WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Cyprinodon variegatus JPKM00000000.1 (JPKM01) 185 72 2 38 39 32 1 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Cyprinodon variegatus V8 igkv JPKM01019413.1 5497 SSGQVTIIQTPGSQSVVPGQTVSIKCKVNPSTGNCLSWYLQKQGDAPKLLIACGSSRQSGVPDRFSGTRSGSDYTLTINGVQAEDAAAYYCQTYYYINSQYV
Cyprinodon variegatus V7 igkv JPKM01017838.1 1158 KSVQLGQTVTIDCKVSQALSTSQCSHNSQVCLSWYQQKPGEATKALIYATASRFSGISSRFTGSGAGNNKDFTLTISGVQAEDAGIYYCQS
Cyprinodon variegatus V6 igkv JPKM01017837.1 180 KSVQLGQTVTIDCKASQALLISQCHHNSQVCLSWYQQKPGEAPKALIYGKSSRFSGISSRFTGSGAGNEIDFTLTISGVQAEDAGVYYCQS
Cyprinodon variegatus V5 igkv JPKM01017836.1 888 SDGQNVVVTQPAAKSVQLGQTVTIDCKVNRQVAQYSGSQYFLAWYHQKPGEAPKALIYVTSDRLSGISSRFTGSGAGNGIDFTLTITGVQAEDAGVYYCQS
Cyprinodon variegatus V4 igkv JPKM01017834.1 629 SDGQNVVVTQPAAKSVQLGQTVTIDCKANRVVDCSPPCLSWYQQKAGEAPKALIYLTSSRFSGISSRFTGNGARNEKDFTLTISGVQAEDAGVYYCQS
Cyprinodon variegatus V3 igkv JPKM01017830.1 1084 SDGQNVVVTQPAAKSVQLGQAVTIDCKANRVVYCSTPCLSWYHQKDGEAPKALIYQTSSRFSGISSRFSGSGAGNGIDFTLTISGVQAEDAGVYYCQS
Cyprinodon variegatus V2 igkv JPKM01017826.1 861 SDGQNIVVTQPTAKSVQLGQTVTIDCKVNEQVYHYSGSKYLLAWYHQKTREATKALIERTSDRFSGISSRFTGSGAGNGIDFTLTISEFQAEDAGVYYCQS
Cyprinodon variegatus V1 igkv JPKM01017823.1 1408 SDGQNVVVTQPAAKSVQLGQTVTIDCKVNRVVAQYSGSQYYLAWYHQKTGEATKALFYRTSDRFSGISSRFTGSGAGNGIDFTLTISGFQAGDAGVYYCQS
Cyprinodon variegatus V0 igkv JPKM01017822.1 3359 KSVQLGQTVTIECKASQALSTSDCRISNLPCLSWYQQKPREATKALIYGTSAKYSGISSRFTGSGAGNNKDFTLTISGVQAEDAGVYYCQS
Cyprinodon variegatus V45 trbv JPKM01070424.1 50633 SSLSDKVHQSADIFCKPADKPQISCRHDIQDYTVILWYKQLEDHRMQLLGYMNVGDGYPENGVKVTMNGRATEGETCTLTLEGVDLSSSGVYFCAA
Cyprinodon variegatus V44 trbv JPKM01070424.1 48650 SSLNDKVLQTPLNIQANSGKTVNISCSHSIQNYDTILWYKRSEDRQLQLLGYYYLSKSYPEPGVIVEMKGGAEKGENCTLIIKELSVSSSAVYFCAARYHSAA
Cyprinodon variegatus V43 trbv JPKM01070424.1 47951 SSPSDQIFQTPSDMFKNPTEQAQIFCSHSLKDYDRILWYKHSTLHPMQFLGYIMGESGTPEKGANVTIEGNANKDKNCTLTISNLNQTSSAVYFCAAR
Cyprinodon variegatus V42 trbv JPKM01070424.1 43101 SSLSDKVHQTPYHIITHPEDSPSIRCSHSIQSYNVILWYKRSEDGQLQLLGHMFKSNKNPEPGVNVEMDGNADKDQICTLTIKELTMSSSAVYFCAAS
Cyprinodon variegatus V41 trbv JPKM01070424.1 38119 SSLSDQVHQTPYHILAKPGDSPSIRCSHSIQSYDVILWYKRSEDGQLQLLGYMYKENKNPEPGVKVEMDGNADKDQSCTLTIKELTMSSSAVYFCAAS
Cyprinodon variegatus V40 trbv JPKM01070424.1 36681 PSINSVHQNPANVIKGPGESVDLNCKHSNTNFDMIQWYKQPPGKTDMTLLGYTRYTSNVVEDQFKSLYNVTGNGQSHSSFVILKLRQPEDSAVYFCAASD
Cyprinodon variegatus V39 igkv JPKM01070424.1 35959 FSLSKNVHQEPPSMLEVSGNPATINCSHSISGYYVILWYQKPIGDSILKLIGYISNQSPKLEDEFKDHFILRGDGSKESGLHIEKLQPEDSSMYYCAASTQ
Cyprinodon variegatus V38 trav JPKM01070424.1 34627 FSLSKDVHQDPPSIFGSLHSPATIKCNHSISIYNTILWYQKPVSDSALKLIGYVFYTDVVLEKEIKNRFNVSGDGSKYSNLVIEELQPDDSSTYYCAASAQ
Cyprinodon variegatus V37 trav JPKM01070424.1 31350 SSVLQNPAVVMKGQGESVNLNCNHSNTNFNMIQWYKQPPGKTDMTLLGYTRLTSNVVEDQFKSLYNVTGNGQSHSSFVILKLRQPEDSAVYFCAASD
Cyprinodon variegatus V36 ighv JPKM01070424.1 14320 LSLSKEVHQDPPSIMKNPDNPATINCSHSITSYDTTLWYQKRTGDSALKLIGYIQYSNDVLEKEFKGHFNFTGDGSKSSKLHVEKLKAEDSGIYYCAAS
Cyprinodon variegatus V35 trbv JPKM01070423.1 41 VSESVLISQWPRNIYSTVDEPAEINCYQNDTDYEYLYWYRQLRGGEIQLIVYLLAGNAKFETDFNSGYKAEVRQKKQWSLTISSPQKKDEAVYLCAAS
Cyprinodon variegatus V34 trav JPKM01070420.1 21976 ICLSIEVHQSPPAALRELGQSIQLVCSHEKTDYMLMQWYQKYPGDLALNRIGHVYYSSIEHEGPFKEHFNITGDMSGETAKNGSLFILDLKTEHTAVYYCAASY
Cyprinodon variegatus V33 trbv JPKM01070420.1 21000 TSYSERVHQTPSDLHKEIEQTVKISCLHNIKNCDQILWYKQIKNKELEFLGRMLANIGYPEKGATMRIDGNANKGQTCTLTIERLRLNSSAVYFCAAS
Cyprinodon variegatus V32 trbv JPKM01070420.1 19096 SSKSNKIQQYPEELHKFPSQNAEINCSHTDDSFNRILWYKQSTNDLQLLGYLYGGTGTPEKDVNVKIKGEATKGRNCTLIIEGLNISSSAVYFCAAS
