WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Clupea harengus JZKK00000000.1 (JZKK01) 148 21 4 16 54 20 13 20
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Clupea harengus V9 ighv JZKK01014428.1 3220 LTQPASLTLQPGKSLTINCKVSYSVTDYGTAWIRQPSGKALEWINVIWSGGSTAHKDSLKNKFSVSRDTSSNTVTLQGQNLQPGDTAVYYCA
Clupea harengus V32 trgv JZKK01049748.1 3300 VVTGSVVSQPDQVIISRLGETVTVKCMTLKDSYEHLFWYQQRLGQMPRCICIARTNKDPHYVAEFKDSHISCQRTEGGFDLKIRNSTWSDEASYYCASRDW
Clupea harengus V31 trav JZKK01048357.1 4751 VAGEDAVYQSDGVLSAFEGDKVTIACHYETSDPTASLLWYKQTANGFPEFMLITFTFPGGQTEEKFKKRFDSKVNTASKTVPLIIQNLQVSDSAVYYCALK
Clupea harengus V30 ighv JZKK01047851.1 13829 GLCQTLRESESVVLKPGDSHKLTCTYSGFSSDPYVGWIRQAAGKGLEWLSVIYTTSTYYAQTVQGRFTISRDNSMKQVYLQMNSLKTEDTAVYYCAR
Clupea harengus V29 ighv JZKK01047849.1 840 ISCQIRLDQSPAEVKRPGEKVKISCKISGYSMTSYNIHWIRQKPGEALEWVGRMSTGNNAGTYAESLKGQFTLTEDLPTSMQYLEAKSLKAEDTAVYYCARE
Clupea harengus V28 ighv JZKK01047848.1 4313 GHGQTLTESEPVVINPGGSHRLTCTASGLTISGNYMAWIRQTPGKGLEWIASMYSSNIYHSQAIQGRFTISRDDGKSQVYLQMNSLKTEDTAVYYCARD
Clupea harengus V27 ighv JZKK01047848.1 1844 GHGQTLTESEPVVINPGGSHRLTCTASGLTISGYYLAWIRQAPGKGLEWIASIYSSNIYHSQAIQGRFTISRDNGKSQVYLQMNSLKTEDTAVYYCARD
Clupea harengus V26 trdv JZKK01044730.1 1115 SPEQKGVTQSEEESVTLKCSYETSSNNVYVYLHWYRQYPEQAPQYLLQKGARGSDYEHIADPRFYSTTSQTSTELHIKVLTLADTALYYCALQV
Clupea harengus V25 trav JZKK01044377.1 1183 ESFGDTITPSQSSVVISEGEQVTFSCNYSSSNVQNLQWYRQYPNSIPEFLYYIFEAGSSSEKVPRLTPSINKEEKRVFLELSSAEASDSAVYYCALR
Clupea harengus V24 trgv JZKK01043871.1 4419 VVTGSVVSQPDQVIISSLGETVTVKCMAQKDSFSNKYIFWYQQKLGQMPRCICMARTYSDLNYFGEFKDSHISCQTTEGGFYLKLRNSTWSDEASYYCAIGNR
Clupea harengus V23 igkv JZKK01035290.1 781 SSADYILTQSSSSKSVQPGETVSISCTASQSVFGGTYHYLNWYSQKPGEAPKLLIYAASSRQSGVPDRFSGSGSFPQYTLTISRVQPEDAADYYCGQSNWTP
Clupea harengus V22 trav JZKK01035058.1 522 VAGEDAVDQSDGVLSAFEGDKVTIACHYETSATAPSLFWYKQTANGFPEFMLITFTYPGGQTEEMFKERFQSKVNSTSKTVPLTIQNLQVSDSAVYYCALK
Clupea harengus V21 trdv JZKK01035038.1 4351 ETQAGALRQTDSALVLHQGENVTLSCFHTERYVLLYWLKLTAGHKPQPVATRYKYGQPKMHPEFEGSTRFDGQPAAGVFHLNIRDAQPSDSALYCCALIDSSSME
Clupea harengus V20 igkv JZKK01032955.1 1871 SYGQVTVNQTPAVKAVQQGGSVTLNCKTSSDVFVYSSNHYLAWYQQKPGAAPKLLIYKTKTLQSGTPSRFSGSGTGSDFDLDISNVQAEDAGVYYCQS
Clupea harengus V19 trav JZKK01030030.1 1864 KILSDSISPDKVEVHLTEGSNATLSCTYDGSPYSFLWYRQKPGTSPEFLKLITESTSYVQEAKPPFSQMSTTFDGKAKRVHLEISSTQGSDSALYYCALQ
Clupea harengus V17 igkv JZKK01021817.1 2781 SYGQVTVTQTPAVKAVQQGGSVTLNCKTSSNVVNAGTSYPYLAWYQQKPGAAPKLLIYYATTLQSGTPSRFSGSGTHSDFTLTISNVQAEDAGVYYCQS
Clupea harengus V16 trav JZKK01021425.1 3583 CISANVITSNSAVSKTVEDFTITLSCNYSSGDYPQWYRQYPRSEPQFLMSVYSSTEAQESSSDPRLSGILNKEKTQIFLNINSAKLSDSAVYYCAME
Clupea harengus V15 igkv JZKK01019644.1 25180 CRGQYTVTQTPLVLPAVPGQTVTLNCKTSSNAYNGICLYWYHQVSGEPPKLLIYWSSHRRSGTPSRFSGSGYGSDFTLTISGVQTEDAGDYYCQS
