WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Eidolon helvum AWHC00000000.1 (AWHC01) 57 5 12 3 22 6 3 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Eidolon helvum V10 trav AWHC01009345.1 2500 VRGLEVEQSPSSLSLQEGTNSTLMCSFSSTVTSMQWFRQNPGGSLTNLFFMSSGTKQNGKLSSTMNTKERYSTLLITASQVQDSATYLCAGQAQC
Eidolon helvum V12 trbv AWHC01011935.1 5145 SMDDGVTQSPRNKIAKTGSSIILECSQNKGHDYMYWYRQDPGLGLKLIYYSVDMNNKNKGEASDGYDVSRNEQANFSLSLTSASPSQTALYFCASSY
Eidolon helvum V28 igkv AWHC01028741.1 2572 ITGEIVMTQSPASLSLPSGEKATFNCRASQSVSSYLAWYQQKPGQAPRLLIYGASNRATGIPARFSGSGSGTEFTLTISNLEPEDFATYYCQQYNSGY
Eidolon helvum V33 iglv AWHC01034923.1 13971 TWAQSGLAQKASALGSLGQTVTVTCTGNSNNVEYSGANWYQQLPGAAPKLLIYGSRGRPSGIPARFSGSRSGSKASLTISGLQPEDEANYYCSSWDKSIS
Eidolon helvum V47 trdv AWHC01048869.1 4708 TRTQVVQVNDSMYGFIGTDVVLHCSFANPLPGVKITQVTWQKSTNGSKQNVAIYNPAMGVSVLIPYRERVEFLQPSFTDGTIRLSRLELEDEGVYICEF
Eidolon helvum V51 trdv AWHC01052940.1 6564 SSIAQKVTQGHRAMLVQEKEAVTLNCKYDTSFTTYSLFWYKEPSSGAMIFLIRQDSHNQQNATEGHYSSNFQKANNFGNLVISAAQLEYSALYFCARSE
Eidolon helvum V60 trbv AWHC01061498.1 5701 IRAQTIHQGPPKKVQVAGSSLFLECIVKGTSNPNLYWYRQALGGALHLLFYSYSVGKAESETPQNFTASRPEDGRFILSSQKLLLSDSGFYLCAWS
Eidolon helvum V62 iglv AWHC01062325.1 704 ANSQTVVTQEPSLSVSPGGSVTFTCGLSSGSVSTSNYPGWHQQTPGQAPRTLIYDANSRPSGIPGRFSGSISGNKAALTITGAQPEDEAEYYCSLHMGSGI
Eidolon helvum V102 trav AWHC01104634.1 5706 RSSGNSVSQTQGQLTLTEGVSLNVSCTYSSSGYPTLFWYIQYPGEGPQLLLKATRSSDKASYKDFKATYRKEPNSFHLEKASVQESDSAMYYCALS
Eidolon helvum V124 trav AWHC01125619.1 1797 VSGKNGVEQSPQYLSAQEGEFITINCSYSKGMTTLHWLGQNPGRGIVSLFILSLQMKKEGRLSAKINTKESHSSLHITASQPRDSAIYFCAV
Eidolon helvum V193 igkv AWHC01214298.1 4026 TRTETIVTQSPALLSVALGDKVTITCKTSTDIDDDMNWYQQKPGEALMLIISESARRSGVPSRFSASGYGTDFTLTINNVESEDAAYYFCQQGDNL
Eidolon helvum V194 trgv AWHC01214936.1 9990 GDTKVKISQDQLSFTRRTDRTVHISCKLSGVHLENAIVHWYQQKEGEPLRRILYGSTNNYKQDKPNSRLETDKKDNGNFYLIINNVVKSDEATYYCAYWD
Eidolon helvum V201 trav AWHC01224357.1 4384 SSIAQKVTQGHRAMLVQEKEAVSLDCRYNTRDTTYSLFWYKQLSSGVMILLIRQDSYNQRNATEGRYSLNFQKTKNFGNLVISATQLEDSALYFCALRE
Eidolon helvum V212 ighv AWHC01236818.1 944 VHAQVQLVQSGAEVRKPGASVKVSCKASGYTFTSYNMNWVRQAPGQGFEWMGWVYPNDGRTRYAQKFKGRVTMTTDKSTSTAYMELSGLRTQDTATYYCAR
