WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Cynoglossus semilaevis AGRG00000000.1 (AGRG01) 18 1 0 1 4 11 0 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Cynoglossus semilaevis V17 trbv AGRG01055929.1 97 ASDKRVIQSPFFITKGNGESVEREINCSHSIPSYDTILWYKQDKRDLIFLGYITATFPTVEVNLRGKVDFHGAGSRHASLTIKELSVNDSAVYFCAAS
Cynoglossus semilaevis V16 trav AGRG01031637.1 5125 TVSLVGITSLTPETVGLEGEKMVLSCKYEGSIYSIVWYQQRERSRPEVMFSITEQGSVSSTVPGFSTHINKPEKHVELQINSAAVRDSAVYYCAVR
Cynoglossus semilaevis V15 igkv AGRG01027179.1 1726 SSQVTVTQPAAVTSALGQSVTITCRTSQNVYVSGSTHILSWYQQKDGEKPKLLIYYASTRASGIPDRFTGSGSNSDFSLTISGVQAEDAAVYYCMS
Cynoglossus semilaevis V14 trbv AGRG01020929.1 1970 FTDGSYVTQTSILWKNNSDNATMHCNQSKGSDYYQMYWFRQLPGKTMELIVLTMSTTKEHDFGKFSKVKFSAEKPDAFSGSFTVKTLEAGDTGLYFCAASQHS
Cynoglossus semilaevis V13 trbv AGRG01020929.1 6219 VSDTKTVIQTPGHIVKRPEESVDREINCSHNIPNHDYILWYKQEENKSLKYLGFLNRKYETVESDLSGKIHITGDGNEKSELTIYNLFLNDSGVYFCAAR
Cynoglossus semilaevis V12 trbv AGRG01020929.1 7007 LLDGADVNQPSMMWRNKDDNTTLHCNHTKGADYFQMYWYRQLPGETIKLIVFTTSVNKNYDFGKFSKDKFAADRPDVFRGTLTVNNLQPGDEGLYFCAVS
Cynoglossus semilaevis V11 trbv AGRG01020929.1 8206 ASDKRVIQSPFFITKGNGESVEREINCSHSIPSYDTILWYKQDKRDLIFLGYITATFQSVEVNLRGKVNFHGAGSRHASLTIKELSVNDSAVYFCAAS
Cynoglossus semilaevis V10 trav AGRG01020928.1 2312 HCQYVTQHPAIGWSSVSGSVEMNCSHNRDAGHTQMYWYRQPPGQTMTLVVYTIYRGQTDYGKEVNKAKYTAVKDTVETGALTVRNLKPEDSGTYFCAVS
Cynoglossus semilaevis V9 trbv AGRG01020928.1 2998 SSLSDKVRQTPADMYKNKDKNETAEIICSHSIDSYNRILWYKQSDDGQLRYLGYMVGNTANPETGAGVKMNGGANKGENCTLTTEALELKDSAVYFCAAS
Cynoglossus semilaevis V8 trbv AGRG01020928.1 3782 SSLSDKVHQTPADMYKNKDKNETAEIICSHSIDSYNRILWYKQSDDGQLRYLGYMYGKTATPETGAGVKMNGDANKGKNCTLTTEALELKDSAVYFCAAS
Cynoglossus semilaevis V7 trav AGRG01020927.1 3701 VTTLVLQSGDQVCLPGTTVMLGCSLGPQLTMQGAIMYWYKQNHYRGPVVHLVNEYSHSVGNIKSIIDSINNNFSLVITEALLQDSSVYYCAA
Cynoglossus semilaevis V6 trbv AGRG01020926.1 666 SSIQVQQTPDQICKYPRQSATISCLHMDNNYDRIYWYKQNDKQLFVSLGYMNFKQPFPEADVELSGGASRNQSCTLTIKSLELNSRGVYYCAAS
Cynoglossus semilaevis V5 trbv AGRG01020926.1 1354 SSLSDKVHQTPAAVHHKPGEAAEINCSHSIDSYDRIYWYRRFNDRQLHFLGYLNIIYGYPEPGLNVKMTGDANKNKTATLSVLDLTPNISAVYFCAAS
Cynoglossus semilaevis V4 trbv AGRG01020926.1 4377 SRTNRVHQTTGLLVNRGQSAEMVCSHDLGGKYLEMRWFQQLPGESLKQIVFTVPYNSQHQYGDSDQDKFTAVKNDAERGEFTVNNVGTADSGVYFCAVSAPTHS
Cynoglossus semilaevis V3 trdv AGRG01020926.1 5608 LTDGSDVTQTPQLWRNKSQSATMHCSHTKGGSYFQMYWYRQRPGQTMEEIVFTTLTPPHQYQSGFSKERYPAEKKDAETGSLTVKTLLPDDSAIYFCSVS
Cynoglossus semilaevis V2 trbv AGRG01020925.1 75614 QVSAVTFQQSPPQLVKENTRIKINCSHSDSTLLQMLWYQQLQDSLSMTLIGFTYSENSPTYEGSSEEQFQLTKEDTLSGSLIILSASLSHSAVYFCAASTQ
Cynoglossus semilaevis V1 ighv AGRG01029657.1 5198 VDGQSLTQSEAVVKRPGDSHRLTCTGSGYTFSSYEMHWVRQAPGKGLEWIAVISYDSSNIYYSDSVRGRFTISRDNSQQQLYLQMNSLKTEDSAVYYCARD
Cynoglossus semilaevis V0 trav AGRG01012149.1 1574 LITATVDQQNVRLISAIVGEDLTLACVVDHSDVQFFWYRQRLGRKPQIICSVYSFQEVAKFHHEFKDNPRFRFEKKDDQMNLRISDAQPTDSATYFCMS