Clupea harengus V14 trav JZKK01017249.1 1697 ESVGNTITPSHSSVVISEGENVKFSCNYSGMVQNLQWYRQYPNSIPEFLYYIREAGSSSEKVPRLTPSINKEEKRVFLELSSAEASDSAVYYCALR
Clupea harengus V13 trbv JZKK01017247.1 1704 DNRVHQTPLQLILSQGENADISCSYSNTNFDQILWYKQTSDRKVTLLGYLTGNSPFPELAFKNKTILKGDANKQQGTLEMLNLTRDDVAVYFCAAS
Clupea harengus V12 igkv JZKK01016197.1 2228 SSADKILTQSPSSKSVQPGETVSISCTASESVYSWPYHYLNWYSQKPGEAPKLLIYTASSRQSGVPDRFSGSGSGPQYTLTISRVQPEDAADYYCGQSNWTP
Clupea harengus V11 ighv JZKK01014428.1 7485 GEAQTLTESPSVIIKPASSHKLTCTYSGISDSDARIAWVRQPPGKGLEWVSHISAPSGANTYYSKAVEGRFTISRDNSMKQVYLQMNGLKTEDTAVYYCARQ
Clupea harengus V10 ighv JZKK01014428.1 4508 VRSDVVLTQPSSMMTQPGQTLSLSCKVAGYSLTSTYCTAWIRQPAGKALEWIALICYDGSTAHSDKLKNKFSISRDTSSSTVTLQGQNLQAEDTAVYYCARW
Clupea harengus V8 ighv JZKK01010844.1 11743 GHGQTLTESEPVVINPGGSHRLTCTASGLTISGYYLAWIRQAPGKGLEWIASIYSSNIYHSQAIQGRFTISRDNGKSQVYLQMNSLKTEDTAVYYCA
Clupea harengus V7 ighv JZKK01010844.1 9272 GHGQTLTESEPVVINPGGSHRLTCTASGLTISGYYLAWIRQAPGKGLEWIASIYSSNIYHSQAIQGRFTISRDNGKSQVYLQMNSLKTEDTAVYYCARD
Clupea harengus V6 ighv JZKK01010844.1 6801 GHGQTLTESEPVVINPGGSHRLTCTASGLTISGYYLAWIRQAPGKGLEWIASIYSSNIYHSQAIQGRFTISRDNGKSQVYLQMNSLKTEDTAVYYCARD
Clupea harengus V5 ighv JZKK01010535.1 6694 GHGQTLTESEPVVINPGGSHRLTCTASGFTFSSYWMAWIRQTPGKGLEWIASMYSSSIEQSQAFKGRFTISRDDGKSQLYLQMNSLKTEDTAVYYCARD
Clupea harengus V4 igkv JZKK01010218.1 3373 SRGQVTVTQTPAVKAARPGETVTLNCKTNPQLSGDGLHWYLQTPGEAPKLLMYYIKTQHSGTPDRFSGGGSSKGSDFTLTIRVQTEDAGDYYCQSYHSLSPEV
Clupea harengus V3 trav JZKK01007601.1 96581 VVTVLVSQDTPDLALKPNSSLKVGCTIAEVSNPVLYWYRWTASGGMELKFFSRGVNTMEPTEVDGFTASRTVDLQMSLESASVQPSEPAVWYCAAS
Clupea harengus V2 trav JZKK01005933.1 1624 VAGEDAVDQSDGVLSAFEGDEVTIACHYETSDTSPSLLWYKQTANGFPEFMLMTFTYTGGQTEEKFKDRFHSKVNTTSKTVPLIIQNLQVSDSAVYYCALK
Clupea harengus V1 trav JZKK01005933.1 318 FGAEDAVDQTDGDLSAFEGDGVTIACSYKTSASASLLWYKQQANGFPEFMLIRNTYSAEGITEEMFKERFHSKVNTTSKTVPLIIQNLQVSDSAVYYCALR
Clupea harengus V0 igkv JZKK01000566.1 20626 SSADKILTQSPSSKSVKAGETVSISCTASESVYSWPSNVLHWYSQKPGEAPKLLIYNASNRQSGVPDRFSGSGSGSTYTQYTLTISRVQPEDAADYYCQQGNAFP
Clupea harengus V70 trav JZKK01007602.1 11887 CSGLVIVQNPENVLTKNREETLHCKHDDSFYDYMYWYRQSRNGELSFVAFSRNKGITEIVAPYNDSKYNLSRPEFEKFSLLIHNLEAGDSALYYCASSKAQ
Clupea harengus V69 trav JZKK01007602.1 12798 STLGVKVSQSPPISFMKRQTKPVTLYCQHDDNTHYNMFWYRQQTNGEMNLIAYSLGKDNVKIEEPFNSSKYTLTRPEVLNSSLEIKGLESGDSVLYFCATSGTV
Clupea harengus V68 trbv JZKK01007602.1 15118 STLGVKVSQSPPILLMKIKTKSVTLNCQHDDSSHFNLFWYRQQTNREMNLIAYSLNKDNVQIEKPFKDSKYTLTRPEVLKSSLEIKDLESGDSALYFCATSI
Clupea harengus V67 trdv JZKK01007602.1 17240 CSGLVIVQNPENVLTKNSEETLHCKHDDSSYDYMYWYRQSRNGELSFVAFSRNKGITEIVAPYNDSKYNLSRPEIEKSSLQIHDLEAGDSALYYCASSK