Cyprinodon variegatus V31 trbv JPKM01070420.1 14101 ASEAYKIFQTPHTIIKKPAESVLNEIHCSHSVPAFEHTLWFKQNKHGAFRFLGYLNRDFLFPEDDVKDRISFVGDGSKHSTLNIGNLSEDDSAVYFCAAS
Cyprinodon variegatus V30 trbv JPKM01070420.1 12877 ASDSKHVSQTPAFMIKTVGKSVDGDIKCSHSIPSYQVILWYKQDKRNALKLLGYLNNDFHKIEDDVKRKIKFDGDGKNQSSLTISDLTLDDCAVYFCAASL
Cyprinodon variegatus V29 trbv JPKM01070420.1 7858 ASDSKHVDQTPAFLFKIVGESVDKEIGCSHSIPSYRIILWYKQDKHNNMKLLGYLDNETPRVEEDVKGKINFNGDGRQQSKLNISDLTLSDNAVYFCAASL
Cyprinodon variegatus V28 trbv JPKM01070419.1 343 ASDSKHVDQTPASIIKNVDESVDKEIRCSHSIPSYQVILWYKQDKHNTLKLLGYLNLNSLSIEEDVKGKISFNGDGRKQSNLTIANLTLSDNAMYFCAASL
Cyprinodon variegatus V27 igkv JPKM01062626.1 112 LAAMATQLSQEDLTLTRRVGQNVSFSCGGTDQCGPTHVTWYQKNATETFRPILYITSDGSTEKRFNHSQQNDFSAERNQKSCTLKLNHVKVDHSASYYCGCRNPG
Cyprinodon variegatus V26 ighv JPKM01062331.1 3537 VYCQSLTESEPVVKRPGESHRLTCTASGFTFSSYYMVWIRQAPGKGLEWLAMIKSDGTSTWYSQSVQGRFTISRDNSKQQVYLQMNSLRTEDSAVYYCARR
Cyprinodon variegatus V25 ighv JPKM01027354.1 1828 SEPVVKRPGESHRLTCTACGFTFSSHNMDWIRQAPGKGLEWVAEIRNDGAIAWYSQSVQGRFTISRDKSKQQVYLQMNSLRTEDSALYYCARQ
Cyprinodon variegatus V23 trav JPKM01023022.1 155 SRGQVTVTQPAAVRADLGGSVTIRCRTNHNVYVYNSKHISAWYQQKDGQPLKRLMHAANSRDSWTPSYFTGSGSNSDFTLTINGVQVEDAAVYYCQTFHSMNSKDL
Cyprinodon variegatus V22 trav JPKM01023021.1 2500 SRGQVTVTQPAALRADLGGSVTINCRTSQKVLYHKPYHYLAWYQQKNGKIPKVLIMVSSLRASGTPSRFTGSGSNSDFTLTISGALAEDSAVYYCKS
Cyprinodon variegatus V21 trav JPKM01023020.1 2194 SRGQVTVTQPALLRADLGGSVTINCRTSQKVLFYKPYHYLAWYQQKNGQIPKLLIMVSSLRASGTPSRFTGSGSNSDCTLTISGALAEDSAVYYCKS
Cyprinodon variegatus V20 trav JPKM01023018.1 2403 SRGQVTVTQSAAVRADLGGSVSISCRTSHNVHGSNYLAWYQQKDGQTPKRLIYGASSRDSWTPNRFTGSGSNSDFTLTISGAQAEDAAVYFCQGQNNINSQWV
Cyprinodon variegatus V19 igkv JPKM01023016.1 3678 SRGQVTLTQPAAVRADLGGSVSISCRTSQNVHVSSSYHLLAWYKQQEGQTYKLLIYYTSSRASGTPSRFTGSGSNSDFTLTITGVQAEDAAVYYCQSENFVNSQYV
Cyprinodon variegatus V18 igkv JPKM01023015.1 6360 QVTVTQPAAVRADLGGSVSISCRTSQNVFKNQYLAWYQQQNEKDLNRLIYAASSRDSWTPGRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Cyprinodon variegatus V17 igkv JPKM01023015.1 3406 SSADIILTQTPGAQAVVPGQTVSIKCKASSGVSNDVQWYLQKSRDAPKLLIYNAYSRQSGVSDRFSGSYSGTDFTLTISRFQAEDVGVYYCQQDSSLP
Cyprinodon variegatus V16 igkv JPKM01023014.1 1869 QVKVNQPLAVRADLGGSVSISCRTSQTVHGSVHLAWYQQKDGGTPKLLFYYVGNRVSGTPNRFKEGGSNSDFTLTISGVQAEDAAVYYCQSVHVINS
Cyprinodon variegatus V15 igkv JPKM01023012.1 2356 SRGQVTVNQPLAVRADLGGTVSISCRTSQTVHGSNHLAWYQQKDGGTPKLLFYYVGSRVSGTPNRFKDGGSNSDFTLTISGVQAEDAAVYYCQSLHVINSQYV
Cyprinodon variegatus V14 igkv JPKM01019429.1 219 SSGQVTITQTPGSQSVVPGQTVSIKCKVNPSTSYCFYWYLQKQGNAPKLLITCGSTRQSGVPDRFSGSGSGSDYTLTINGVQAEDAGVYYCQSFHSINSQRV
Cyprinodon variegatus V13 trav JPKM01019427.1 121 SKIQPTVTQPAAVSSLIGGTVTIRCRTSHNVYVSNHLSWYQQKGGEVPKLLVYTSSTRESGAPSRFTGSGSNSDFTLTISGVQAEDAAVYFCNGEFHL
Cyprinodon variegatus V12 igkv JPKM01019425.1 14510 SSGQVTITQTPGSQSVVPGQTVSIKCKVNLSWIHCLSWYLQKPRDAPKLIIKCRNNRQSGVPDRFSGSGSGSDFTLTISGVQAEDAAVYYCLSGHVISSQWV
Cyprinodon variegatus V11 igkv JPKM01019424.1 495 SSVDIIVTQTPGSQSVVLGQTVSISCKTSSSVGTCFSWYLQKDGESSKLLIYYASSRQSGIPSRFSGSGSGTAFTLTISGVQAEDGGVYYCQQCNYSP
Cyprinodon variegatus V10 igkv JPKM01019420.1 217 SSGQVTITQTPGSQSVVPGQTVSITCEVNPSTGYCFQWYLQKQGDAPKLLIRCGSSRQSGVPDRFSGSGSGSDYTLTISGVQVEDTGVYYCQSLHSINSQYV
Cyprinodon variegatus V9 igkv JPKM01019415.1 11616 SDGQNVVVTQPAAKSVQLGQTVAIDCKANRVVACSTPCLSWYHQKDGEAPKALIYQTSSRFSGISSRFTGSGAGNNKDFTLTISGVQAEDAGVYYCQS
Cyprinodon variegatus V83 ighv JPKM01055550.1 1442 VKSEQLTQPASLTLQPGQHLTMDCQVSYSLSSFPTAWIRQPSGKGLEWIGRAGEGWSTIYKDSLKNKFSISFVSSSKTVTLKGQNMQPEDSAVYYCARERHC