Eidolon helvum V228 trdv AWHC01254006.1 2651 AMSVHVLVPQDEVVTVSMGESATFRCSMKGESITSFYLSWYRKTQGNTVTFIHREENIYGPGFQDRFQGKIDVSNNQAVLEILKVSEGDEGSYYCASD
Eidolon helvum V229 trav AWHC01254539.1 686 GTRAQTVTQPEDHISVFEGDSVQVKCNYLYTGSPELFWYVQYPKQGLQLLLKYTSRKSIKGFTADLNKAGASFHLKKPSVQEEDSAMYYCALS
Eidolon helvum V240 trav AWHC01270670.1 207 GLKAQSVTQPDYQVTVAEGDPLTVRCTYSLSGSPYLFWYVQYPNRGLQFLLKYITGDKLVKGNFGFEAEFDKQQSSFHLKKLSALVTDSAVYFCTGS
Eidolon helvum V249 trav AWHC01002846.1 919 VRGQQQVEQSPPALSLQEGANTTLGCKFSSVTNVQWFRQNPGGRLINLFYIPSGTKQNGRLKATTDVQSRQSSLIISSSQTTDSAIYFCAVEPQCS
Eidolon helvum V255 iglv AWHC01010502.1 1235 SVASSNLSQPPAVSVAIGQTASITCQGERLGQGESLKKYYAGWYQQKAGQAPVTVIYGNNNRPSGIPDRFSASDSGDTNTLTISGVQAEDEADYYCTAWDNSDK
Eidolon helvum V273 trdv AWHC01025328.1 9001 FSMTHSVTQARTIVTQREGEAVTMDCTYETTWSYYDLYWYKQLPSGEMVFLIYQYFSSQNAQQDRYSVNFQKEKKIIVLTISSLQMEDSAKYFCA
Eidolon helvum V274 trav AWHC01025328.1 3508 IMGDAKSTQPDAMESTEKEPVFLPCNHSTISGDEYIHWYRQIPGQSPEYVIHGLKGNVSHGMTSLIIARDRKSSTLILAKVTLRDSAVYYCILRE
Eidolon helvum V278 trbv AWHC01028882.1 3285 PMDAAVTQTPRHRIVQTGKRTILECSQHMNHFAMFWYRQDPGQGTRLIYYSRGVGSTAEGDVTEGYGVSRNKTEDFPLTLESASTTQTSLYLCASSEYPA
Eidolon helvum V279 iglv AWHC01029148.1 14838 ADSQTVVTQEPSLSVSLGGMFTQTCGFSSGSVSTSNYPGWHQQSPGQPTCKLICSTNSHPSGIPGHFSGSISENKVALSITGAQPEDEANYYCNLYVGSGI
Eidolon helvum V290 iglv AWHC01037006.1 1664 SLSQPMVTQPPSLSASPGASARLTCTLSSGFSVGGHWIYWFQQKPGSPPRYLLSFYSDSSKHQASGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCSV
Eidolon helvum V314 ighv AWHC01065897.1 1482 VLSQVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVHWTRQAPGKGLEWVGGIWSDGSTYYNPALKSRVTITRDTSKSQVFFRLNSVTSEDTAVYYCAR
Eidolon helvum V321 trav AWHC01070003.1 3978 SSIAQKVTQSHRAMLAQEKEAVTLDCRYNTSDSSYSLFWYKQLSSGVMISLIRQDSYNQRNATEGRYSLNFQKAKNFGNLVISAAQLEDSALYFCALRE
Eidolon helvum V347 trav AWHC01102937.1 7362 SSVAQTVTQPQPEMSVQETETVTLACTYDTSESTYYLFWYKQPPSGEMIFLIRQESFKQQNAMNDRFSVDFQKATKQFSLRISDSQLEDAAMYFCAFMK
Eidolon helvum V350 iglv AWHC01110562.1 1114 VLTQPQPVLTQPPSLSASPRASARLSCTLSSGFSVGSYGIYWHQQKPGSPPRDLLRFYTDSDKHQGSGVPSRFSGSKDASANAGLLLISGLQPEDEADYYCSI