Clupea harengus V66 trdv JZKK01007602.1 20174 CSGLVIVQNPENVLTKNSEETLHCKHDDSSYDYMYWYRQSRNGELSFVAFSRNKGITEIVAPYNDSKYNLSRPEIEKSSLQIHDLEAGDSALYYCASSK
Clupea harengus V65 trbv JZKK01007602.1 21572 STLGVKVSQSPPILLMKIKTKSVTLNCQHDDSSHFNLFWYRQQTNREMNLIAYSLNKDNVQIEKPFKDSKYTLTRPEVLKSSLEIKDLESGDSALYFCATSI
Clupea harengus V64 trdv JZKK01007602.1 24112 KVSQSPPILFMKIQTKSVTLNCQHDDSTHLKLFWYRQQTNREMNLIAYSSGKDNAQKEKPFDGSKYTLTRPEVLKSSLEIKDLESGDSALYFCATSI
Clupea harengus V63 trdv JZKK01007602.1 24971 CSGLVIVQNPENVLTKNREETLHCKHDDSLYYNMYWYRQSRNGELSFVAFSRNKGITEIVAPYNDSKYNLSRPEIEKSSLQIHDLEAGDSALYYCASSK
Clupea harengus V62 trav JZKK01007602.1 26515 STFGVKVSQSPPILFMKIRTKSVTLNCQHDDSTHYNMFWYRQQTNRELKMIAYSSGKDNAQIEKPFEKSKYTLTRPEMLKSSLEIKGLESGDSALYFCATSI
Clupea harengus V61 trav JZKK01007602.1 28833 GVKVLQEPQNSFTTVENKSLTMYCQHDDSNYVQMMWYTQQRNGGELKLLAFSFGKDNGDIEKPFEKSKYTLTRPEVLKSSLEIKGLESGDSALYFCATSI
Clupea harengus V60 trav JZKK01007602.1 30186 TSQGINVLQEPPALLSRRGTSETLRCEHNDADYYRLAWYKQEENGQTLQMVSFSAGATTTNIEPPFDKNDKYEMTRPVVTHSNLKVKNLEATDSAVYYCASSS
Clupea harengus V59 trgv JZKK01007602.1 30874 FRQLRNTTPIRKYAKGKKFKPGQSNSIPCSIKDVASYTMSWYRQRIWGRSGENMMDEAGEIYNIELGSRFTVSCKAKHLIILKVAQLEKNDSAQYYCATAHLVS
Clupea harengus V58 trav JZKK01006340.1 538 KSAGNSIVPNTAVKHATEGENVQLVCKYNGSVDSLHWYRQFTDSVPQFLILDYQSVIINATHPVPGISIKHDTTAKQVSLEISSAEVSDSAVYYCALR
Clupea harengus V57 trdv JZKK01006012.1 10814 VCMRNKITSDRTRVSTVEESNVTLSCSYSSARALQWYRQYPRSAPQFLLLMLHSTGQPQRSEVDPRLMVKLNKEKTQVLLEISSVQVSDSALYYCAMRPTVTQ
Clupea harengus V56 ighv JZKK01005923.1 3183 VYGQSLTSSGPVVKRPGEAVTLSCSVSGLPLQWLHWIRQKPGQGLEWIGRIDTGTGTIFAQSLQGQFSITKDTNTNKVHLQVKSLKAEDTAVYYCARE
Clupea harengus V55 ighv JZKK01005923.1 4766 VHGIELIQPSHMDVKPGELSSISCKISGFSTSQYYNWIRHSAGKTMEWIGWIGGRGSSGTTDSLKSKISFTRDTSTNTVVLQGQNFQTEDTAVYYCTRN
Clupea harengus V54 ighv JZKK01005922.1 1811 VICDEIRLDQSPAQVKTPGGTVKISCKISGFDMTNHWMHWIRQKPGEALEWIGAMNSESETDVLYAESLKGQFTLTEDVPTSSMQYLEAKSLKAEDTAVYYCARE
Clupea harengus V52 trav JZKK01005922.1 7214 VYCQVQLNQQSSVTIQPGQVLTLSCGVSGYSLTDSSYCTSWIKQPAGKALEWIGYVCYTGSVYYSDKLKNKFSISRDTSSSTVTLLGQSLQTEDSAVYYCARY
Clupea harengus V51 iglv JZKK01005179.1 13449 VVTGSVVSQPDQVIFSRLGETVTVKCMALKDSSEYLFWYQQRLGRMPRCICMARKNRDPNYVGEFKDSHISCQTTEGGFDLKIRNSTWSDEASYYC
Clupea harengus V50 trgv JZKK01005176.1 4244 VVTGSVVSQPDQVIISRLGETVAVKCVALKDSYEYLFWYQQRLGQMPRCICMATKHTNTHYFDEFNDSHNSCNITKGGFDLKIRNSTWSDEASYYCASKNK
Clupea harengus V49 trgv JZKK01005175.1 2180 SGSVVSQPDQVIISRLGETVTVKCMTLKDSYGDLFWYQQRLGQMPRCICMARTYTDPHYLDEFKDSHISCQRTEGGFDLKIRNSIWSDEASYYCASRNG
Clupea harengus V48 trgv JZKK01000430.1 3559 VVTGSVVSQPDQVIISRLGENVTMKCVALKDSYEHLFWYQQRLGQMPRCICMARTNTDPHYVDEFKDSHITCQTTKEGFYLKIRNNTWSDEASYYCASRKKK
Clupea harengus V47 trav JZKK01070023.1 385 VSSENVISPNSPEVYAEEGSRVILSCNYSTTATSLQWYHQYPRSVPKHLVSVYSSDQISDTDPRLTGKINKEKTQVFLEISSVQVSDSALYYCALT
