WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Cyprinodon nevadensis pectoralis JSUU00000000.1 (JSUU01) 42 15 0 6 6 14 0 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Cyprinodon nevadensis pectoralis V13 ighv JSUU01091294.1 329 VFCIDLIQPGSKVVQPGQSLTITCQLSGYSLTEAYATGWIRQREGKTLEWIFHKWGHTNNFYQNNALKNKFSYSRDTSAGTVTITGQNLQSEDTAVYYCVR
Cyprinodon nevadensis pectoralis V12 ighv JSUU01037662.1 12 VTCEQLNQPASMTVKPGEGLTITCQVSYSLSSSWTHWIRQAAGKGLEWISRDTDVKSSLKNKISVNLDRFINRVTLNAQNMQPEDAAVYYCARE
Cyprinodon nevadensis pectoralis V11 ighv JSUU01026202.1 7275 VMCEQLKQSASLTLQPGQQLTISCQVSYSVGSCHTHWIRHSRGKGLEWIGRAHVGSYLKVIAKTINKSYLKINFGFKSGSSSNTVSLNRQNMQPEDSAVYYCARQ
Cyprinodon nevadensis pectoralis V10 ighv JSUU01018102.1 1559 VRPDTLRQPPSASVLTGERLQITCQVSYSFSSYYTAWIRQPARKGLEWISRDTTVKDSLKSKFSVNLDESNSIVTLQGQNMQPEDSAVYYCARQ
Cyprinodon nevadensis pectoralis V9 trbv JSUU01017711.1 6911 ASDSKHVDQTPAFIIKNVDKSVDKEIRCSHSIPSYQVILWYKQDKHNTLKLLGYLNLNSLSIEEDVKGKISFNGDGRKQSNLTISNLTLSDDAVYFCAARL
Cyprinodon nevadensis pectoralis V8 trbv JSUU01016779.1 10746 SSLSDQVYQTPFYIEKNPGQNASINCSHSIRSYNRIFWYKKSEHRQLQFLGYTYQTSSNAELEVKVSIKGNAAEGDISTLTIKELTVSSHAVYFCAAS
Cyprinodon nevadensis pectoralis V7 igkv JSUU01010732.1 16659 SSGQITLTQPAAVRADLGGYVTISCRTSQNVGYSSPYHLLAWYQQKNGQLPKRLIYCATHRDSGTPSRFTGSGSISGVQAEDAAVYYCQSRDNVGSQWT
Cyprinodon nevadensis pectoralis V6 trbv JSUU01004224.1 41766 SSLSDQVHQSPADMFHKPGEKALINCSHSIEGYDQILWYKHSNNKHMQFLGYISAMTAFPEPGVKISGNANKNQNSTLTVEELDVNSSAVYFCAAR
Cyprinodon nevadensis pectoralis V5 trbv JSUU01004224.1 34577 SSLSDKVHQSADIFCKPADKPQISCSHDITDYTVILWYKQLENHRMQLLGYMNVGDGYPENGVKVTMNGRATEGETCTLTLEAVDLRSSGVYFCAA
Cyprinodon nevadensis pectoralis V4 trbv JSUU01004224.1 31874 SSPSDQIFQTPSDMFKNPTEQAQIFCSHSLKDYDRILWYKHSTLYPMQFLGYIMGESGTPEKGANVTIEGNANKDKNCTLTISNLNQTSSAVYFCAAR
Cyprinodon nevadensis pectoralis V3 trbv JSUU01004224.1 27136 SSLSDKVHQTPYHIITYPEDSPSITCSHSIQSYNVILWYKRSEDGQLQLLHMFKSNKNPEPGVNVEMDGNADKDQSCTLTIKELTMSSSAVYFCAAS
Cyprinodon nevadensis pectoralis V2 igkv JSUU01004224.1 17325 FSLSKNVHQEPPSILEVSGNPATINCSHSISGYYVILWYQKPIGDSILKLIGYISNQSPKLEDEFKDHFILRGDGSKESWLHIEKLQPEDSSMYYCAASTQ
Cyprinodon nevadensis pectoralis V1 trbv JSUU01001133.1 74909 FTTGSDVTQTPFLWKNMGENATIDCSHTKGDLYFQMYWYRQLPGETMKLVVFTTTGQIKHDFGSFSEEKFSTTKTVAKSGTFTVKNLEPQDEGVYFCAV
