WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Boleophthalmus pectinirostris JACK00000000.1 (JACK01) 59 20 0 14 16 6 0 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Boleophthalmus pectinirostris V33 trav JACK01012165.1 1100 FCLAVHIKQLPFVLNYHDFIASFYCSHHHKDHHYMYWYKQSASEGMTLVAYSAGKDTATFESTQHKSRFILNRPNVFECILHFHNLTFEDSESVFYCATSRAQ
Boleophthalmus pectinirostris V32 trav JACK01012165.1 2596 AITFEPSHPRIVNNSTEVEIDCHHDSSEMYVMLWYKQLQDGQMKLIVYSYFGSDPVFEKDFLKRFEMKRTDRQTGALIISNVEPNDSAMYFCAAS
Boleophthalmus pectinirostris V31 trdv JACK01012164.1 18767 LSITVLQPVRHIFTDPGSSIKIDCSLEGYSMGSAVMYWFRQRGYAEIEHVCYEYDKKNDNFECLLDGAKNNFSVVISDLATDDTGMYYCAA
Boleophthalmus pectinirostris V30 trbv JACK01012164.1 25871 QPKYAVTHSPKNIITAQVKVIVIDCSHSNSDFDMILWYRPDLIAYARFSSLIVENRSESLYNDSGSGSSRASLHILNVKTASDSVVYFCAAS
Boleophthalmus pectinirostris V29 trbv JACK01012164.1 27839 VCFSSVIQKDILWESEGGNATLHCSHTKGSSYFQMYWYRQRPGENMRQIVFTRTTSEPDFEPDFRNDRFKVTRPNAESGTLTVEKLQPGDSGVYFCAVS
Boleophthalmus pectinirostris V28 trav JACK01012164.1 28744 QVEGSDVTQDGLIWAQEGKEATMSCTHTKGASYNQMYWYRQLPGETMRLVVFTSYLKDDHDFGDFSKEKYSAQRAKAESGTFTVKDVTAADKAMYFCAVS
Boleophthalmus pectinirostris V27 trav JACK01093182.1 535 TDTASLCDCAARTHSHHLLFCSVSYSVSSYYTAWIRQSAGKGLEWIGSYRTGGTLYLKDSLKNKFSINIESSSNTVTLNGQNMQPGDTAVYYCARD
Boleophthalmus pectinirostris V26 igkv JACK01092565.1 318 SSGEISLTQTPKAAAVDKGASVTLRCQTSSNVGNNLAWYLQKGTESPKLLIYAATSRHSGVSSRFSGSGSGSDYSLTISGFEAEDAGVYYCQQGYSFP
Boleophthalmus pectinirostris V25 igkv JACK01092019.1 873 SSGEISLTQTPKAAAVDKGASVTLRCQTSSSVGRALDWFHQKGTEPPKLLIYAASSRHSGVSSRFSGSGSGSDFSLTISGFEAEDAGVYYCQQRSSW
Boleophthalmus pectinirostris V24 ighv JACK01091895.1 4900 VKCETLTQPASVTVQPGHTLTIPCTVSYDVSSYVTHWVRQPAGKGLEWIGEHCGSGCTMFIKDSLKNKFSINVDSSSNRVTLNGQNMQPGDTAVYYCARQ
Boleophthalmus pectinirostris V23 ighv JACK01091895.1 2881 VKCETLTQPGSVTVQPGHTLTISCTVSYDVTAHGYATHWIRQSAGKGLEWIGCHCAGCSTKLIFKDSLKNKFSINVDSSSNEVTLNGQNMQPGNTAVYYCAR
Boleophthalmus pectinirostris V22 ighv JACK01091895.1 1301 VKCETLTQPASVTVQPGHTLTISCTVSYSVSSYATAWIRQPAGKGLEWIGHHCPWCSPNLFYKDSLKNKFSINVDSSSNTVTLNGQNMQPGDTAVYYCARA
Boleophthalmus pectinirostris V21 ighv JACK01086371.1 8865 TVDCVELLQPGSVLLQPAQTLTISCRVSGYSLTDDSYATGWIRQREGKLEWIFYQWGTSGIRQNDALKNKFSLSRDTSARTVTIQGQRLQPEDSAVYYCVR
Boleophthalmus pectinirostris V20 ighv JACK01086368.1 5860 VWTEIKLEQPSSLVKRAGESVKMSCVTSGFSMTSTFIHWIRQRPGQGLEWIGRMDAGRNSPTYASAFQQRFTLTENVPSSTQYMEITGLTAEDTAVYYCARR