Clupea harengus V46 ighv JZKK01069710.1 667 GHGQTLTESESVVINPGGSHRLTCTASGFTFSSYWMAWIRQTPGKGLEWIASMYSSSIEQSQAFKGRFTISRDDGKSQLYLQMNSLKTEDTAVYYCARD
Clupea harengus V45 trbv JZKK01069703.1 213 SSTSSQVNQVPPDIVQSTGGSAKIQCSHNIPNYNRILWYKQTKDGQLTYLGYLFGKNPNPESEFKNKIDLIGFSNTNGSMMVEKLLPKDAAVYFCAAY
Clupea harengus V44 trav JZKK01068926.1 9401 CRSQETVDQPERVHMAFEGGRTTLNCTYKTTDSFPYLFWYQQKSNDFPRYMVKIFPSGSEYDDDVYKKRFHAELKDSSSVPLTIQNLQVSDSAVYYCALR
Clupea harengus V43 trav JZKK01067371.1 584 VAGEDAVDQSDGVLSAFEGDEVTIACHYETSDTSPSLLWYKQTANGFPEFMLITFSYPGGQTEEKFKERFHSKVNTTSKTVPLIIQNLQVSDSAVYYCALK
Clupea harengus V42 igkv JZKK01063817.1 5116 SYGQVTVTQTPAVKAVQQGGSVTLNCKTSSDVYVYAGLYHRLFWYQQKPGAAPKLLIYYAKTLQSGTPSRLRGSGTHSDFTLTISNVQAEDAGVYYCQS
Clupea harengus V41 igkv JZKK01063817.1 2502 SYGQVTVTQTPAVKAVQQGGSVTLNCKTSSNVYNAGTSQPELAWYQQKPGAAPKLLIYYTTTLHSGTLSRFSGSGTHSDFTLTISNVQAEDAGVYYCQS
Clupea harengus V40 igkv JZKK01063814.1 1681 SYGQVTVTQTPAVKAVQQGGSVTLNCKTSSDVYNAGSSTPRLAWYQQKPGAAPKQLIYNAKTLQSGTPSRFSGSGTHSDFTLTISNVQAEDAGVYYCQS
Clupea harengus V39 trav JZKK01062408.1 486 DAVDQSDGVLSAFEGDEVTIACHYETSDPTPSLLWYKQTANGFPEFMLITFTYTGGQTEEKFKERFHSKVNSTSKTVPLIIQNLQVSDSAVYYCALR
Clupea harengus V38 trdv JZKK01062273.1 1022 IVADQLSPANSNMKGLEGDSAKLWCSYEASSDSIYLYWYRQYPNEAPQFLLYKGARSPSYAHISDSRFSTTTSRSSTEFHIKGLTLADTALYYCALIVAQ
Clupea harengus V37 iglv JZKK01062054.1 5567 VVTGSVVSQPDQVIISRLGETVTVKCMTLKDSYEYVFWYQQRLGQMLRCMCMARKSRNPSYVGEFKDSHISCQTTEGGFDLKIRNSTWSDEASYYC
Clupea harengus V36 iglv JZKK01062054.1 3353 VVTGSVVSQPDQVIISRLGETVTVKCMTLKDSYEYVFWYQQRLGQMLRCMCMARKSRHPSYVGEFKDSHISCQTTEGGFDLKIRNSTWSDEASYYC
Clupea harengus V35 iglv JZKK01060808.1 22988 LEALVLTQQKTQTTKLGQNVQISCVRDSGTWEITWFQQKQGSAPKFLLADSRRATGLPSRFTYTDNGLTEYLNINGVTAVDEAVYYCLCPNCPSS
Clupea harengus V34 ighv JZKK01060808.1 10944 LGAVVLTQEKVQNVQLGGNAKIHCARTGGKSSWILAWYQQKPGSAPKFLLADSNRATSLPSRFTYTDNGYNEYLDINGVTADDEAVYYCACHGCPSSA
Clupea harengus V33 trdv JZKK01051473.1 1008 VTADQVSPERQGVSQSEDESVTLKCSYETSSSFVHLYWYRQYPEQAPQYLLRKGARSYSSKDSNDPRFDSTTSQTSTELHIKDLILADTALYYCALEV
Clupea harengus V109 trgv JZKK01027190.1 3149 VSCQKAVTQTPSSLTVNKNEKATLYCNVEKDQGQYVSWYKQIPLEAPQYVLRFYHSHGSPNEYGTGFSSDHVTSKASSTIDYQLVISNVEVGDSATYYCATWD
Clupea harengus V108 trdv JZKK01026464.1 312 SAAENDVTQTPGILWKHHGDSAEMNCSHTKGAQYFQMYWYRQRQGETMSLVVFTTTGSEEFGDIDKTKYSTVKTVPERGSLTVTSVESDDSGIYFCSVS
Clupea harengus V107 trav JZKK01026331.1 866 KTSGNKITPNSVELNTVEGDHLTLSCNYSSGDYLQWYRQYPRSTPQFLLLIINPDKTEKSDLEPRFSGRMNKERSQMFLDISSAKLSDSALYYCALR
Clupea harengus V106 igkv JZKK01026003.1 429 SVTQTPTVKAVLPGQTVSMTCKTSENVATSCYQSGDHCLSWYKQQSGEAPKLLIKAGRFLHTGTPSRFSGSGARSDFTLTISNVQAEDAGVYYCQSYHSGPV
Clupea harengus V105 trav JZKK01021467.1 298 QETVDQPEVHVVSYEGAMVTLSCGYSKGGSSPDLFWYIQRPNDFPKLILRRDRYSPGHDGTEFNERFNSTLNFTSSSVPLIIQNLQVSDSAVYYCALR