Cyprinodon variegatus V82 igkv JPKM01045219.1 964 GSPSVTQSPAVKSASLGETVSLSCTASSGVGRDLSWYLQKPGEPPKLLFYKISSRESAPSHFSSSGSEPQFTLTISGVQAEDAGDYYCMGLYSGPV
Cyprinodon variegatus V81 trav JPKM01043937.1 6393 QTESVLQPDGDVTAAAGETATLRCLYNTSSSNHYLFWYRQKGSSSPQFILSRFKVGEGKTEETERFSSSLDATARSVPLQIHNLRLSDSAVYYCALQPTVTG
Cyprinodon variegatus V80 igkv JPKM01023016.1 13714 QVTVTQPATLRADLGGSVTISCRTGQNVYVYSNNHYLAWYQKKDGQPPKQLINRAKYRDSETPSRFSGGGSHSDFTLTISGVQAEDAAVYYCQSYDDYL
Cyprinodon variegatus V79 trav JPKM01020119.1 81 VSCKQATMVTNQESSSEGSSVSLSCSYRKGAADYFFWYRQFPGKQPEFLIFITDFEEKRKDSLSRLSGKVRKNEAQMDLLISSAAVTDSALYYCAVR
Cyprinodon variegatus V78 trav JPKM01013548.1 3193 VSGVTVVTQKPSVLTVRKGETATMDCNLGTVTDSSARWYRQIPGGVPLYMLRFRHSYSSPQYDTGFPSARHTSTHQSTTDYRLIISNVEKGDSAVYYC
Cyprinodon variegatus V77 trav JPKM01013548.1 14322 VSGVTVVTQKPSVLTVRKGETATMDCNLGTVTDSSARWYRQIPGGVPLYMLRFYHGWSSPRYETGFPSARHISTHQSTSDYRLIISNVEKGDSAVYY
Cyprinodon variegatus V76 trbv JPKM01110490.1 246 VWSEIKLDQSASVVKRPGETVKMSCVISGYRMTIYNIDWIRQRPGRALEWIGYMSPSRIVYEGSPSTRYLSISSLTAEDSAVYFCVRHPQ
Cyprinodon variegatus V75 ighv JPKM01105376.1 952 TDGQTLTESEPVGRRPGESHRLTCTYSGFSSDPSIGWIRQAAGKGLEWIAYISSGGSIYYSDSVRNRFTISRENSRNEVYLQMNSLTAGDSAVYYCAR
Cyprinodon variegatus V74 ighv JPKM01102795.1 27 VRRETLRQPPSASVLTGERLQITCQVSYSLSSYYTAWIRQPAGKRLEWISRDTTVKDSLKSKFSVNLDISNSIVTLQGQNMQPEDSAVYYCARQ
Cyprinodon variegatus V73 ighv JPKM01099775.1 2944 ADGQTLTESEPALKRPGDSHKLTCTTSGFTLRSYYMAWIRQAPGKGLEWIAYIGPSSSPIHYSQSVQGRFIISRDDSSSKIYLQMNQLKTEDTAVYYCVRE
Cyprinodon variegatus V72 igkv JPKM01099377.1 1222 SSGDIILTQTPGSQSVVLGQTVSISCKTSSSAGSCLIWYLQKDGESPKLLIYSASSCQSGIPGSFSGSGSGTAFTLTISGVQAEDGGVYYCQQVKSLP
Cyprinodon variegatus V71 trav JPKM01095910.1 55 MGSMNTIKQEQREQAVSEGRSTSLSCEYTGSINNIQWYRQQQGSRPEFLLYITEAGEIHPVRSDFSAKINKMTKQVDLLISSAAMADSAVYYCALQY
Cyprinodon variegatus V70 ighv JPKM01088107.1 17142 VKCEQLTQPASKTLQPGQRLTINCQVSYDFSSYWTAWIRQPAGKGLEWIGWKYAGGSNYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCARY
Cyprinodon variegatus V69 ighv JPKM01088107.1 9710 VKSEQLTQPASLTVQPGQRLTIDCQVSYSLSSLPTAWIRQPSGKGLEWIGRAGGGWSTIYKDSLKNKFSISFVTSSKTVTLKGQNMQPGDSAVYYCARDTV
Cyprinodon variegatus V68 ighv JPKM01088107.1 6597 VKCEQLTQPASKTVQPGQSLTINCQVSYGLSSYATAWIRQHSGKGLEWIGWKHTGGSSYKDSLKSKFSIDLDTSGKIVTLNGQNMQPEDSAVYYCAR
Cyprinodon variegatus V67 trbv JPKM01086516.1 513 SSQNDKVQQDPSEMVKTPSDNEAEIHCSHKDDSYNQILWYRQSNGDLQLLGYMYAGKATLEKDVNVEINGNANKNDICKLKIKDLNIKSSAMYFCAAR
Cyprinodon variegatus V66 trbv JPKM01086515.1 10875 FTTGSDVTQTPFLWKNMGENATIDCSHTKGDLYFQMYWYRQLPGETMKLIVFTTKGQIKHDFGSFSEEKFSATKTVAESGTFTVKNLEPQDEGVYFCAV
Cyprinodon variegatus V65 trbv JPKM01086515.1 8756 AADSKQVDQTPPFIIKEPGQSVDGEIICSHNIPNYEVILWYKQDQHKALKLLGYINLRYPSVEEDVKRKINFNGDGSKQSSLNISDLTLSDNAVYFCAAKR
Cyprinodon variegatus V64 trav JPKM01081643.1 334 VSGVTVVTQKPSVLTVRKGETATMDCNLGTVTDSGPRWYRQIPGGVPLYMLRFYHGWSSPRYDTGFPSARHTSTHQSTSDYRLIISNVEKGDAAVYYC
Cyprinodon variegatus V63 ighv JPKM01079466.1 1281 VKCEQLTQPAAMSVQPGQSLTVDCKVSYDLGYATHWIRQPAGKGLEWIGYTCRGCTPIYKDSLKNKFRFTVDSSSKTVTLNGQNLQPEDSAVYYCARQ
Cyprinodon variegatus V62 igkv JPKM01072561.1 6570 SRGQVTVNQPLAVRADLGGTVTISCRTSQNVYSSSYLAWYQQKDGQTPKRLIHAASSRDSSTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHVINSQYV
Cyprinodon variegatus V61 igkv JPKM01072558.1 42 SRGQVTVTQPAAVRADLGGSFTINCRTSQNVYGSNLLAWYQQKNGGTPKLLFYNVGNRVSGTPNRFKDGGSNSDFTLTVSEVQVEDAAVYYCQSSHLINSQWV
Cyprinodon variegatus V60 igkv JPKM01072555.1 17 QVTVTQPAAVRADLGGSVTINCRTSQNVHNSNHLAWYQQKDGGTPKLLFYHVGNRVSGTPNRFKDGGSNSDFTLTISGVQAEDAAVYYCQS