Boleophthalmus pectinirostris V19 ighv JACK01086368.1 1801 VKCETLTQPTSVTVQPGHTLTIPCTVSYAVMLSGGYYTAWIRQPAGKGMEYIGYHCAGCSGGLKDSLKNKFSINVDSSSKTVTLNGQNMQPGDTAVYYCARR
Boleophthalmus pectinirostris V18 trav JACK01048433.1 3902 TDTASLCDCAARTHSDHLLYCLLYWLRHRWIRQPAGKGLEWTGQNCAGCTATMKDSLKNKFSINLESSSNTVTLNGQNMQPGDTAVYYCAR
Boleophthalmus pectinirostris V16 ighv JACK01048432.1 16378 VSCQILQSIPSSPVLKTPQESVSLSCSGSGFNFGGYGMHWIRQAEGKGLEWLRLIYYDASKTYYANSVQGRIEISRDNGRSLTFLTLSNLQPEDSAVYYCARK
Boleophthalmus pectinirostris V15 ighv JACK01048432.1 9410 VKCETLIQPASVTVQPGHTLTISCTVSYSVSSYWTAWIRQPAGKGLEWIGTHRAGNTMELKDSLKNKFSINLESSSNTVTLNGQNMQPGDTAVYYCAR
Boleophthalmus pectinirostris V14 ighv JACK01048432.1 958 VKCETLTQPASVTVQPGHTLTISCTVSYDVRYGHGYATHWIRQSAGKGLEWIGGHCAGCSGAFKDSLKNKFSINVDSSTKTVTLNGQNIQPGDTAVYYCARKAK
Boleophthalmus pectinirostris V13 ighv JACK01048431.1 21387 VKCETLTQPASVTVQPGHTLTIPCTVSYDVGSHHTHWIRQPSGKGLEWIGGHRAGYTMYLKDSLKSQFSVNVDSSTKTVTLNGQNMQSGDTAVYYCARQSQ
Boleophthalmus pectinirostris V12 igkv JACK01042238.1 3089 CSGQVTVTQPPVQIVTPGSTVTLTCKTNKDVYHNGGSSWDIFWYQQKPGKSPKLWLKLVTQRLSETPSRFSGSGSHSVQAEDAAVYYCQS
Boleophthalmus pectinirostris V11 igkv JACK01042238.1 126 CSGQVTVTQPPVQMFTPGSTVTLTCKTNPDVYGNNHMFWYQHKPGQTPKLWIKYATQRLSETPSRFSGSGSHSDFSLTITGVQAEDAALYYCQSYHSGPV
Boleophthalmus pectinirostris V10 igkv JACK01042237.1 1944 CSGQVTVTQPPVQMFTPGSTVTLTCTANKHVYSDSNGWFMHWYQQKPGQTPKLLIKLATQRLSETPSRFSGSGSHSDFSLTITGAQAEDAAVYYCQS
Boleophthalmus pectinirostris V9 igkv JACK01042162.1 3360 CSGQVTVTQPPVQTVTAGSTVTLTCKTNKDVHVNTYMFWYQQKTGQTPDLLIKYATQRLSETPSRFSGSGSHRDFSLTITGAQAEDAAVYYCQS
Boleophthalmus pectinirostris V8 igkv JACK01042161.1 2448 CSGQVTVTQPPVQMFTPGSTVTLTCKTNTDVHSDSNGWYMHWYQQKPGQTPKLWIKLATQRLSETPSRFSGSGSHSDFSLTITGAQSEDAAVYYCQS
Boleophthalmus pectinirostris V7 igkv JACK01013389.1 3816 QSAEDQIPVTVVQPGDTVTFTCSHSLDTASAVYWYKQTPGHTMQQIATVYYEQNDVCDSFKDQNRFTFAAEDKKHVLEIRNIIKEDQAIYYCQIRGGIILSFVN
Boleophthalmus pectinirostris V6 igkv JACK01013386.1 3927 QSAEDQIPMTVVQPGDTVTFTCSHSLYGMNKVYWYKQTPGHTMQQIATVYYEQNDVCDSFKDQNHFTFTTVDKKHVFEIRNIRKQDEAIYYCQKGGVAVLSFMN
Boleophthalmus pectinirostris V5 trbv JACK01012170.1 11877 QSKYAVTQSPKNIITAPVNVIVIDCSHSNSDFDMILWYRQTIGLTDLTLIAYARFSSLVVENTFESLYNVSGSGSSRSSLHILKVKTASDSAVYFCAAS
Boleophthalmus pectinirostris V4 trbv JACK01012169.1 23986 QIDGTVVKQSPYLVTAVGDNVTVNCDQSLGLNTDWIYFFRQRPGQRSLVLAAQTTLTYITYAEKRWRQYIHREWQPKVIGLKTLNVSREDEAVYFCAVSLLS