Clupea harengus V104 trbv JZKK01021394.1 729 LSNSQVQQTPRDLLKQPGDDVQLNCSHKIPSYNTILWYKQLKGDTALKLIGYVYYKNPTLEMSGQNFSVTGDGQNDAFLHVDKLKPVDSAVYFCAASY
Clupea harengus V103 trdv JZKK01021394.1 2590 SGLGNDIKQFPLYVFQNQGQSGRLTCSHPYSSSNTIIWYKQSQDGGLKYLGYLSGDSETLETELKNTGKISLDGNGGANSNGSLTINKLVPNDSAAYYCAAS
Clupea harengus V102 trbv JZKK01021393.1 121 LSNSQVHQAPRDLLTQPGNGVQLNCSHKIPSYDTILWYQQLKGDPALTLIGYVSFTYPALEMSGQNFNVTGDGRNVAFLHLVKLKPVDSAVYFCAASY
Clupea harengus V101 trbv JZKK01021392.1 4542 LSNSQVHQAPRDLLTQPGNGVQLNCSHKIPSYDTILWYQQLKGDPALKLIGYVSFTYPALEMSGQNFNVTGDGRNVAFLHLVKLKPVDSAVYFCAASY
Clupea harengus V100 trav JZKK01021392.1 6172 QSYEVQQNLRDLLKAKGENVSLNCQHQIPNFKLILWYKQTVQGSTLDLIGYVYYTSPTVEKPYDELFNVTGDGSKNSILYFLKPIQVEDSAVYYCAASQ
Clupea harengus V99 trbv JZKK01021391.1 698 SALTTSVDQTPPDMFKTQEDSAQFKCRHNISSYNVILWYQQSQNTGLTLLGYVYRMNKNKESAFEHKIELSGSSGTNEDSFITIKSLTLNDSALYFCAAS
Clupea harengus V98 ighv JZKK01020415.1 16767 FVITITPMKSEDHVLEGGNITLGCKYDGSVNNLQWYRQYPALKPEFLLLILQTSSHVQHAVPQNPRLHTRLDTEKTHVFLEISSVKLSDSAIYYCTLQ
Clupea harengus V97 trav JZKK01020312.1 135 VGAEDAVDQTDGDLSAFEGDGVTIACSYKTSANSASLLWYKQQANGFPEFMLIRNTYNTDGTSEEMFKERFQSKVNTASKTVPLTIQNLQVSDSAVYYCALK
Clupea harengus V96 trdv JZKK01020312.1 1400 DTKANGITPLDSTKNVMKGESVTFSCNYSGSIRSIHWYRQYPRSKPEFLLFITESNFTGEVPSRMSSHTTKDTKHVFLEISSVEVSDSALYYCALQ
Clupea harengus V95 ighv JZKK01020311.1 2088 FVITITPMKSEDHVLEGGNITLGCKYDGSVNNLQWYRQYPALKPEFLLLILQTSSHVQHAVPQNPRLHTRLDTEKTHVFLEISSVKLSDSAIYYCTLQ
Clupea harengus V94 ighv JZKK01020311.1 4096 FVITITPMKSEDHVLEGGNITLGCKYDGSVNNLQWYRQYPALKPEFLLLILQTSSHVQHAVPQNPRLHTRLDTEKTHVFLEISSVKLSDSAIYYCTLQ
Clupea harengus V93 trav JZKK01020311.1 5573 DTSANVITSLESTKNVMNGESVIFSCNYSGSISALQWYRQYPRSKPEFLLFITESNSTGEVPSRMSSHTTKDTKHVFLEISSVEVSDSGLYYCALQ
Clupea harengus V92 trav JZKK01020310.1 9983 DSFEDSVTPIETEQQALEGETVTVSCNYSGSVRSLHWYRQFGTAAPEFLNLILEAGTAVGNVSRVVPKIHKSIQRVDLEISPAKISDSALYYCALE
Clupea harengus V91 trav JZKK01020310.1 11322 CTFSNPISTLQHDVDVSEGESVTLSCTYTGDSGSELYWYQQHLGSKPEYILFIMESGFNRTADTPLPGVTVHIDKELKRVDMKISPVKLSHSALYYCALR
Clupea harengus V90 trav JZKK01020310.1 12781 DSFEDSVTPIETEQQALEGETVTVSCNYSGSVRSLHWYRQFGTAAPEFLNLILESGTAVGNVSRVVPKIHKSIQRVDLEISPAKISDSALYYCALE
Clupea harengus V88 trav JZKK01020310.1 15604 DSFEDSVTPIETEQHALEGETVTVSCNYSGSVRSLHWYRQFGTAAPEFLNLILESGTAVGNVSRVVPKIHKSIQRVDLEISPAKISDSALYYCALQ
Clupea harengus V87 trav JZKK01020310.1 16947 CTFSNPISTLQHDVDVSEGESVTLSCTYTGDSGSELYWYQQHLGSKPEYILFIMESGFNRTADTPLPGVTVHIDKELKRVDMKISPVKLSHSALYYCALR
Clupea harengus V86 trav JZKK01020310.1 18427 DSFEDSVTPIETEQQALEGETVTVSCNYSGSVRSLHWYRQFGTAAPEFLNLILEAGNTVGNVSRVVPKIDKSVQRVDLEISPAKISDSALYYCALE