Cyprinodon nevadensis pectoralis V0 trbv JSUU01001133.1 72845 AADSKQVDQTPPFIIKEPGQSVDGEIICSHNIPNYEVILWYKQDQHKALKLLGYINLRYPSVEEDVKRKINFNGDGSKQSSLNISDLTLSDNAVYFCAAKR
Cyprinodon nevadensis pectoralis V40 ighv JSUU01033273.1 5648 VWSEIRLDQSASVVKRPGETVKMSCVLSGYSLTSRDISWIRQRPGRALEWIGYMSTGSNRPSYASSFQSRFTMTEDGSSSNQYLEISSLTAEDSAVYFCARE
Cyprinodon nevadensis pectoralis V39 trbv JSUU01031529.1 9949 WSEIRLVQSASLEKSPGDTVKISCVTSGFKMTDNYMHWIRQRPGRALEWIGRMDTGKSSAIYGSSFQGRFTMTENVPSSTQYIEIRSLTAEDSAVYFCARE
Cyprinodon nevadensis pectoralis V38 ighv JSUU01031529.1 12759 VRCEQLTQPSSISVQPDQRLTISCQVSYSMSTYATHWIRQPTGKGLEWIGYTCTGCTPVYKNSLKNKFSFTLESSSNTVTLHGQNVQPEDSAVYYCARE
Cyprinodon nevadensis pectoralis V37 trbv JSUU01027288.1 7008 LSDGSDVNQTPLLWVNESQPANLSCNHTKDINHNQMYWYQQLPGENMKQIVFTTAYSSHQYEEGFNKEKFPAEKKDAQTGSLTVKNAQPEDSGVYFCAVS
Cyprinodon nevadensis pectoralis V36 trbv JSUU01027288.1 13558 LSDGSDVNQTPLLWVIEGQSANMSCSHTKDHGFDQMYWYQQLPGQNMKQIVFTTAYRAHQYGQGFSEETFPAEKKDAQTGSLKVKNPQPEDSGMYFCAVS
Cyprinodon nevadensis pectoralis V35 ighv JSUU01020537.1 9136 VKCEQLTQPASMSVQPGQTLTISCQVSYSVTSYGTNWIRQPTGKALEWMGAIWYDGSNSYGSSFQGRIEITRDTNKNIVNLRLSTMKPEDPGVYYCA
Cyprinodon nevadensis pectoralis V34 ighv JSUU01020537.1 10858 VRPDTLRQPPSASVLTGERLEISCEVPYSLRIYNVVWIRQPAGKGLEWFSFNSNFSVIRVTVIDSTESLQGQNMQPEDSAVYYCAGTHS
Cyprinodon nevadensis pectoralis V33 trav JSUU01015164.1 2336 AVNIHQPTSELVRDGEQSVTLKCEQDSDQIYYMYWYRQASSGEMELVAYSASKDASSIEAPFNNSKYTMTRRELRRTELQIHPAEAKDSAVYYCAS
Cyprinodon nevadensis pectoralis V32 trav JSUU01015164.1 3968 VLQSEDLISPPAVDVTLECKMGEGYSMSSQTMLWYRQKGHGAQMEFILKEYEESVGNYRSSLKTSENLFTLQILKLSVNDSSIYYCAA
Cyprinodon nevadensis pectoralis V30 ighv JSUU01012400.1 12465 IHGQILRESEPVVKSPGSSHKLTCTTSGISFSSYWMAWIRQAPGKALEWIAIIEYDNARIFYAQSVQGRFTISRDNSKEQLYLQMNSLKTEDSAVYYCARR
Cyprinodon nevadensis pectoralis V29 trdv JSUU01012400.1 20675 AEGQSLTSSEDVVQRAGQSATLSCKVQGIALAWLHWIRQKPGKGLEWIGRIDSGTGTIFSQNLQGQFSISKDTSLNTVSLTIKSLKTEDTAVYFCAREPQ
Cyprinodon nevadensis pectoralis V28 ighv JSUU01012400.1 23713 VDGQTLSQSEPILKRPGESHKLTCIASGFTLSSYWMGWVRQAPGDGLEWIAADTGGSTNYYSQTVQGRFTVSRENNRQQLYLHMSSLKTEDSAVYYCARF
Cyprinodon nevadensis pectoralis V27 ighv JSUU01012400.1 38837 VVGQTLTQSEPVILRPGESHKLTCTASGFTFGDYWMHWIRQPPGKGLEWVAAISYWAGTDKRYSQLIQGRFTISRDNGKQQVFLQMNSLKLEDSAVYYCARG
Cyprinodon nevadensis pectoralis V26 trav JSUU01012400.1 43277 VFAQTLIESESVIKKPGESHRLTCTGSGLTVSSIFFSWIRQAPGKGLEWIAWHDSGSGTRRFYSQSVQGRFTISRDDSRNQLILQMNSLRVEDSAVYYCARE