Boleophthalmus pectinirostris V3 trbv JACK01012169.1 11247 AVKFQQSPSMIVNQGVSVSIKCSHDDSSLTVMLWYQHRPDTQSMMLIGYYYAGSDNYEKELGKQFKIERSSVKTSSLTVLSTSPSHSAVYFCAASITVMKYR
Boleophthalmus pectinirostris V2 trbv JACK01012169.1 10148 AVKFQQSPSIIVNQGVSVSIECNHDDSSLTVMLWYQHRTDTQSMMLIGYNFVGSDNYEKELGKQFKMERSSVKTGSLTVLSTGPSHSAVYFCAASITVMKYR
Boleophthalmus pectinirostris V1 trdv JACK01012169.1 3273 SSLNDQVHQFPKDIYNTKGTSAEIQCSHDIVNYDRILWYKQLNDGQLQFLGYILGTSPSPESGAKVQIRGDANKGKNSTLVIEEPSSAIYYCAAS
Boleophthalmus pectinirostris V0 trav JACK01012169.1 1642 KSLYDQISQSPQDLIKFSNETINNELKCSHSISSYDRTFWYKQEKNGAMTLLGYAYSNVPNVEDAVKDKININGDGRSDTSLYISNLTVEDSGVYYCAPS
Boleophthalmus pectinirostris V57 ighv JACK01092894.1 1030 VKCETLTQPASVTVQPGHTLTISCTVSYDLSSYRTHWIRQPAGKGLEWIGSNRVGYSIFLKESLKSKFSINLDSSSKTVTLNGKNMQPGDTAVYYCARD
Boleophthalmus pectinirostris V56 ighv JACK01092894.1 3292 VECVTLTQPASVTVHPGHTLTIPCTVSYSVATPTNWVRQPAGKGLEWIGEHCSGSCTMFIKDSLKSKFRINVDSSSNTVTLNGQNMQPGDTAVYYCARQ
Boleophthalmus pectinirostris V55 trav JACK01091024.1 2342 EDTVTQPTGDTSDTQGHTATILCTFQRAALTNYYLFWYRQKNGDFPKYILRRDTIGGEANSPDFTKPKFDAELNENSFTLTIQDVDVTDSAVYYCALK
Boleophthalmus pectinirostris V54 trav JACK01091024.1 4632 EDTVTQPTGDTSDTQGHTATILCTFKTAYNTAYLYWYKEEGRGAPRYMLKKTKTSSKWLDTAKSSEFSENRFEVEAEGNSFSLKIQDVDVTDSAVYYCALQ
Boleophthalmus pectinirostris V53 igkv JACK01088771.1 101 SSGEISLTQTPKAAAVDKGASVTLRCQTSSNVGNHLAWYLQKGSEIPKPLIYAATSHHSGVSSHFSGGGSGSDYSLTISGFEAEDEGVYYCQQGYSFP
Boleophthalmus pectinirostris V52 trav JACK01086998.1 456 EDTVTQPTGDTSDTQGHTATILCTFKTAYSSSSAYLYWYKQEGQGAPRYMIQTTKLSLSMWSKTVKSPEFNEERFEVEAEGNSFSLKIQDVDVTDSAVYYCALQ
Boleophthalmus pectinirostris V51 trav JACK01086997.1 2079 EDTVTQPTGDTSDTQGHTATILCYFEFSEFVNNYLFWYRQKNRDTPEYILQRGPLGTNANSPKFNKSKFDAELKGNSSSLKIQDVDVTDSAVYYCALQ
Boleophthalmus pectinirostris V50 trav JACK01086997.1 5251 DTVTQPTGDTSATQGETATILCTFEAGSTNPTLFWYKQDGKKSPKFMLRNYRAGSSWVSSKSDEFTVKLNTKNGQNSSELIIQDVDVTDSAVYYCALK
Boleophthalmus pectinirostris V49 trav JACK01086997.1 8485 EDTVTQPTGDTSDTQGHTATIICTFTTSDPTPYLYWYKQEGRGAPRYMMTLVAKSVVKSSEFNKLKFDAELNATFLSLKIQDVDVTDSAVYYCALK
Boleophthalmus pectinirostris V48 trav JACK01086997.1 12497 EDAVTQPTGDTSDTQGHTATILCTFKTTYTTDNPYLYWYKQEGRGAPRFMIQKTKTSFQWLGTVKSSEFNNERFEVESEGNSFSLKIQDVDVTDSAVYYCALK
Boleophthalmus pectinirostris V47 trav JACK01073897.1 5583 VVMGTSKTSAVSQDSGLKIVKVGDSVTLQCSCANDKMTFFTWYQQKLGGKPELISKWLKGIQEPVVEPVFQQRFHIFQTGDKKETNNLKITDLQANDTASYFCGVEV