Clupea harengus V85 ighv JZKK01019645.1 19043 SQTPDVKHVLPGESVSIRCKTSAPVYPDCSSSGKPCLFWYQKKEGAPPKILVYHADLRHQDAPVRFSGSGSGSDFTLAISGVHREDSGVYYCKSIHSGNV
Clupea harengus V84 trav JZKK01017427.1 689 QDAVEQPEGEMVHIEGGTVTLNCGYKTTSSTQYLYWYIQRPKDFPKFILKRENYGIGENGTEFIERFHSNLNVTYSSVPLIIKNLQVSDSAVYYCALRPTVTA
Clupea harengus V83 trav JZKK01016816.1 453 QDAVEQSEGEMAHIEGGTVTLNCGYKTTSSTQYLFWYIKRPKDFPKFILKRDSYGIGENGTEFNERFHCKLNVNSSSVPLIIQNLQVSDSAVYYCALRPTVTA
Clupea harengus V82 trdv JZKK01016816.1 1684 DTITSNQNQSYTEDGSNVTLSCSYSTTSGSATLQWYRQYPRSAPQFLVLMLHSTEEPQMSEVDPRLMVKLNKEKTQVFLEISSVQVSDSALYYCALR
Clupea harengus V81 trav JZKK01015122.1 1909 YSLQDDITPASKEITILEGETASLSCTYSGISVNNLQWFRQNPGSKPKFIILMMESSNFKVESTPPHPRVSAEVYKDAKRVDLNISSAEVSDSAVYYCALE
Clupea harengus V80 trav JZKK01010784.1 538 DSNGQGIQPSIAEGVFSEGSFVSLSCKYTGTVSMESLLWYRQYPRSRPEFLYLLSETNFKQEADPPISGLSVKLNSEQNRVFLELSSAEVSDSALYYCALQ
Clupea harengus V79 trav JZKK01010765.1 3305 CRAKGDQVHQQESHVIRFEGETVILPCVYESSSTNLNLFWYKQRPKEFPKFILRRDKFGSGDNGTEFNERFHSNLNITFSSVPLIIQNMQVSDSAVYYCALR
Clupea harengus V78 trbv JZKK01007607.1 621 STADNSVHQTPPQWILSQGENASIDCSYSNTDFNRIFWYKQTSDRKVTLLGYLTGNSPFSESAFKNKTVLKGDANKLRGTLEVLNLTRDDVAVYFCAAS
Clupea harengus V77 trdv JZKK01007607.1 1502 SGLGNDIKQFPLYVFQNQGQSGRLTCSHSYSSYNTIIWYKQSQDGGLKYLGYLLRDSETLETEFKNTGKISLDGNGGANSNGSLTINKLVPNDSAAYYCAAS
Clupea harengus V76 trbv JZKK01007606.1 2956 SALTTSVDQTPPDLFKAQEDSAQFQCSHNISSYNVILWYQQSQNTGLTLLGYVYMTNKNKESAFEHKIELSGSSGTNEDSFITIKSLSLNDSALYFCAAS
Clupea harengus V75 trav JZKK01007605.1 495 QSNEVQQNLRDLLKAKGENVSLNCQHQIPNFKMILWYKQTVQGSNLDLIGFVSYTSPTVEKQYDKLFNVTGDGSKDSNLYFLKPIQVEDSAVYYCAASQ
Clupea harengus V74 trbv JZKK01007604.1 4 SALTTRVYQTPPDMFKTQEDSAEFKCSHNIKKYNVILWYQQTQNKGLTLLGYVYLIDKIKESTFQHKIELSGNAGRLDSCFITIKSLSLNDSALYFC
Clupea harengus V73 trbv JZKK01007603.1 4910 IIDGVQITQWPKDISNLTGSSVDMHCYQNETDYDYLYWYQHKEGAGPVMMVTYVSGRATFESDFNSGFKAWGSGKKQWSLTINSVQAGQGAVYLCAAS
Clupea harengus V72 trbv JZKK01007603.1 10418 SGVHQFPNILWKPSQSTTVMNCSHTKDASHTQMYWFQQHAGKGMRRLVFTFAGGAPDYGDSSNDKYEAIKDSIESGALRIKNLVPEDSGLYFCAVS
Clupea harengus V146 trav JZKK01069833.1 472 KTSGNKITPNSVELNTVEGDHLTLSCNYSSGDYLQWYRQYPRSAPQFVLFIITPDKTEISDVEPRFSGRMNKERNQMFLDISFAKLSDSALYYCALR
Clupea harengus V145 trav JZKK01069780.1 1465 KTSGNKITPNSVELNTVEGDNLTFSCNYSSGNYLQWYRQYPRSAPQFLLLITSPDKTDKSDVEPRFSGRMNKERNQMFLDISSAKLSDSALYYCALR
Clupea harengus V144 trdv JZKK01069304.1 751 DTITSNQNQSYTEDRSNVTLSCSYSASSGETPQWYRQYPRSAPHFLLFIISPDKTEISAVEPRFSGRMNKERNQMFLDISSAKLSDSALYYCALR
Clupea harengus V143 trav JZKK01064765.1 23051 KSYGNKITPNSVELNTVEGDNLTLSCNYSSGNYPQWYRQYPRSAPQFLLFIISPGKTEISNLEPQFSGRMNKERNQMFLDISSAKLSDSALYYCALR
Clupea harengus V142 trav JZKK01064765.1 27507 FTVKGDSGSQPKDVTGLKGRMVTLSCQFDTIGVMPYCIFWYQQKPNSFPKYMLWRNAIGEVVEHGFRGRFSTTLNTTSKTVPLIIQNLQVFDSAVYYCSLS