Cyprinodon variegatus V59 igkv JPKM01072552.1 52 QVTVNQPAAVRADLGSSVTIKCRTSQNVHGSTYLAWYQQKDEQSPKRLIYAASTRDSWTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSEHYINSQYL
Cyprinodon variegatus V58 igkv JPKM01072548.1 2449 QVTVTQPAAVRAELGGSVTIRCRTSQNVHVYNSNRYLAWYQQKDGQTPKLLIYIVSSRASGIPSHFTGSGSNSDFALTISGVQAEDAAVYYCQSTHVISNQVV
Cyprinodon variegatus V56 trav JPKM01072544.1 8024 SRGQVTVTQPAAVRADLGGSVTIKCRTSHEVFSSNRLAWYQQKDGQTPKFLIYYISTRGSGTPSRFTGSGSKSDFILTISEVKAEDAAVYYCKS
Cyprinodon variegatus V55 trgv JPKM01070435.1 14 LAAMATQLSQEDLTLTRAKGGNVSFSCGGTDQCASGYVYWYQKKKPETFKLILRFRTTNSEIKKGYKHPLEGDFSAERKQNECSLKIEKIKLDHEASYYCGCEKSV
Cyprinodon variegatus V54 trav JPKM01070429.1 19360 AVNIHQPPSELVRDGEQSVTLKCEQDSDQIYYMYWYRQASSGEMELVAYSASKDASSIEAPFNNSKYTMTRRELRRTELQIHPAEAKDSAVYYCAS
Cyprinodon variegatus V53 trbv JPKM01070429.1 4123 SSLSDQVYQTPFYIAANPGQNASINCSHSIRSYNRIFWYKKSEHRQLQFLGYTYQTTSNAELGVNVSIKGNAAEGDISTLTIKELTVSSSAVYFCAAS
Cyprinodon variegatus V52 trbv JPKM01070427.1 10389 CLGGSDVTQTPMLWKSVGEDATMECKHTKGAGYFQMYWYRQLPGETMKLVVFTTTATANHDFGDFNKDKFSANKTKAEIGSFRVKKLQPEDKGLYFCAVSQHSDT
Cyprinodon variegatus V51 trav JPKM01070425.1 15687 LEVHQSNSDLIKEAGDKVLIFCTHEKTDYRVMLWYQKSPGETAMKLIGYLNYGTPSIEESYQKDFNISGDLSGNTAKNASLIIQTVDQSHTAVYYCAARY
Cyprinodon variegatus V50 trav JPKM01070425.1 11402 LSLGLEVHQSHSDLIKQVRDKVQISCSHGKTDYTLMLWYQKSPGDTAMKLIGYLNYGTPSIEESYQKDFNMSGDLSGSTAKNASLIIQTVDQSHTAVYYCAASY
Cyprinodon variegatus V49 trbv JPKM01070425.1 6659 FSLSDQVHQDPPELFCMTEDKPRINCKHEIQDYNRILWYKQSKDHRMQFLGYMNVKDSYPENGVKVTITGKATKGETCTLTLEGVDLSSSGVYFCAASHHSAA
Cyprinodon variegatus V48 trbv JPKM01070425.1 4451 SSLSDQVHQSPADMFHKPGEKALINCLHSIEGYDQILWYKHSNNKHMQFLGYISAMTAFPEPGVKISGNANKNQNSTLTVEELVVNSSAVYFCAAR
Cyprinodon variegatus V47 trbv JPKM01070425.1 1362 SSLSSQIFQNPNEIVQRNGEMTQINCSHSIQSYDQILWYKRTENQMQLLGYMLRKSPFLEKGLNVEMTGGANKDENCTLTIKHPTVNSSAVYFCAARYHSAT
Cyprinodon variegatus V121 igkv JPKM01072548.1 5069 SDGQNIVLSQPEAKSVQLGQSVTIECKTSVQPQGCTPPCLSWYQKKAGEAPKALIYLTSSRFLGISSRFTGSGPGSGMDFSLTISGVQAEDAGVYYCLS
Cyprinodon variegatus V120 igkv JPKM01072548.1 5069 SDGQNIVLSQPEAKSVQLGQSVTIECKTSVQPQGCTPPCLSWYQKKAGEAPKALIYLTSSRFLGISSRFTGSGPGSGMDFSLTISGVQAEDAGVYYCLS
Cyprinodon variegatus V119 igkv JPKM01072548.1 7950 SDGQTVALTQPTAKSVQPGQTVTINCKASSIVGQNSVSQYYLGWYQEKNEKAHKALISRTTIRYSGISSRFTGAGNGIDFSLTISGVQAEDAGVYYCQS
Cyprinodon variegatus V118 igkv JPKM01072548.1 7950 SDGQTVALTQPTAKSVQPGQTVTINCKASSIVGQNSVSQYYLGWYQEKNEKAHKALISRTTIRYSGISSRFTGAGNGIDFSLTISGVQAEDAGVYYCQS
Cyprinodon variegatus V117 ighv JPKM01057131.1 1762 AKCEQLKQPASMTVQPGQPLVISCQVSYSVNSYWTHWIRQPSGKGLDWIGRAVGSSTDYKTSLRNKFSISTDSSSNTVTLNGQNVQPEDSAVYYCARQ
Cyprinodon variegatus V116 ighv JPKM01057131.1 5308 VKCIELTQPASMSVQPGQALTISCQVSYSVTGYNTAWIRQPTGKALEWMGIIWYDGSNSYGSRFQGRIEITRDTNKNIVNLRLSTMKPEDSAVYYCARE
Cyprinodon variegatus V115 trav JPKM01057131.1 9912 AKSEQLTQPASMSVQPGQTLTISCQVSYSVSNYYTAWIRQSLGKGLEWIGQAADGYKTYYKDSLQSKFSISTDSSSNTVVLNGQNIQPEDSAVYYCARVT
Cyprinodon variegatus V114 ighv JPKM01057129.1 133 VKCEQLTQPASMFVQPGQTLTISCQVSYSVTSYGTAWIRQPTGKALEWMGVIWSGGSNDYASRFQGRIEITRDTNKNIVNLRLSSMKPEDSAVYYCARE
Cyprinodon variegatus V113 ighv JPKM01057127.1 479 VKSEQLTQPASVALKPSQPLTISCQVSYSVSSFWTAWIRQSAGKALEWIGDANGISADYKDSLKHKFSISTEPSNNTVTLKGQNLQPEDTAVYYCAR
Cyprinodon variegatus V112 ighv JPKM01057125.1 2167 VLSIDLSQPDSKVVQSGQSLTITCRPSGYSLTDAYATGWIRQREEKTLEWIFHKWHDNDFYQNNALKNKFSYSKDISAGTVTITGQNMQPEDTAVYYCVR
Cyprinodon variegatus V111 trbv JPKM01057123.1 3513 VCSEVRLDQSASQVKRPGDTVKMSCVTSGYSMTGPNMHWIRQKPGRALEWIGYMSTGNNNPTYASSFQSRFTMTENVPSSTQYLEISRLTAEDSAVYFCLGE
Cyprinodon variegatus V110 ighv JPKM01057123.1 5713 VRCEQLTQPASMTVQPGQSLTISCQVSYSVSSYQTHWIRQPAGKALEWIGYMCEGCSGNRKDSLKNKFSITVHASSKTVTLNGNNMQPQDTAVYYCAKE