Eidolon helvum V353 trdv AWHC01112855.1 6475 VLLDINLEPDTKTLTVQVGEPATFCCRVTGADLKNYQMSWYKKNEDNSLTLVYRLSNSSDHSLIRSNFKGKIDALKSQYILDIQKTTAKDAGIYYCGSD
Eidolon helvum V357 trav AWHC01114332.1 5277 RSRGASLSQMGGQVTLSEGASLNVSCTYSASGYSVLFWYVQYPGEGPQLLLKAQRANEKGRKKGFEATYHQKANSFHLEKASVQESDSAMYYCALS
Eidolon helvum V373 iglv AWHC01137841.1 2903 SFSQAVLSQPPSLSTSLGSTARLTCTLISGFDVGNYVISWYQQKPGSPPGYLLWFKSDSEKHQASGVPSRFSGSKDASANAGLLLISGLMPEDEADYYCAT
Eidolon helvum V374 iglv AWHC01138521.1 4298 SWAEFVLTQPGSVSGSPGQKAIISCTRSSGSIGGYYVYWYQQRPGSAPITVIYDDNERPSGVLDRFSGSIDSSSNSAYLTISGLQPEDEADYYCQSYDRDSN
Eidolon helvum V381 trav AWHC01146153.1 1643 GAGAQSVTQPDRHVTVSEGTSLEIRCTYSTSTSPYLFWYMQYPNQGLQLLLKGISGATLVKGIKDFEAVFRKNEASFHLQKSSAHWSDSATYFCAVS
Eidolon helvum V382 trav AWHC01146154.1 36883 RTRGASVSQMGGQVTLSEGASLNVSCTYSASGYPSLFWYVQYPGECPQLLLKAQRANEKGRKKGFEATYHQEANSFHLEKASVQESDLSMYYCVLS
Eidolon helvum V383 trav AWHC01146154.1 31947 GVRGLEVQQSPSFLSLQEGTDSTLRCNFSAAVNNVQWFRQDPVGGLTSLFFLTSGMKTNGKLSSTMNFKERNSTLHITASQLEDSATYLCAGQ
Eidolon helvum V384 trav AWHC01146154.1 25174 VIRGEKVDQRPPTLSVREGDNSVITCTYSDSASEYFSWYKQEAGKGPQFIIHIRSNKMENQVGRFTVKLKKVDKQFSLSIEATQPGDSAVYFCAAS
Eidolon helvum V385 trav AWHC01146154.1 7665 VSSAYVLEQNPSFLSIQEREHAIINCTYQKKTLYNFLWFRQDPGKGLVSLTLTQSSPKEQADKAFKEQLGKEKFYSVLHIPASHIGDSATYFCAL
Eidolon helvum V397 igkv AWHC01163902.1 1828 SNGNIMLTQSPDLLSVSLGESASIVCTSNQSVSDYLTWYQQKLGQTPKILIYDADNRYSGVPDRFSGIQSRTKFILTISKIEPDDAASYFCQQDYTVP
Eidolon helvum V407 trav AWHC01174794.1 1885 MCFLIGTTGQGVRQPAELVAMEGASVQVNCMYQTFGFNGLSWYQQHDGRAPIFLSYNVLDGLEKKGHFFSFLSRSDTYSYLLLKELQMKDSASYLCAVR
Eidolon helvum V408 iglv AWHC01176235.1 22402 GISQAVVTQEASLSMTPGGTVTLTCGSSAGAVTTSNYASWIQQKPYQVPQGLIGGTSNRIPGVPARFSGSLTGGKATLTITGAQPEDEADYYCAL
Eidolon helvum V430 trgv AWHC01202348.1 8955 TQVSSNWKGRKMSVTRPTGLIAVFTCNGLQKSIDYIHWYQYQEGMALRHLFYYRFFSSKVVMEGGISSGKYHAYEGTGRSCTFVLRNLEESDSGVYYCAA
Eidolon helvum V434 iglv AWHC01210255.1 724 VNSQTVVTQEPSLSVSSEGTVTLTCGLSSGSVSTSNYPAWYQQTPGRSPRMLIYNTNSPASGIPGRFSGSISGNKAALTITGAQPEDEADYYCSV