Clupea harengus V141 trav JZKK01063781.1 335 EGESVDQPQGDVISSEGGMVTINCQYDTTAVQIYLFWYKQQPNDVLKYMLQRYQYGDEINSDEFKERFDATLNITSKTVPLTIQNLQMSDSAVYYCALRPTVTA
Clupea harengus V140 trav JZKK01062973.1 547 CRAEDRLEQPDEMAAAEGGHVTLHCKYITDDPYPYLFWFQQKLKVAPKLILNRLTSGGGSTESEFKERFNASLDTSTKTVPLSIQDLQISDSAVYYCALR
Clupea harengus V139 trav JZKK01062973.1 1916 QDAVEQSEGEMAHIEGGTVTLNCGYKTTSSTQYLFWYIKRPKDFPKFILKRDSYGIGENGTEFNERFHCKLNVNSSSVPLIIQNLQVSDSAVYYCALRPTVTA
Clupea harengus V138 trav JZKK01062972.1 2652 CRAKKDSVHQTESLVVGTEGESVTLVCEYETTDERPYLLWYKQQQNNIPDNLLGRGKYDTGNNGTEFSERFHSTFSSSSFPLTIRNPQVTDAAVYYCALQPTVRT
Clupea harengus V137 trav JZKK01062971.1 2492 VRSENVISPHSPEVYAEEGSRVTLSCNYSTATTSLLQWYQQYPRSVPKHLVSVYSSEQISYIDHRLTGKINKEKTQVFLEISSLQVSDSALYYCALT
Clupea harengus V136 trdv JZKK01057302.1 1162 KVSQLPTISIMKIQTKSVTLNCQHDDSSYFYMFWYRQQTNREMNLIAYSSGIHNAQIEKPFDGSKYTLTRPEVLKSSLEIKDLESGDSALYFCATSI
Clupea harengus V134 trdv JZKK01048211.1 1033 VCMGNKITPDRTEVSTEKESNVTLSCSYSSAVSLQWYRQYPRSPPQFLLLMLHSTGQPQRSEVDPRLMVKLNKEKTQVFLEISSVQVSDSALYYCALTPTVTQ
Clupea harengus V133 trav JZKK01048211.1 2633 KSAGNSIVPNTAVNHATEGENVQLICKYNGSVYSLHWYRQFSDSVPQFLILDYQGYITNATPPVPGISSKHDTTAKQVSLEISSAEVSDSAVYYCALR
Clupea harengus V132 trav JZKK01048210.1 864 CRAEDRLEQPDEMAAAEGGHVTLHCKYITDDTYPYLFWYQQKLKVAPKFILSKLISAEGSTDSEFQERFNASLDTSTKTVPLSIQELQISDSAVYYCALR
Clupea harengus V131 igkv JZKK01047711.1 4640 SVTQTPTVKSVLPGQTVSMTCKTSRNVDTSCYYSGDQCLSWYKQQSGEGPELLIYSGIYLHTGTPSRFSGSGTGSDFILTISNVQAEDAGVYYCQSYHSGGV
Clupea harengus V130 trav JZKK01046592.1 608 VDCNIEHTQPSIMTVKPGESLSITCKVTGASITDSSYWRTAWIRQPAGKALEWINSIDYDGEERHSDKLKNKFSISRDTSSNTLTLRGQNLQPGDTAVYYCARATL
Clupea harengus V129 trbv JZKK01043889.1 1416 SSTSSQVNQVPPDIIQSTGGSANIQCSHNIPNYDRILWYKQTKDGQLTYLGYLYGKDPNPESEFKNKIDLIGFSNTNGSMMVEKLLPKDAAVYFCAAY
Clupea harengus V128 trbv JZKK01043888.1 1412 DNSVHQTPPQWILSQGENADINCSYSNTNFDRILWYKQTSDRKVTLLGYLSGNSAFSETAFENKINLKGDAYKLRGTLEVLNLTRDDVAVYFCAAS
Clupea harengus V127 trgv JZKK01041251.1 9770 VSGHKAVTQTPSSLTVNKNEKATLYCNVEKDQGQYVSWYKQIPLEAPQYVLRFYHSHGSPNEYGTGFSSDHVTSKASSTIDYQLVISNVEVGDSATYYCATWD
Clupea harengus V126 trgv JZKK01041251.1 11176 VSGHKAATQTPSSLTVNKNEKATLYCNVEKDQGQYVSWYKQIPLEAPQYVLRFYHSHGSPNEYGTGFSSDHVTSKASSTIDYQLVISNVEVGDSATYYCATWD
Clupea harengus V125 trgv JZKK01040947.1 3210 VVTGSVVSQPDQVIISRLGETVTVKCMTLKDSYEHLFWYQQRLGQMPRCICIARTNKDPHYVAEFKDSHISCQRTEGGFDLKIRNSTWSDEASYYCASRDR
Clupea harengus V124 trgv JZKK01038837.1 3114 VVTGSVVSQPDQVIFSRLGEIVTVKCMALKDNPEYLFWYQQRLGQMPRCICMARKHTDPYYVGEFKDSHITCQTTEGFDLEIRNNTWSDEASYYCASRNK
Clupea harengus V123 igkv JZKK01038290.1 4376 SSADKILTQSPSSKSVQSGETVSISCTASESVGNALNWYSQKPGEAPKLLIYDASNRQSGVPGRFSGSGSGSTFTQYTLTISRVQPEDAADYYCGQ