Cyprinodon variegatus V109 ighv JPKM01057122.1 2629 VRCEQLTQPASMTVQPGQSLTISCQVSYSLSTLTHWIRQPAGKALEWIGYMCDGCSGNRKDSLKNKFSITVHASSKTVTLNGNNMQPQDTAVYYCAKE
Cyprinodon variegatus V108 ighv JPKM01057122.1 4366 VFCIDLVQPDSKVVQPGQSLTITCQLSGYSITDDSYATGWIRHRQGKAMEWIFYMCGGGGFYQNNALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVR
Cyprinodon variegatus V107 trbv JPKM01057122.1 7898 VLSEIRLDQSASQVKRPGDTVKMSCVISGYSMTSYNIHWIKQKPGRGLEWIGWMNTGSNRPTYASSFQSRFTMTENVRSSTQYLEISRLTAEDSAVYFCARS
Cyprinodon variegatus V106 ighv JPKM01057116.1 709 VFCIDLIQPDSKVLQPGESLTITCKPSGYSITDSSYATGWIRHRKGKAMEWIFHMWGDGSLTQNDALKNKFSYSRDTSAGTVTITGQNMQPEDTAVYYCVR
Cyprinodon variegatus V105 ighv JPKM01057113.1 900 VFCIDLIQPDSKVVQPGQFLTITCQLSGYSITDNSYATGWIRHREGKAMEWIFEMWGRGSLYQNDALKNKFSYSRDTSAGTVTITGQNMQPEDTAVYYCVR
Cyprinodon variegatus V104 ighv JPKM01057111.1 5198 TDGQTLTQSEPVVKRSGESHRLICTFSGFSSTPYIHWIRQAAWERPQWLSWVSDSGGSSGLAESVKNRFTISRDNSRKQVYLQLNSLKADDSAVYYCAR
Cyprinodon variegatus V103 ighv JPKM01057111.1 9328 TDGQTLTESETVVKRPGDSHRLTCTYSGFDQHYWNAWNRQAAGKGLEFLATISGNSGSIYYSQSVKNRFTISRDNNRNQVYLQMNSLTAEDSAVYYCA
Cyprinodon variegatus V102 ighv JPKM01057111.1 20192 VFCIDLIQPDSKVVQPGQSLTITCQPSGYSITDGSYATGWIRHREGKAMEWIFYMWGGGGFYQNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVR
Cyprinodon variegatus V101 igkv JPKM01057109.1 1747 VPIFTGVDGQTLTQSEPVVKRLGESHKLTCTFTGFSSNPYINWIKHAAGKRPEWLGWIHPDGSTSGLVESVQNRFTISRDNSKYQVDLQLNSLKTDDSAVYYCVRY
Cyprinodon variegatus V100 ighv JPKM01057103.1 1808 MCEQLKQSASLTLQQGQQLTISCQVSYSVGSYHTHWIRQPPGKGLEWIGGARVGYNPYQKDSLKSKFSYKLDSSSNTVTLNGQNMQPEDSAVYYCARQ
Cyprinodon variegatus V99 trav JPKM01057102.1 787 FTGQTMESIPSSQVVKKPGETLSLSCRGSGFSFDCCSMHWIRQPAGEALQWMGRVYSHGRTTDYSSSFQDRIVISRDNSNSMVYLRLPDLKPDDSAVYYCAKQ
Cyprinodon variegatus V98 trav JPKM01057102.1 3652 VFAQTLIESESVIKKPGESHRLTCTGSGLTVSSIFFSWIRQAPGKGLEWIAWHDSGSGTRRFYSQSVQGRFTISRDDSRNQLILQMNSLRVEDSAVYYCARE
Cyprinodon variegatus V97 ighv JPKM01057102.1 5929 CIDLVQPESKAVLPGQSLSITCRLSGYTLYDSYATGWIRQREDKTLEWIFDQWGGSGGSLYQNNALKNKFSFSRDMSAGTVTITGQNLQAEDTAVYYCVR
Cyprinodon variegatus V96 ighv JPKM01057102.1 7133 VRAKQLTQPVSLTVQPGESLTITCQVSYPLTISRTHWIRQPVGKELVWLCSAHIGHATHYKESVKNKFRIDMEPSSKQVTLTGQNMQPEDTAVYYCASE
Cyprinodon variegatus V94 ighv JPKM01057102.1 20362 CTGQSMESIPSSPVVKKPGETLSLSCRGSGFTFGSFGMSWVKQPAGKALEWMGYIYTDGSNTDYSSTFQGRIEITRDNSNSMLYLKLSNLGPEDSALYYCARK
Cyprinodon variegatus V93 ighv JPKM01057101.1 4228 ASGQILTESEPVVKRPGESHRLTCTYSGFGGHSDNAWIRQAAGKGLQWVAYISGGGSYIHYSNSVKNRFTISRENNRNQVYLQMNSLTAGDSAVYYCA
Cyprinodon variegatus V92 ighv JPKM01057101.1 15560 VFGQTLTQSEPVILRPGESHKLTCTASGFTFGDYWMFWIRQPPGKALEWVAAISYWAGTTKRYSQLVQGRFTISRDNGKQQVFLQMNSLKLEDSAVYYCARG
Cyprinodon variegatus V91 ighv JPKM01057100.1 2034 VSGQTLTQSESVIKRPGETHKLTCTASGYTFSDNSMQWIKQAEGKGLEWVAYIRYDSSKTSYSQSVQGRFTISRDDNRQQVYLQMNGLKTEDSAVYYCARN
Cyprinodon variegatus V90 trdv JPKM01057100.1 5547 GEGQSLTSSEDVLQRAGQSATLSCKVQGTSLAWLHWIRQKPGKGLEWIGRIDSGTGTIFSQNLQGQFSISKDTSLNTVSLKIKSLKTEDTAVYFCAREPQ
Cyprinodon variegatus V89 trbv JPKM01057099.1 284 IHGQILRESEPVVKSPGSSHKLTCTTSGISFSSYWMAWIRQAPGKALEWIAIIKYDNARIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDSAVYFCARR
Cyprinodon variegatus V88 trbv JPKM01057099.1 3325 IHGQILRESEPVVKSPGSSHKLTCTTSGISFSSYWMAWIRQAPGKALEWIAIIKYDNARIYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDSAVYFCARR
Cyprinodon variegatus V87 ighv JPKM01057098.1 1524 VKCEQLTQPDSVNVQPGQRLTISCQVSYSVTSYWTGWIRQAAGKGLEWIGCRVGSSTSYKDSLKNKFSIDIDSSRNTATLNGQNMQPEDTAVYYCAR
