WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Cottus rhenanus LKTN00000000.1 (LKTN01) 8 0 0 0 0 5 0 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Cottus rhenanus V1 trbv LKTN01046423.1 875 LSKNSVHQSPGALIKHPGEEVQMNCSHSNSDFDMIQWYKQPAGGHEMVLVGYVRFSSGTIEAQFQDTYNVSGNGGSLACLHIPKLSLSEDGVVYFCAASR
Cottus rhenanus V0 trbv LKTN01034493.1 397 QGNAVTFQQSPPQIVEESTEVQINCSHDDTNLPSMLWYQHRTENMSMTLIGYGYGTSPPNYEGQFEEQFKLTKETSVKGALFVRKAELSHSAVYFCAASTQ
Cottus rhenanus V6 trdv LKTN01044588.1 351 LVAGDRISPAGDEVIQREGESVSLRCDYDTTSNSVYLYWYKHHSDLQAPHFILWKGARDITNEYIPDKRYECQTSRESSVLTITRLSLTDTALYYCALE
Cottus rhenanus V5 trdv LKTN01106632.1 5031 VTKTLSITQDSGILTANVGQNVTLKCFSQDVSVTFLSWYQQRMGSKPVIITTGMRKGVMSISPEYEERFRISEEKDTNHLVIKDLQLSDSATYYCGALE
Cottus rhenanus V4 trbv LKTN01095556.1 3635 QVSAAKFQQSPPQIVEESTEVQIKCSHDDTSLVLMLWYQQRQDNMSMTLIGYGYESSPNYEGQFEEQFKLTRENTVKGALIVRKAELSHSAVYFCAASTQ
Cottus rhenanus V3 trbv LKTN01095556.1 2689 VSQSVLITQWPHYISSLPSGRAEMHCYQNDTNYEYLYWYRQPSVGGFQLMVYILAGSVNYEEGFKTGFEAVKSEDKQWSLTITSVQTNDEAVYLCAAS
Cottus rhenanus V7 trdv LKTN01084061.1 541 QATDLKMSSPLLQERGFVSANVGDKITLQCFYSNDDPAWLYWYKQILGEKPKLISTVYVYDTKATFYHEFKNNARFTLDTEKGQNHLTVFDVDISDSATYYCAS
Cottus rhenanus V2 trbv LKTN01095556.1 1778 IVISSLLIQQSPVNLLMKPEQEEAHLGCYHGDNNYPYMLWYRSTAAGGRRDMELIGLLHYETSTPEKNFEARFNITGHSKGRAQLVISNVNPADSAEYFCAAS