Boleophthalmus pectinirostris V46 trav JACK01073892.1 4755 VVMGTSKTSTVIQDSGLKIVKVGDSVTLHCSCADDQMTFFTWYQQKLGEKPELISMWLKGIQEPTVEPVFQQRFHIFQTGDKKETNNLKITDLQANDTASYFCGVEV
Boleophthalmus pectinirostris V45 trdv JACK01073888.1 8086 PNYATSLNFTVVNIGDSVTLECSFSPSSVAVMFYWYKQILGQKPIVMSRFYKHEKNSTFIGDFQNNPRLSIKNGNFQNHLTISDLRMSDSATYYCISKY
Boleophthalmus pectinirostris V44 trav JACK01054386.1 1954 QVTVSQTGAVRAALGDTVNILCTVSPAVAYTADLDWYQQRDGEPPKALIYDTSNRASGVPSRFSGSGSKSAVTLTISGVQPEDFAVYYCTS
Boleophthalmus pectinirostris V43 ighv JACK01046251.1 2246 VKCETLTQPTSVTVQPGHTLTIPCTVSYSLGSWTHWIRQPAGKGLEWIGEKYTGGSYYKDSLKSKFSIDLDTSTKTVTLNGQNMQPGDTAVYYCARE
Boleophthalmus pectinirostris V42 ighv JACK01046246.1 115 VWTEIRLEQPSSLVKRAGESVKMSCVTSGYSMTSNSMHWIRQRPGQGLEWIGWMYTGRNQPTYASAFQQRFTLTENVPSSTQYMEITGLTAEDTAVYYCARQ
Boleophthalmus pectinirostris V41 ighv JACK01046246.1 1380 VFAQTLTESGPAVKRPGESHRLTCTTSGFTFSSLYMSWIRQAPGKGLQWLARISSGGGTTYYSESVKGRFTISRDNSRDQLYLQMNNLQTEDTAVYYCAQ
Boleophthalmus pectinirostris V40 ighv JACK01046245.1 1997 VKCETLTQPASVTVQPGHTLTIPCTVSYSVSSHWTAWIRQPAGKGLEWIGSKYTGDTLHKDSLKSKFSLNVDSSSNTVTLNGQNMQPGDTAVYYCA
Boleophthalmus pectinirostris V39 ighv JACK01046245.1 3332 TVDCVELLQPGSVLLQPAQTLTISCRVSGYSLTDSSYATGWIRQREGKLEWIFHQWGGGGLRQNDALKNKFSLSRDTSAGTVTIQGQRLQPEDSAVYYCVR
Boleophthalmus pectinirostris V38 ighv JACK01046245.1 4244 VFAQTLTESGPAVKRPGESHRLTCTTSGFTFSNYNMNWIRQAPGKGLQWLAFIGSRGVNIYYSESVKGRFIISRDNSRNQLYLQMNNLQTEDTAVYYCARQ
Boleophthalmus pectinirostris V37 ighv JACK01046245.1 9541 VFAQTLTESGPAVKRPGESHRLTCTTSGFTFSNYNMNWIRQAPGKGLQWLAFIGSRGVNIYYSESVKGRFTISRDNSRNQLYLQMNNLQTEDTAVYYCAR
Boleophthalmus pectinirostris V36 igkv JACK01045836.1 1577 SSGEISLTQTPKAAAVDKGASVTLRCQTSSSVENYLAWYLQKGLEPPKSLIYHATSRHFGVSSRFSGSRSGSDYSLTISGFEAEDAGVYYCQQSSSSL
Boleophthalmus pectinirostris V35 igkv JACK01012168.1 402 SSLNDQVHQTPKDIYNTKGTSAEIQCSHDINNYNQILWYKQLNDGQLQLLGYILATSPSPESGAKVQIRGDASKGKTSTLTIEEPSSAIYYCAAS
Boleophthalmus pectinirostris V34 igkv JACK01012168.1 402 SSLNDQVHQTPKDIYNTKGTSAEIQCSHDINNYNQILWYKQLNDGQLQLLGYILATSPSPESGAKVQIRGDASKGKTSTLTIEEPSSAIYYCAAS
Boleophthalmus pectinirostris V58 igkv JACK01094455.1 473 CSGQVTVTQPPVQMFTPGSTVTLTCTTNTDVYGDNYMHWYQQKPGQTPKLWVKLATQRLSETPSRFSGSGSHSDFSLTITGVQAEDAAVYYCQSYHSSGV
Boleophthalmus pectinirostris V17 ighv JACK01048433.1 350 VKCETLTQPASVTVQPGHTLTISCTVSYDVRAGHGYATDWIRQAAGKGLEWIGGHCVGCTAAFKDSLKNKFSINVDSSTKTVTLSGQNMQPGDTAVYYCARE