Cyprinodon variegatus V86 trav JPKM01055556.1 688 CSGQTMDSIQSGPVIKRPGETLSLSCRGSGFTFPCCTMNWIRQPPGKGLEWIGVGISDQNLNSYASSVRGRIEFSREDTKSMVHLRLSILKPEDSAVYYCAKA
Cyprinodon variegatus V85 ighv JPKM01055553.1 232 TDGQTLTESEPVVKRPGESHRLTCKYSGFSSTPYVAWIRQAAGKGLEWIAWIRDDSAYIYYSDSVRNRFTISRENNRYQVYLQMNSLTAGDSAVYYCARQ
Cyprinodon variegatus V159 trav JPKM01090215.1 3278 VSSETLTQPASEALQPGQRLTIRCQVSYSFYNYYGAWIRHPAGKGVEWIGMKSNWFTFYKDSPKNKFSIDVDASSSTVTLNGENMQPEDSAVYYCARFD
Cyprinodon variegatus V158 ighv JPKM01090214.1 1517 VSCETMTQPASLTVQPGQRLTIRCQVSYDVGDWTAWIRQAAGKGLEWIGMNDRAGNLRLKDSLKNKFSIDVDTSSSTVTLNGENMQPEDSAVYYCARQ
Cyprinodon variegatus V157 ighv JPKM01090213.1 950 VSIETLTQPASEALQPGQRLTIRCQVSYSFDDYYGAWIRHPAGKGVEWIGMKSNWFTFYKDSLKNKFSIDIDASSSTVTLNGENMQPEDSAVYYCARYNA
Cyprinodon variegatus V156 ighv JPKM01090213.1 6118 VSCETLNQPASLILQPGQRLTIRCQVSYSLGYYTAWIRQAAGKGLEWIGMKYTGGSLYKDSLKNKFSIDLDTSSSTVTLNGQNMQPEDSAVYYCARK
Cyprinodon variegatus V155 ighv JPKM01090211.1 1231 VSCETLNQPASLTVQPGQRLTIRCQVSYSLGSWTAWIRQAAGKGLEWIGMKYTGNSYYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCAR
Cyprinodon variegatus V154 ighv JPKM01090211.1 4775 VSCETLTQPASLTVQPGQRLTIRCQVSYSMSYWTGWIRQAAVNGLEWIGVNDEDSPRDLHLKDSLKNKFSIDVDTSSKTVTLNGQNMQPEDSAVYYCARC
Cyprinodon variegatus V153 ighv JPKM01086072.1 24 IYCQTLRESEPVAKRPGESHKLTCTASGFTFSSYWMAWIRQAPGKGLEWLAYIHPGGSSTYYSQSVQGRFTISRDNSKQQLYLQMNSLRTEDSAVYYCARE
Cyprinodon variegatus V152 ighv JPKM01086071.1 232 VDGQTLVESEPALKRPGDSHKLSCTASGFTLSSYYMAWIRQAPGKGLEWIAYIGTYSSPIYYSQSVQGRFIISRDDSSSKIYLQMNQLKTEDTAVYYCARR
Cyprinodon variegatus V151 ighv JPKM01086071.1 5826 VDGQTLVESEPVVKRLGDSHRLTCTTNGLSFSSSWMHWIRQAPGKGLEWVSCITADSTKFYSLSVQGRFTISRDNSKQQLYLQMNSLNTDDSAVYYCVHD
Cyprinodon variegatus V150 ighv JPKM01086071.1 10567 AHCQTLTESESVVKRPGDSHQLTCRASGFTFSNHWMAWIRQAPGKGLEWISYINPGGSVAWYPDSVRGRFTISRDNSKQQLYLQMNSLRTEDSAVYYCARE
Cyprinodon variegatus V149 ighv JPKM01086068.1 1733 VTCEQLNQPASVTVKPGEGLTITCQVSYSVSSSWTHWIRQAAGKGLEWISRDTNVKNSLKNKFTVNIDSSKKIVTLNGQNMQPEDAAVYYCAREP
Cyprinodon variegatus V148 ighv JPKM01086067.1 1974 ADSQTLRESEPVQKRPGDSHKLSCTASGFTLRSYAMAWIRQAPGKGLEWIAYIDTYSTPIYYSQSVQGRFIISRDDSSSKIYLQMNQLKTEDTAVYYCARE
Cyprinodon variegatus V147 ighv JPKM01086066.1 2698 ADGQTLTESEPALKRPGDSHKLSCTASGFTLGSYEMVWIRQAPGKGLEWIAFISTASSPIYYSQSVQGRFIISRDDSSSKMYLQMNQLKTEDTAVYYCARE
Cyprinodon variegatus V146 ighv JPKM01086065.1 2175 ADGQTLVESESVLKRPGDSHKLSCTTSGFTLSSYRMAWIRQAPGKGLEWIAYISTSSSPIYYSQSVQGRFIISRDDSSSKIYLQMNQLKTEDTAVYYCARR
Cyprinodon variegatus V145 ighv JPKM01086064.1 106 ANGQTLTESEPALKRPGDSHKLSCTASGFILSSYYMAWIRQAPGKGLEWIAYIGPSSSPIHYSQSVQGRFIISRDDSSSKIYLQMNQLKTEDTAVYYCARE
Cyprinodon variegatus V144 ighv JPKM01086064.1 2449 QTLKESESVVKNPGDSHMLTCTASGFTFSSYWIHWIRQAPGKGLEWVAGIYDSSNIDYSQAFQGRFTISRDNSKQQVYLQMNNLRTEDSAVYYCARE
Cyprinodon variegatus V143 ighv JPKM01086063.1 7449 VYCQTLRESESVVKRPGESHQLTCTASGFTFSDYYMDWIRQAPGKELEWLAEINDDGDSPWHSQSVQDRFTISRDNSKQQVYLQMNSLRTEDSAVYYCARE
Cyprinodon variegatus V142 ighv JPKM01086062.1 1801 VFSQTLTESEPAVKRPGASHTLTCTYEGITDSSADISWIRQAEGKGLEWIAHISAPSGSSKYYSPSIQNRFTISRDNSKDQVYLHMSSLTTEDSAVYYCARE
Cyprinodon variegatus V141 ighv JPKM01086062.1 8218 VDGQTLSQSKTVVKRAGESHSLICTASGFRLSDYVMHWIRQVPGKGLEWIVSIYIRRSSAYISQSVRGRFVICSEESNSEIYLDMKELKTEDTAVYYCARG
Cyprinodon variegatus V140 trbv JPKM01086061.1 4297 WSEIRLDQSASVVKRPGETVKMSCVISGYSMTRYNIRWIRRKPGRALEWIGYMYTGRNRPSYASSFQSRFIMTEDVPNSNQYLEISSLTAEDSAVYFCTRE
Cyprinodon variegatus V139 ighv JPKM01086061.1 6022 VYCQTLRESEPAVKRPGESHKLTCTTSGLSFSSNWMAWIRQAPGKGLEWIATEARGSQHYSQSVRGRFIVSRDDGREQLFLQMNRLKTEDSAVYYCARE
Cyprinodon variegatus V138 ighv JPKM01086060.1 276 VRCEQLTQPASMSVQPDQRLTISCQVSYSMSSYATHWIRQPTGKGLEWIGYTCTGCTPTYKNSLKNKFSFTLESSSNTVTLHGQNMQPEDSAVYYCARE
