WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Austrofundulus limnaeus LDAR00000000.1 (LDAR01) 16 3 1 1 4 4 2 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Austrofundulus limnaeus V12 trbv LDAR01114784.1 324 ICESVLITQWPHYISTTPSGRVEMHCYQNDTDYPYMYWYKQVKGRDIQLIVYLVANTANFETEFKTGFEANQLKNKQASLILSSVQEKDEAVYLCAAS
Austrofundulus limnaeus V11 trav LDAR01114774.1 2419 YIDGSDVTQTPELWKHKGDNATMNCSHTKDSSYRQMYWYQQLPGDKMKQIVFTTTFSSHEYEEGFTKDRFAAEKKDAQTGSLTVKQLQAEDSGVYFCAVS
Austrofundulus limnaeus V10 trav LDAR01114772.1 1095 LSDGSGVTQSPLLWRNQSQSATMNCSHTKGATYWQMYWYQQLPGKTMKQIVLTTPTPPHQYEEGFTQDKFPAEKKDAQTGSLTVTQLQAEDSGVYFCAVS
Austrofundulus limnaeus V9 trbv LDAR01114770.1 773 SSLSGQIVQTPVETLTDDGKTAKINCSHSIQSYDQILWYKQSQQHPMQLLGYMYGDAPFPEPGVNVVLEGSANKDQTCTLTIKDLSVNSSAVYFCAVR
Austrofundulus limnaeus V8 trdv LDAR01103269.1 4526 LTAGDSISPVQDEVRGTEGQSLTLTCQFKTTANHPDLHWFRHHSDLQAPQFLLWKGAKERKSQYIPDDRYNSTTADTSTNLTIQKLTLTDSGLYYCALD
Austrofundulus limnaeus V7 ighv LDAR01025292.1 614 CSGQSMESIQSSPVVKRPGETLSLSCRGSGFTFSSHNMHWIKQPEGKGLQWMGRVYYDASGTDYSSSFQGRIEITRDNSNNMVYLKLSNLRPEDSAMYYCARG
Austrofundulus limnaeus V6 trav LDAR01025291.1 694 VMCQKMTQPASVTVPSGQRLTINCQIFYSVNDHHTHWVRQPERKGLEWIGGARIGYNSYFKDSLKNKFSISLDSTTNTVTLKGENMQAEDSAVYYCARE
Austrofundulus limnaeus V5 igkv LDAR01135096.1 301 LTAKSVTQSPVIKSAGLGETLSFTCTASPGVDDDLSWYLQKPGQPPKLLFYQISQRWSAPSHFSSSGSEPEFTLTIRGVQTEDAGDYYCLGLHPGDV
Austrofundulus limnaeus V4 trbv LDAR01109538.1 2148 LGLGLEVRQSHSNVVVKPGDKVQIFCTHEKTDYRVMLWYQRSPGHTAMKLIGHVYFKDTTMEETYKDDFIISGDMSGSTAKNGSLTISAPEQKHTAVYFCAASE
Austrofundulus limnaeus V3 trbv LDAR01109536.1 497 SSDQVFQTPEHIVKSPGQSAMINCSHNIPAFDRILWYKQTRGGPLQFLGYTYTNMQNPEPGLDVKLSGNADKNQVCTLTIAVVNTNSSAMYFCAAR
Austrofundulus limnaeus V2 trgv LDAR01100794.1 120 DLVQDDVTLTRRAGQPVSFSCTGTEQCDYSWIFWYQKKETETFKIILNNNCVTGEIDNSYNHTQKDDFSAETKPNGCSLKINKVKQDHSASYYCSCWVRA
Austrofundulus limnaeus V1 ighv LDAR01072748.1 85 RSEIRLDQSLSEVKRPGETVKMSCVSSGFTMSSFFIHWIRQRPGRALEWIGRMNAGQNSAVYGSSFQVRFLMTEDVPSSTQYLQISSLTAEDSAVYFCARE
Austrofundulus limnaeus V0 ighv LDAR01072744.1 298 QTLCESESVVKRPAESHRLTCTYSGFSSDPRIVWIRQAIGKGLEWIAYINSGGSTDYSQSLKDWFTIFRDNNKQQVCLQMSSLTTEDSADYYCARE
Austrofundulus limnaeus V14 trav LDAR01129814.1 174 MGSSISIKQEPSQQVVEEGRSINVSCEYDASIYNIQWYRQQQRSRPEFLLYITEGGSVHPTRSDFSAHINKKQKHVDLQISSAAETDSAVYYCALQ
Austrofundulus limnaeus V13 trgv LDAR01114786.1 392 FSRGLEVHQSHSDIIKYPDEKVEIFCSHNQTDYRLMLWYQQPPGDTALKLTGYLYYKAVTMEDHYKDHFSLTGDLGGDATKTGSLLILSIQKEHSAVYYCAASK
Austrofundulus limnaeus V15 iglv LDAR01141499.1 122 VSGVTLVTQKPNVVTVRKGDTVSMDCNLGSVTNYAALWYKQSRGGVPQFVLYFYHSHSSPTYGSGFSSPKFTSTHQSTSDYRLTIKTIEEQDSAVYYC