Cyprinodon nevadensis pectoralis V25 ighv JSUU01012400.1 46758 VRAKQLTQPVSLIVQPGESLTITCQVSYPLTISRTHWIRQPVGKELVWLCSAHIGHATHYKESVKKKFRIDMEPSSKQVTLTGQNMQPEDTAVYYCASE
Cyprinodon nevadensis pectoralis V24 ighv JSUU01012400.1 50224 VSGQTLTESEPAVKKPGESHRLTCTGSGFTFSSYPMNWVRQAPGKGLEWIAFVHTGSSHFFYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARR
Cyprinodon nevadensis pectoralis V23 ighv JSUU01012334.1 5749 VSCETLTQPASLTVQPGQRLTVRCQVSYELSYYTAWIRQAAGKGLEWIGMEDSYGNSYYKDSLKNKFSINLDTSRKTVTLNGENMQPEDTAVYYCARR
Cyprinodon nevadensis pectoralis V22 ighv JSUU01009980.1 3324 AHCQTLTESESVVKRPGESHQLTCRASGFTFSNHWMAWIRQAPGKGLEWISYINPGGSGAWYPDSVRGQFTISRDNSKQQLYLQMNSLRTEDSAVYYCARE
Cyprinodon nevadensis pectoralis V21 igkv JSUU01009889.1 20716 SRGQVTVTQPAAVSADLGRSVTINCRTSQKVLFYKPYHYLAWYQQKNGQIPKLLIMVSSLRASGTPSRFTGSGSNSDFTLTISGALAEDSAVYYCKS
Cyprinodon nevadensis pectoralis V20 igkv JSUU01006765.1 75266 SDGQNIVLSQPAAKSVQLGQIVTIECKTSVQPQGCTPPCLSWYQKKAGEAPKALIYLTSSRLSGISSRFAGSGPGSGMDFSLTISGVQAEDAGVYYCLS
Cyprinodon nevadensis pectoralis V19 igkv JSUU01006765.1 75266 SDGQNIVLSQPAAKSVQLGQIVTIECKTSVQPQGCTPPCLSWYQKKAGEAPKALIYLTSSRLSGISSRFAGSGPGSGMDFSLTISGVQAEDAGVYYCLS
Cyprinodon nevadensis pectoralis V18 igkv JSUU01006765.1 75266 SDGQNIVLSQPAAKSVQLGQIVTIECKTSVQPQGCTPPCLSWYQKKAGEAPKALIYLTSSRLSGISSRFAGSGPGSGMDFSLTISGVQAEDAGVYYCLS
Cyprinodon nevadensis pectoralis V17 trbv JSUU01004695.1 18318 QAKSVKFQQTSSKIVNISETVNFHCSHNDSSLNVMLWYQQTKTGIMNLIGYSYVGSEAVYEKQFESSFKITRNVTQTGGLNIKSVKESDTAVYFCAGS
Cyprinodon nevadensis pectoralis V16 trbv JSUU01004695.1 20125 VSESVLIFQWPRNIYSTVDEHAEINCYQNDTDYEYLYWYRQLRDGEIQLIVYLLAGNAKFETDFNSGYKAEVRQKKQWSLTISSPQKKDEAVYLCAAS
Cyprinodon nevadensis pectoralis V15 trbv JSUU01004695.1 32415 ICLSIEVHQSPPAALGELGQSIQLVCSHEKTDYMLMQWYQKYPGDLALIRIGHVYYSSIEHEGPFKEHFNITGDMSGETAKNGSLFILDLKTEHTAVYFCAASY
Cyprinodon nevadensis pectoralis V14 trav JSUU01000222.1 2455 QTVTDKISPGSAEVSGTEGQPVSLFCEYLTGSRLPFLHWFRQHPGFNPPKFLLFKGARNESQKEYILDDHYKSFTNHTWTELRIESPSVADSALYYCALG
Cyprinodon nevadensis pectoralis V41 trav JSUU01091970.1 38 VDGQTLTESEPVGKGLGDSHRLTCTTNGLSFSSSWMHWIRQAPGKGLEWVSCITADSTKFYSLSVQGRFTISRDNSKQQLYLQMNNLNTDDSAVYYCVHD
Cyprinodon nevadensis pectoralis V31 trav JSUU01013661.1 4270 VSCKQATMVTNQESSSEGSSVTLSCNYRKGAADYFFWYRQLPGKQPEFLIFITDFEEKQKDSLSRLSGKVRKNEAQMDLLISSAEVTDSALYYCAVR