Eidolon helvum V436 trav AWHC01216004.1 6533 TLSLAKTTQPIFIDSYEGQEVNISCDHTNIVTNEYIFWYRQFPNQGPQFLIRGYKTNTANELVSLFIPHDRKSSTLSLPCASLSDTAVYYCIVS
Eidolon helvum V437 trbv AWHC01216743.1 11434 SVFGAVLSQKPSRDICQHGTSMTIQCQADRPLNLMFWYHQLPGQSLTLIATVNQGSQTTYENGFTEDKFPVSRPNLTFSILTVSNLSPEDSSVYFCSAG
Eidolon helvum V438 trbv AWHC01216744.1 8047 PMEAKVTQNPRHLIAQTKKKLTVTCSRNMNHDAMYWYRQDPGLGLKLIYYSINTGIIDKGDVPDGYSVSRKKKENFPLTLESASTNQTSLYLCASSE
Eidolon helvum V439 trbv AWHC01216744.1 1414 LMDAGVTQAPKYLVTKVGEKVLINCSQNMGHDRMFWYRQDPGLGLRLLHSSYGMGSEEKGDLPDGYSISRKKKEVFSLILESARTNQTSVYLCASSE
Eidolon helvum V443 ighv AWHC01222664.1 334 VQCEVQLVESGGDLRQPGGTLRLSCQGSGFSFSDRYMSWIRQTPGESLQWIGFIRNKANGHTTEYAASVKGRFTISRDDSKSIAYLQMSSLRAEDTAVYYCAT
Eidolon helvum V453 ighv AWHC01235192.1 512 VLSQVQLVESGGDVVRPGGSLSLSCKASGFTFTNYTMNWVRQAPGKALEWVAGVSQPTGSSQWYAPSVQGRFTISRDNPTSTTSLKMTNLKSEDTAMYYCVR
Eidolon helvum V458 iglv AWHC01241366.1 1309 SVAQAGLTQPLSMTRSLGQTVTLTCTGNSNNVGNEGAAWLQQHPGRVPKVLADRNNNRPSGVSQRFSSSRSGSVSSLTISGLQAEDEADYYCSAWDSSLYA
Eidolon helvum V463 trav AWHC01247054.1 11146 VCSDDKVIQSPPSLVVHEGDNAILNCNYEVTNFQSLHWYKQEKKTPTFLFILISSGIDKHSGSSRGTLDKKERLSTLHITATQTRDSATYLCAVE
Eidolon helvum V468 trav AWHC01256532.1 1834 GARAQTVTQPDSHISVSEGASLELRCKYEYGATPYLFWYVQYPSEGLQLLLKYYSGNTMVKGDKDFVAEFRKDESSFNLQKHFAHWSDSAEYFCAVS
Eidolon helvum V481 ighv AWHC01276369.1 1551 VLSQVTLKESGPGLMRPTQTLTLTCSFSGFSLSTTYMGVGWVRQPPGKALEWLANIWWSDSKYYNPSLKSRLTISKDTSQNQVVLTMTSMDPADTATYYCARR
Eidolon helvum V482 trav AWHC01278410.1 479 GTCGDSVKQTEGSVTLLEAAFLTLKCTYQTSYTPYLFWYVQYQNKEPELLLKSSSDNQINIRGFQASLDKEDSSYHLKKPSVQMSDTAVYYCVLG
Eidolon helvum V483 trgv AWHC01279160.1 1464 VLGLSKVEQSQISISTEVKKSVNIYCKISSTNFKKDVIFWYWWKPNQALEYLIHVSSTKLPARSHKGGKNNKIEARKNSQILTSILTINFIEKEDAAIYHCAGW
Eidolon helvum V486 trdv AWHC01283765.1 878 FSMTQSVTQTQTTVTRREREAVTMDCTYETASGYYNYYYVLYWYKQPPSGEMVLLIYQYSSHSNAKEGRYSVNFQNEKKIISLTISSLQLADSAKYFCALN
Eidolon helvum V488 iglv AWHC01284311.1 1722 SWAQSALTQPSSVSGALGQTVTISCAGSSNNIGSYNYVSWYQQRSGTAPKLLIYSVNTRPSGIPDRFSGSKSGTTASLTISGLQPEDEADYYCCSYRSS
Eidolon helvum V489 trav AWHC01285424.1 1778 GVRGLEVEQSPSLSLQEGTNSTLKCSFSNMVTSMQWFRQNPGGGLTSLFHMSSGTKQNGRLSSTMNTKELYSTLFITASQVQDSATYLCAGQAQC