIGVKEEDKSIIRNERDVVTLRCFYESTSRDIMLYWFRQHSKGAPHFLLYKGAKAFTRFKSSPADTRLKSVTNDTSTALTIAAVNFSDSALYYC
Astyanax mexicanus V74 trgv APWO01112001.1 1243 CWGQDSIDQFVELLTASEGDAVVLNCKYHTTDQSPYFFWYKQKSHKPPQFIVMNLTFGLGYTDLEFKERFSANLDLNSSLIPLRIQEVRVQDTAVYYCALS
Astyanax mexicanus V73 trav APWO01112000.1 1625 VSGQDSITPTSTAVTYKVKEMVKLSCEYKYTVSLNNLQWYRQKKGAKPEFLVLLMESGQNQTADPPHPRLSASVNKTGKYVYLEIFSAEVSDSALYYCALQPTVTG
Astyanax mexicanus V98 trav APWO01109666.1 1187 AQLIQVQQDPVELIVSPGSSLKVSCSITGYSNPDLFWYQWTPEAGFTLVFTSRSTGNVNPSEKDRFKSRRPEDLQIVLESDGVGERDSAVWYCAAS
Astyanax mexicanus V94 ighv APWO01069760.1 2577 GVHSVELTQPGSMMVQPGQSRTINCKVSYSVTSYATFWIKQPAGKALEWIGYINIHGSTTYSDKLKNKFSISRDTGTNTITLQGQNLQTEDTAVYYCAR
Astyanax mexicanus V72 trav APWO01109661.1 2259 ASDGVSIVQEPKISFVDQSSSVILNCRHEKSDQTRMFWYRQRQDTQDLELLAFSLGKDNAKIEPPFDKADKYIMTRPEVLKGTLQIEKLEAADSALYYCATSL
Astyanax mexicanus V46 trav APWO01109642.1 36630 QTQDHKVFQTPPELLISPEGNNQLYCRHSIAGYYMILWYQQSVGDTSLKLIGYVSYTNPTVESSFEGRFTVSGNGANNASLHLGKLTAEDSAVYYCAASQ
Astyanax mexicanus V18 ighv APWO01061162.1 166 LTQPGSMTVRPGQSLTINCKVLYSITSEDTAWIRQPAGKALEWIGYIDYAADISYSDKLKNKFSFSRDTGTKTITLQGQNLQTEDTAVYYCAR