Clupea harengus V122 igkv JZKK01037020.1 380 SSADIILTQSHSSKSVKAGETVSISCTASQTVSGYLHWYSQKPGEAPKLLIYYATTRQSGVPDRFSGSGSGTQYTLTISRVQPEDAADYYCQQCNQFP
Clupea harengus V121 igkv JZKK01037019.1 1310 SSADIILTQSHSSKSVKSGETVSISCTASEGISNNLHWYSQKPGEAPKLLIYYATSRQSGVPDRFSGTYSGTQFTLTISRVQSEDAADYYCGQSSYNP
Clupea harengus V120 trdv JZKK01035683.1 242 DTTANVITPLGSAKNVMKGESVIFSCNYSGSISALQWYRQYPRSKPEFLLFITESNGTGEVPSRMSSHTTKDTKHVFLEISSVEVSDSGLYYCALQ
Clupea harengus V119 trav JZKK01035683.1 1560 ESFGDTITPSQSSVVISEGEQVTFSCNYSSSNVQNLQWYRQYPNSIPEFLYYIREAGSSSEKVPRLTPSINKEEKRVFLELSSAEASDSAVYYCALR
Clupea harengus V118 trav JZKK01035683.1 5236 VAGEDAVDQSDGVLSAFEGDEVTIACHYETSDKTASLLWYKQTANGSPEFMLITFSYPGGQTEEKFKERFHSKVNSTSKTVPLIIHNLQVSDSAVYYCALKPTVTA
Clupea harengus V117 trbv JZKK01035631.1 608 SSTSSQVNQVPPDIIQSTGGSANIQCSHNIPSYDRILWYKQTKDGQLTYLGYLFGKDPNPESEFKNKIELIGFSNNSNTNGSMMVEKLLPKDAAVYFCAAY
Clupea harengus V116 trbv JZKK01035631.1 2377 STLANSVNQTASDQIKNASVSLVLECFHTIPNYNRILWYKQTHGGTLTLLGYLTGTSASNIEPEFSGKVQMDGDPNTNKMNSLTISNLLLNDSAVYFCAAF
Clupea harengus V115 trdv JZKK01035631.1 3202 SAAENDVTQTPGILWKHHGDSAEMNCSHTKGAQYFQMYWYRQRQGETLSLVVFTTLGGREQFGDFNKSEYSTVKTEADKGSLTVISVESDDSGIYFCSVS
Clupea harengus V114 trbv JZKK01035631.1 3971 SAAENDVTQTPRILWKHHGDSAEMNCSHTKGAGYNQMYWYRQRQGETMSLVVFTTSYSKEEFGDIKSSNYSTVKTVPERGSLTVTSVESDDSGIYFCSVS
Clupea harengus V113 trbv JZKK01035631.1 6197 SSTSSQVNQVPPDIIQSTGGSANIQCSHNIPSYDRILWYKQTKDGQLLYLGYLFGKTPYPENENKTDLIGFSNTNGSMMVEKLLPKDAAVYFCAAY
Clupea harengus V112 trbv JZKK01035631.1 7949 STLANSVNQTVSDQIKNASQSLELECFHTIPSYNRILWYKQTHGGILTFLGYNVGTSPGTIEPEFREKLKMDGDPNTNKMNSLTISNLLLNDSAVYFCAAF
Clupea harengus V111 trdv JZKK01035631.1 8778 SAAENDVTQTPGILWKHDGDSAEMNCSHTKGAQYFQMYWYRQRQGETLSLVVFTTLGGREQFGDFNKSEYSTVKTEADKGSLTVISVESDDSGIYFCSVS
Clupea harengus V147 trgv JZKK01070025.1 110 VVTGSGVSQPEQVIISRLGETVTVKCMTSKDSYKDLFWYQQRLGQMPRCICMAMKYTYPHYFDEFKDSHISCQRTEGFDLKIRNSIWSDEASYYCASRNT
Clupea harengus V135 trav JZKK01048212.1 497 IILGNTITSNQNQSYTEEGSNVTLSCSYSTTYSSVTLQWYRQYPRSDPQFLLLMLKSTETQRSELDPRLMVKQNKEKTQVFLEISSVQVSDSALYYCALR
Clupea harengus V110 trgv JZKK01027191.1 492 VSGHKAVTQTPSSLTVNKNEKATLYCNVEKDQGQYVSWYKQIPLEAPQYVLRFYHSHGSPNEYGTGFSSDHVTSKASSSIDYQLLISNVEVGDSATYYCATWD
Clupea harengus V89 trav JZKK01020310.1 14124 CTFSNPISTLQHDVDVSEGESVTLSCTYTGDSGSELYWYQQHLGSKPEYILFIMESGFNRTADTPLPGVTVHIDKELKRVDMKISPVKLSHSALYYCALR
Clupea harengus V71 trav JZKK01007603.1 12476 QSFEVQQNRELLKAQGENVPLNCQHQIPNFRLILWYRQTVQGSTLDLIGYVDYTSVTVEKPYDELFNVTGDGSKNSILYFLKPIQVEDSAVYYCAASE
Clupea harengus V53 ighv JZKK01005922.1 4341 SSGQTLTESEPVVLKPGDPHKLTCTYSGFSSDPWMAWIRQGPGKALEWLALIHPTTSSDTYYAQSIQGRFTISRDNSKKQSYLQMNSLKTEDSAVYYCARE
Clupea harengus V18 igkv JZKK01026002.1 3616 CRGQISVTQTPAVKAVLVGQTIKLDCRSSSPIYGDYLSWYLQKTGEAPKLLIYDINSRQGSTPSRFVGEGSDYGSDFSLTISNVQAEDAGVYYCQSYHSISSKSV