Cyprinodon variegatus V137 trbv JPKM01086058.1 6672 IICEIKLEQTPSEARRPGETLKMSCVMSGFVMTSYYIHWIKQKPGKALEWVGRMNAGSNSAIYGSSFQGRFTMTENVPISTQYLEIRSLTAEDSAVYFCARS
Cyprinodon variegatus V136 trbv JPKM01086058.1 9495 WSEIRLVQSASLEKSPGDTVKISCVTSGFKMTDNYMHWIRQRPGRALEWIGRMDTGKNSAIYGSSFQGRFTMTENVPSSTQYIEIRSLTAEDSAVYFCARV
Cyprinodon variegatus V135 ighv JPKM01086057.1 461 VKCEQLTQPASMSVQPGQTLTISCQVSYSVTDYSTLWIRQPTEKALEWMGGIWYDGSNAYASRFQGRIEITRDINKKVIHLRLSSMKPEDSAVYYCARH
Cyprinodon variegatus V134 ighv JPKM01086057.1 3499 VKCEQLTQPASMSVQPGQTLTISCQVSYSVTSHHTGWIRQLTGKEPEWMGVIWHNGGKVYASRFQGRIEINRDTNKNMVNLRLSSMKPEDSAVYYCARE
Cyprinodon variegatus V132 ighv JPKM01086053.1 819 VWSEIKLDQSASVVKRPGETVKMSCVLSGYSLTSHDMHWIRQRPGKALEWMGYMSTGNNDPSYASSFQSRLTMTEDGSSSNQYLEISSLTAEDSAVYFCARQ
Cyprinodon variegatus V131 trav JPKM01086049.1 3186 VWGDITLQQSPYEVKRPGETVRISCVTSGYEMTSYPINWIRQKRGKSLEWIGWINTDTAVPTYADSFKSRFSFTQDVSSSTQFLQISSLSTEDSAVYFCARE
Cyprinodon variegatus V130 trav JPKM01083586.1 585 CKGDSVTQTEGHVAAARGECVTLGCIFTTSYTGYTLFWYKLEENSFPKYMLKQLSSTKEKAPDFNHIRFNADLDSDKKSFNLTIQDLRLSDSAVYYCALQPTVTG
Cyprinodon variegatus V129 trav JPKM01083575.1 3986 MGSMNTIKQEQREQAVSEGRSTSLSCEYSGSIYNIQWYRQQQRSRPEFLLYITEAGQIHPTGSEFSVHINKTAKQSKLLISSAALSDSAVYYCAVA
Cyprinodon variegatus V128 trav JPKM01083572.1 1301 VQSQKITAFKNEESTLEGSTITLSCNFTKANALFLFWYRQNPGEPPKFLFSHSPSAAEQKLNRLTFEVDKEEMKMSISSAAVSDSAVYYCALQ
Cyprinodon variegatus V127 trav JPKM01083564.1 1059 CKGDSVTQTEGHVAAAKGGNVTLECTFETNSFGNPYLFWYKKEENKRPSHILTRLRGTGINSKEFNKERFDAILQDASIPLKIQDLRLSDSAVYYCALQPTVTG
Cyprinodon variegatus V126 iglv JPKM01081641.1 488 VSGVTVVTQKPSVLTVRKGETATMDCNLGTVTNSEARWYRQIPGGVPLYMLRIYHGWSSPRYDTGFPSARHTSTHQSTSDYRLIINNIEEGDSAVYYCKTW
Cyprinodon variegatus V125 iglv JPKM01081641.1 488 VSGVTVVTQKPSVLTVRKGETATMDCNLGTVTNSEARWYRQIPGGVPLYMLRIYHGWSSPRYDTGFPSARHTSTHQSTSDYRLIINNIEEGDSAVYYCKTW
Cyprinodon variegatus V124 trav JPKM01081640.1 434 VDAAITLTQIPPVETVSTGQQVVLKCNIQRYDGNFVNWYKQVPGGVPQYALSFYHFSSSLYFGTGFSSDRFNSKSTSNIDYEFIIKQAEAGDSALYFCQ
Cyprinodon variegatus V123 trav JPKM01081636.1 13853 ITLTQIPPVETVSTGQQVVLKCNIQRYDENYVNWYKQVPGGVPQYVLSFLHSYSALYFGTGFSSDRFNSKSTSSIDYEFIIKQAEAGDSALYFCQTWDDSAAEAV
Cyprinodon variegatus V184 igkv JPKM01106687.1 1704 SSGQVTITQTPGSQSVVPGQTVSIKCKVNPSPGNCFQWYLQKQGDAPKLLITCGSSRQSGVPDRFSGSGSGSDFTLTISGVQAEDAAAYYCQSLHSINSQWV
Cyprinodon variegatus V183 igkv JPKM01106633.1 1740 SSGQVTITQTPGSQSVVPGQTVSIKCKVNPSPGNCFQWYLQKQGDAPKLLITCGSSRQSGVPDRFSGSGSGSDFTLTISGVQAEDAAAYYCQSLHSINSQWV
Cyprinodon variegatus V182 trbv JPKM01103035.1 2156 VVCEIKLEQSPSEAKRPGETFKMSCVMSGFDMTEYFIHWIKQKPGKALEWVGMMNAGSNSADYGSSFQGRFTMTENVPSSTQYLEIRSLTAEDSAVYFCARS
Cyprinodon variegatus V181 trav JPKM01097690.1 1327 DSVTQTEGHVVAAEGESVTLGCSYKSSVTPTLFWYKQEENSFPQYMLKRVSSEGDNAPEFSKNKFQAEVKNSAFNLTIQDLRLSDSAVYYCALKPTVTG
Cyprinodon variegatus V180 trav JPKM01097685.1 320 INCQHLTATKSEESSLEENSVTLSCTYSQSAAYGDYIFWYRQNPGKPPEYLVSHSGTGDKLQDPVPGFSFRVNDDKTQMDLLISSAAETDSAVYYCAVRPTVTG
Cyprinodon variegatus V179 trav JPKM01097683.1 155 CKGDSVTQTEGHVAAAKGKSVTLGCIFETSDPYPYLFWYQQKEGSSPTYMLNRYSGTAANDPKFSTDRFNADLNTGTQKKSVNLTIQDLRLSDSAVYYCALR
Cyprinodon variegatus V178 trbv JPKM01095383.1 3375 VCSEIKLDQSASVEKRPGESVKMSCVASGYSMTDANMHWIRQRPGRALEWIGFMITGNNDPSYASSFQSRFTMTEDVSSSTQFLEISSLTAEDSAVYFCARQ
Cyprinodon variegatus V177 ighv JPKM01095376.1 1111 VKCIELTQPASMSVQPGQALTISCQVSYSVTGYNTAWIRQPTGKALEWMGIIWYDGSNSYGSRFQGRIEITRDTNKNIVNLRLSTMKPEDSAVYYCARE
Cyprinodon variegatus V176 trav JPKM01095376.1 5715 AKSEQLTQPASMSVQPGQTLTISCQVSYSVSNYYTAWIRQSLGKGLEWIGQAADGYKTYYKDSLQSKFSISTDSSSNTVVLNGQNIQPEDSAVYYCARVT
Cyprinodon variegatus V175 ighv JPKM01095376.1 8002 LKCEQLTQPASMSAQPGQTLTISCQVSYSVTSYGTHWIRQPTGKALEWMGVIWASGSNNYASRFQGRTEITRDTNKNIVNLRLSSMKPEDSAVYYCAKE
Cyprinodon variegatus V174 ighv JPKM01095376.1 10195 STGQALESIPSTSMVKNPQEVLSLSCRGSGFDFSRYVMHWIRQPAGKSLEWMGVISDGGSNTLYASIVDGRIEITRDNSNSMVYLKLSNLKAEDSAVYYCARE
Cyprinodon variegatus V173 trav JPKM01091482.1 4000 CKGDSVTQTEGHVAAAQGESVTLGCSYDSSVTPTLFWYQQEETGSPKYMLQQLSSRNIKAPDFNNDRFDTDLDSSKKSFNLTIQNLRLSDSAVYYCALQPTVTG
Cyprinodon variegatus V172 ighv JPKM01090597.1 1475 VSCETLNQPASLTLQPGQRLTIRCQVSYELGYYTAWIRQAAGKGLEWIGMEDSYGSSYYKDSLKNKFSINLDASSKTVTLNGENMQPEDSAVYYCARQ
Cyprinodon variegatus V171 ighv JPKM01090595.1 2782 VSCETLTQPASLTVQPGQRLTIRCQVSYSLGSYTAWIRQAAGKGLEWIGIKYTGGSHYKDSLKNKFSIDIDTSSSTVTLNGENMQPEDSAVYYCARESQ
Cyprinodon variegatus V170 ighv JPKM01090594.1 1612 VSCETLTQPASLTVQPGQRLTVRCQVSYELSYYTAWIRQAAGKGLEWIGMEDSYGNSYYKDSLKNKFSMNLDTSRKTVTLNGENMQPEDSAVYYCARR
Cyprinodon variegatus V169 ighv JPKM01090592.1 979 VSCETLTQPASLTVQPGQRLTIRCQVSYSLSTYYTAWIRQAAGKGLEWIGRKYTGASYYKDSLKNKFSIDLDTSSSTVTLNGQNMQPEDSAVYYCARQ
Cyprinodon variegatus V168 ighv JPKM01090585.1 83 VSSETLTQPASLTVQPGQRLTIRCQVSYSLSSYNTAWIRQAAGKGLEWIGMKHTGGSYYKDSLKNKFSIDVDTSSKTVTLNGQNMQPEESAVYYCAR
Cyprinodon variegatus V167 trav JPKM01090584.1 260 VSSETLTQPASVTVTPGQRLTIRCQVTYSLGSYRTAWIRQPAGKGLEWIGMKYTGDSFFKDSLKNKFSIDLDTSSSTVTLNGKNMQPEDSAVYYCARE
Cyprinodon variegatus V166 ighv JPKM01090580.1 206 VSCETLTQPESSTVQPGQRLTIRCQVSYSLGSYYTAWIRQAAGKGLDWIGMKHGGGASYYKDSLRNKFSIDVDTSSKTVTLNGQNMQPEDSAVYYCARR
Cyprinodon variegatus V165 ighv JPKM01090579.1 2983 VPCETLTQPASLTVQPGQRLTIRCQVSYSFGSYHTAWIRQAAGEGLEWIGMKSSRYSYYKDSLKKKFSINLDTSSKTVTLNGQNMQPEDSAVYYCARDTV
Cyprinodon variegatus V164 ighv JPKM01090579.1 6052 VSCESLTQPASLTVQPGQRLTIRCQVSYDLGYYTAWIRQAAGKGLEWIGMKRSDGTSYYKDSLRNKFSIDVDTSSKTVTLNGQNIQPEDSAVYYCARY
Cyprinodon variegatus V163 ighv JPKM01090579.1 9666 TDGQTLTESEPVVKRPGESHRLTCKYSGFSSTPAVAWIRQAAGKGLEWIAYISDGSASIYYSDSVRNRFTISRENSRNQVYLQMNSLTAGDSAVYYCAR
Cyprinodon variegatus V162 trav JPKM01090577.1 2255 VSSETLTQPAAVTVTPGQRLTIRCQVTYSLSSYWTHWIRQAAGKGLEWIGMKYTGDSYYKDSLKNKFSIDLETSSSTVTLNGQNMQPEDSAVYYCARE
Cyprinodon variegatus V161 trav JPKM01090217.1 455 VSSETLTQPASEALQPGQRVTIRCQVSYSFYNYYGAWIRQPAGKGVEWIGMKSNWFTFYKGSLKNKFSIDVDASSSTVTLSGENMQLEDSAVYYCARFD
Cyprinodon variegatus V160 ighv JPKM01090215.1 980 VSCETLNQPASLTVQPGQRLTIRCQVSYSLGSYTAWIRQAAGKGLEWIGMKDSYGSYYKDSLKNKFSINLDTSSKTVTLNGENIQPEDSAVYYCARY
Cyprinodon variegatus V133 ighv JPKM01086054.1 963 VYCIDLIQPDSKVVQPGQSLTITCQPSGYSVTDNSYATGWIRHQEGKAMEWIFHMWGDGDFYQNNDLKNKFSHSRDTFAGTVTITGQNLQPEDTALYYCVR
Cyprinodon variegatus V122 igkv JPKM01072562.1 1151 SDGQNVVLTQPAAKSVQLGQTVTIDCKASRQVGHWSGSQYYLAWQQKKNGEAHKALVTRTTTRYSGISSRFTGSGAGNGIDFSLTISGVHTEDAGVYYCQS
Cyprinodon variegatus V95 ighv JPKM01057102.1 12344 VSGQTLTESEPVVKKPGESHRLTCTGSGFTFSSYPMNWVRQAPGKGLEWIAFVHTGSSHFFYSQSVQGRFTISRDDSSSKVYLQMNNLKTEDTAVYYCARE
Cyprinodon variegatus V84 ighv JPKM01055551.1 434 TDGETLTESEPVVKRPGEFHRLTCTYSGRSGNPYIVWIRQAPGKGLEWIVWISDDSAYIHYSDSVRHRFTASRENSRNQVYLQMNSLTAGDSAVYYCARE
Cyprinodon variegatus V57 trav JPKM01072546.1 11415 QVTVTQPAAVRADLGGSVSIRCRTSQNVYYSSSTRYHCLAWFQQKDGQSPKRLIYGSSSRDPWTPSHFTGSGSHTDFTLTFSGVLAEDSAVYYCQSAHLINNHWV
Cyprinodon variegatus V46 trbv JPKM01070424.1 51643 SSPSDQVHQAPAHHFKLTGEPAVINCTHNIQYYDRILWYKQSKDDRMQLLGYMNVKDGYPEPEVKVKITGKATEGETCTLTLEAVDLSSSGVYFCAAS
Cyprinodon variegatus V24 igkv JPKM01023027.1 2485 SRGQVTVTQPAAVRADLGGSVTISCRTSPNVRVWSSYHLLAWYQQKDGQSPKRLIYYASSRDSWTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSEHYINSQPV