WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Esox lucius AZJR00000000.3 (AZJR03) 202 55 2 43 58 15 12 17
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Esox lucius V160 igkv AZJR03000634.1 1013590 SSADVILTQSPKSRSVSPGETVSISCSTSTSVGSYVSWYLQKPGDAPKLLVYYATSRQSGIPDRFSGSGSGSQFTLTISGIQGEDAGDYYCQQYD
Esox lucius V3 trav AZJR03000064.1 151968 PSVEQSMTPDREVVDVMESKSVKLSCRYNSSSSTNTAFWYHQHPGSSPQLLIMEYSDSTKWTLTHDKEKKRVDLEISSVEVTDSALYYCALR
Esox lucius V4 igkv AZJR03000151.1 7314 QYILTQSPAVQSVLTGNSVTMNCKVSSNVHNNNHLHWYQQKPGGAPKLLIYLANTLQSGTPSRFSGSGSGSDFTLTISGVQGEDAGDYYCQS
Esox lucius V2 trav AZJR03000064.1 151968 PSVEQSMTPDREVVDVMESKSVKLSCRYNSSSSTNTAFWYHQHPGSSPQLLIMEYSDSTKWTLTHDKEKKRVDLEISSVEVTDSALYYCALR
Esox lucius V1 trav AZJR03000064.1 91168 GSYEQTIEPNQQETIAHVGSKIHLSCNYSSAYSLLWYKQSPGSAPQYLLLVPHSTGRMMGDDSLDTRFLGKLNEEKTRVDLYISSAIVTDSALYYCALR
Esox lucius V0 trav AZJR03000064.1 86511 SVTQPTGDVITTEGEQVTLDCTFNAVNPNNVNLFWYTYEPNGFPKVILGRFSFGSTNTTEFKARFDALLNSESKSVPLTIQRLQLSDSAVYYCALR
Esox lucius V43 trav AZJR03000681.1 47184 SVTQPPGDVITTEGEQVTLGCTFDTQDANQYLFWYKQGANDHPNYMLMRPKYGTGDNAADFKDRFHADLDTKTNSIPLTIQRLQLSDSAVYYCALR
Esox lucius V42 trav AZJR03000681.1 26807 SVTQPTGDVITTEGGQVTLGCTFNTQGTTTYLFWYKQEANDYPKYMLMRPKYGTGDNAADFKDRVHADLDTKTNSIPLRIQRLQLSDSAVYYCALR
Esox lucius V41 trav AZJR03000681.1 13520 EDSVTQPTGDVITTEGEQVKLGCTFDTQDGGPSIFWYKQGANAHPKYMLMRPKYGTGVNAAEFKDRFQADPDTKTNSIPLKIQDLQLSDSAVYYCALR
Esox lucius V40 igkv AZJR03000666.1 172679 SRGQYILTQSPAVQSVTTGNSVTMNCKVSSNVYNNNNLAWYQQKPGGAPKLLIYYAKTLQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Esox lucius V39 igkv AZJR03000666.1 163577 SRGQVTVTQTPAVEAVLPGQTVSLKCRTSSNVDGAGGSYPCMAWYQQKPGGAPKLLIYYAKTRVSGIPSRFSGSGDYSDFTLTISGVQGEDAGDYYCQS
Esox lucius V38 igkv AZJR03000666.1 112979 SRGQYILTQSPAVQSVITGKSVTMNCKVSSNVHNNDFLAWYQQKPGGAPKLLIYRANTLQSGIPSRFSGSGAASDFTLTISGVQTEDAGDYYCQS
Esox lucius V37 igkv AZJR03000666.1 112979 SRGQYILTQSPAVQSVITGKSVTMNCKVSSNVHNNDFLAWYQQKPGGAPKLLIYRANTLQSGIPSRFSGSGAASDFTLTISGVQTEDAGDYYCQS
Esox lucius V36 igkv AZJR03000666.1 107570 SRGQVTVTQTPAVEAVLPGQTVSLKCRTSSNVVGTCWNGQSSYDRQCLAWYQQKPGGAPKLLIYSANILQSGIPSRFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Esox lucius V35 igkv AZJR03000634.1 1082211 SSADIILTQSPNSRSVSPGETVSITCSTSTSVSSYLSWYLQKPGEAPKLLVYYATTRQSGIPDRFSGSGSGSQFTLTISGIQGEDAGDYYCQQGYTP
Esox lucius V34 igkv AZJR03000634.1 1056346 SSADIILTQSPKSRSVSPGETVSITCSTSTSVGSEFDWYLLKPGEAPKLLVYAATTRQSGIPDRFSGSGSGSQFTLTISGIQGEDTGDYYCQQDYSYP
Esox lucius V33 igkv AZJR03000634.1 1041859 IILTQSPKSRSVSPGETVSISCTASSDVSDYLHWYLQKPGEAPKLLVYYATELESGIPDRFSGSGSGSQYTLTISGIQGEDAGDYYCQQG
Esox lucius V32 igkv AZJR03000634.1 1016270 SSADIILTQSPKSRSVSPGETVSISCSISSSVRSYLHWYLQKPGEAPKLLVYDATNRQSGIPDRFSGSGSGSQFTLTISGIQGEDAGDYYCQQGYSG
Esox lucius V31 igkv AZJR03000634.1 993521 SSADIILTQSPKSRSVSPGETVSISCSTSTSVGSYLSWYLQKPGEAPKLLVYYATNRQSGIPGRFSGSGSGSQFTLTISGIQGEDAGDYYCQQGYSFP
Esox lucius V30 igkv AZJR03000634.1 977662 SSADIILTQSPKSRSVSPGETVSISCSTSTSVTYLQWYLQKPGEAPKLLVYSATTRQSGIPDRFSGSGSGSQFTLTISGIQGEDAGDYYCQQGDSSP
Esox lucius V29 igkv AZJR03000634.1 966307 SSADIILTQSPKSQAVSPGETVSISCSTSSSVSNYLHWYLQKPGEAPKLLVYDATTRQSGIPDRFSGSRSGSQFTLTISGIQGEDAGDYYCQQSKSFP
Esox lucius V28 igkv AZJR03000632.1 4264088 QVTVTQPPVVTFSPGDTVSLTCRNNPAVYVNSVGDHYMFWYQQRSGEAPKLLIVYAETRIDGIPARFSGSGSGSDFSLTISGVQAEDAAVYYCQS
Esox lucius V27 igkv AZJR03000632.1 4181997 QVTVTQPPVVTFSPGDTVTLTCRTNPAVHKWSDGDEGAYWYQQRPGEAPKLLIKYAKTRIDGIPARFSGSGSGSDFSLTINGVQAEDAAVYYCQS
Esox lucius V26 igkv AZJR03000632.1 4175722 TSGAGVVSQSPTVKSVTLGEYVSLSCTASQGVDDDLSWYLQKPGQPPQLLFYNINTPESKTPSHFSSSGSEPDFTLTISGVQAEDVGDYYCMGA
Esox lucius V25 trav AZJR03000505.1 156940 EDSVTQPPGDVITTEGEQVTLGCTFDTQDGGPYLFWYKQGSNDHPKYMLMRPKYGTGDNAADFKDRFHADLDTKTNSIPLRIQTLQLSDSAVYYCVLR
Esox lucius V24 trav AZJR03000505.1 143520 EDSVTQPTGDVITTEGGQVTLGCTFNTQDGIYLFWYKQGANDHPNYMLVLSKYGAGVNAADFKDRFHAHLDITTKSVPLMIQELQLSDSAVYYCALR
Esox lucius V23 trav AZJR03000505.1 77281 SVTQPPGDVITTEGGQVTLGCTFNTQFINPYLFWYKQGANDHPKYMLKRFKLGSGDNAADFKDRFHADVDANANSVPLRIQRLQLSDSAVYYCALR
Esox lucius V22 trav AZJR03000505.1 65286 EDSVTQPTGDVITTEGEQVTLGCTFDTQGTTPYLFWYKQEANDYPKYMLMRPKYGTGDNAADFKDRFHADLDTKTNSIPLTIQGLQLSDSAVYYCVLR
Esox lucius V20 trav AZJR03000505.1 7938 TVTQPPGDVITTEGGQVTLNCTFNTQDTNICLFWYKQGSNDNPNYMLMRPKYGTGDNANEFKDRFHADLDTKKNSVPLRIQRLQMSDSAVYYCALR
Esox lucius V19 trav AZJR03000401.1 1892277 SSYEQTIEANQHEVYADVNNKVHLSCKVSSQSLSDNFLWYKQSPGSAPQYLMLILGPENVVRDDSLDSRFSGNQNKEKTRVDLYISSAEVTDSALYYCALT
Esox lucius V18 trav AZJR03000401.1 1873715 DSVTQPTVDVIAVEGQSTTLSCKFTTDQTPYLFWYKQQGNSNPVFMMRKDTFSPGETATEFKERFYANLSITTKSVPLMIQRLQPSDSAVYYCALK
Esox lucius V17 trav AZJR03000401.1 1861233 SVTQPTGDVITTEGGQVKLGCTFNTVNANDAYLFWYKYEPNGFPKVILSRFPFGSTNTTEFKERFDAHLDSHSKSVPLTIQRLQLSDSAVYYCALR
Esox lucius V16 trav AZJR03000401.1 1836430 DSVTQPKEEVTVTEGGQITLTCRYETDYSSPYLFWYQQRANDYPKYMLRRFKAGTGDNATEFKDRFHAHLNITTKSVPLRIQSLQLSDSAVYYCALR
Esox lucius V15 trav AZJR03000401.1 1835741 SVTQPTGDVITTEGGQVTLGCTFNTVNANNAYLFWYKYEPNGFPKVILSRFPFGSTNTTEFKERFDAHLDSHSKSVPLTIQRLQLSDSAVYYCALR
Esox lucius V14 igkv AZJR03000257.1 101354 SRGQVTVTQTPAVETVRPGQTVSLKCRTSSDVYRWNSNDYQAWYQQKPGRAPKLLIYDVKKPLSETPSRFSGSGSGRDFTLTISGVQAEDAGDYYCQS
Esox lucius V13 igkv AZJR03000257.1 83491 SRGQYTVTQTPVVEAVLPGKTVSLKCRTSSNVHGAGGSYPHQAWYQQKPGGAPKLLIYYAKTLQSGIPSRFSGSGDYSDFTLTITGVQTEDAGDYYCQS
Esox lucius V12 igkv AZJR03000257.1 63268 SRGQVTVTQTPVVEAVLPGQTVSLKCRTSSDVYQAGTSSPRMAWYQQKPGGAPKLLIYYAKTLQSGTPSRFSGSGDYSDFTLTINGVQAEDAGDYYCQS
Esox lucius V11 trav AZJR03000190.1 155848 RVIQLKMEVTAYEGEDVSLNCEYETSYTSSSIFWYSFSTNSYPEYVLRKDLIGPGDLSSRFKERFQANLSTKTNSVPLAIQRLQLSDSAVYYCALR
Esox lucius V10 trdv AZJR03000190.1 122395 LTAGDHITPVENEVTSTEGQSVTLNCTYDTSSEYPLLYWYRHYPNQAPQFILYKGAKSSSDFEEIPDKRYKSKTSDTSTELVIQQLTLSDTGFYYCALR
Esox lucius V9 trav AZJR03000190.1 117902 EDSVTQPTGDVITTEGGQVTLGCTFDTQVANSYLFWYKQGANDHPKYMLMRFKVGTTPGNNAADFKDRFHADVDANANSVPLRIQDLHLTDSAVYYCALR
Esox lucius V8 trav AZJR03000190.1 87792 SVTQPTGDVFTTEGGQVKLGCTFNTLDTYPYMFWYKQGANDHPKYMLRRFKDGTGDNAPEFKDRFHADVDANANSVPLRIQDLQLSDSAVYYCALR
Esox lucius V7 trdv AZJR03000190.1 85190 LTAGDHITPVENEVTSTEGQSVTLNCTYDTSSEYPLLYWYRHYPNQAPQFILYKGAKSSSDFEEIPDKRYKSKTSDTSTELVIQQLTLSDTGFYYCALR
Esox lucius V6 trav AZJR03000190.1 31272 EDSVTQPTGDVITTEGGQVTLGCTFDTEVASPYLFWYKQGSNDHTKYMLMRPEYGDGDNAPEFKDRFDADLDTKTKSVPLTIQSLQLSDTAVYYCALR
Esox lucius V5 trav AZJR03000190.1 10787 EDSVTQPTGDVITTEGGQVTLGCTFYTQDGIYLFWYKQGSNDHPNYMLMRPKYGFGDNAADFKDRFHADLDTKTNSIPLRIQGLQLSDSAVYYCALR
Esox lucius V82 ighv AZJR03000142.1 263377 VQSQTLTESEPVVKKPGESHKLTCTTSGFTFSSYAMNWIRQAPGKGLEWIAFVQTGSTSIYNSQTVPGRFTISRDDSNSKLYLQMNSLKSEDTAVYYCA
Esox lucius V81 ighv AZJR03000142.1 280704 VQCQTLTESEPVVKKPGESHKLTCTGSGFTFSSYWMGWIRQVPGKGLEWIGSIHGTTASYSQSVQGRFTMSRDDSSSKVYLQMNSLKSEDTAVYYCAR
Esox lucius V80 ighv AZJR03000142.1 313811 VQGQTLTESEPVVKKPGESHKLTCTTSGFTFSSYPMNWIRQAPGKGLEWIAYVGTSSTPIYYSQSVQGRFTISRDDSSSKLYLQMNSLKSEDTAVYYCAR
Esox lucius V79 ighv AZJR03000142.1 337984 VHSISLTSSSDQLKAPGESVKLSCQVSGYALTDYGTGWIRQQSGKPLEWIGIIWGGGSINLGASFQSRFTISRDSSNVLYLDISRLQAEDTAVYYCAKT
Esox lucius V78 ighv AZJR03000142.1 339704 VQGQTLTESEPVVKKPGESHKLTCTGSGFTFSSYWMGWIRQVPGKGLEWIGHIHGTTAYYSQSIQGRFTMSRDDSSSKLYLQMNSLKSEDTAVYYCAR
Esox lucius V77 ighv AZJR03000142.1 356929 VFCQIELKQQDSMTVQPGQSLTLSCKVSGYSLTDTSYCTYWVRQPAGKALEWIGGICGNGNTYYGDKFKNKFSSSRDTSSSTATLTGQSLQTEDTAVYYCARE
Esox lucius V76 ighv AZJR03000142.1 370496 VHCQVVLTQAEQSVQGTPGGSLKLTCACSGFTLSGAYMHWIRQAPGKGLEWIIFYRSDSDKSNSQAVQGRFTASKDSTNFYLHMNQLKPEDSAVYYCARD
Esox lucius V75 ighv AZJR03000142.1 378253 VHCEELTQPPSMTVQPGQPLTISCKVSYSVTSYHTAWIRQPAGKTLEWIGFIYSGGSTAYKDSLKNKFSITRDISSNTLFLKGQNLQTEDTAVYYCARD
Esox lucius V74 ighv AZJR03000142.1 383385 VHCEELTQPPSMTVQPGQPLTISCKVSYSLGYWTAWIRQPAGKALEWIGMKYTGGTEQKDSLKNKFSLTLDSSSNTVTLTGQNLQAEDTAVYYCAR
Esox lucius V73 ighv AZJR03000142.1 402170 VHCEELTQPPSMTVQPGQPLTISCKVSYSVSSYNTHWIRQPAGKTLEWIGRINTGGGTGYKDSLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYCAR
Esox lucius V72 ighv AZJR03000142.1 419653 LNGQSMESIPSSPVLKSPGEILNLSCKGTGYTFTSYSMNWIRQATGKPLEWMGWINTNTGAAGYAKSLEGRVELTKEDSVSMTHLKLSGLKAEDSAVYYCAR
Esox lucius V71 ighv AZJR03000142.1 427997 VHCQVVLTQAEQSVQGTPGGSLKLTCACSGFTLSSTYMHWIRQAPGKGLEWIMYYYSDSNKGYSQAVQGRFTASKDSTNFYLHMNQLKPEDSAVYYCARD
Esox lucius V70 ighv AZJR03000142.1 433316 VQCQVVLTQAEQSVQGTPGRSVTLTCACSGFDLSSTYMHWIRRAPGKGLEWIMYYHSDTYNSNSQAVQGRFSASKARPNFYLHMNQLKPEDSAVYYCARD
Esox lucius V69 ighv AZJR03000142.1 438444 VHCQVVLTQAEQSVQGTPGGSLKLTCACSGFTLSSYRMHWVRQAPGQGLQWILHYYTSSDNGYLPAVQGRFTASKDSTNFYLHMNQLKPEDSAVYYCARD
Esox lucius V68 ighv AZJR03000142.1 452608 VHCQVVLTQAEQSVQGTPGGSLKLTCACSGFTLSSTYMYWIRQAPGKGLEWIIYYYSDSDKSNSQAVQGRFTASKDSTNFYLHMNQLKPEDSAVYYCAGN
Esox lucius V67 ighv AZJR03000142.1 468599 VHCQVVLTQAEQSVQGTPGGSLKLTCACSGFTLSGTSMHWIRQAPGKGLEWIIYYYSDSSKSNSQAVQGRFTASKDSTNFYLHMNQLKPEDSAVYYCARD
Esox lucius V66 ighv AZJR03000142.1 472943 LSGQSLESIPSSPVIKKPGETLSISCKGSGYTFGNHAVHWVRQPTAKGLEWIGRVRTDTGEATYANSFSGNLEITKDNAQSMSFLKLSGLRAEDSAVYYCARQ
Esox lucius V65 ighv AZJR03000142.1 520571 VHSEELTQPPSMTVQPGQPLTISCKVSYSVSSYYTAWIRQPAGKTLEWIGYINTGGSTGYKDSLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYCAR
Esox lucius V64 ighv AZJR03000142.1 526245 LNCQSLTSIPSSPVLTQPGETLSLSCQISGYTFSSHHSHWIRQPAGKSLEWLGYSGLGTSYHSKSFEGRMETTKDDSTRMMTLKLSCLRAEDSAVYYCAR
Esox lucius V63 ighv AZJR03000142.1 538101 VHCEELTQPPSMTVQPGQPLTISCKVSYSVSSYWSGWIRQPAGKALEWIGRISTSGSTDYKDSLKSKFSITRDTSSNTLFLKGQNLQTEDTAVYYCAR
Esox lucius V62 ighv AZJR03000142.1 556022 VHCEELTQPPSMTVQPGQPLTISCKVSYSVSSYYTQWIRQPAGKALEWIGYISNGGSTGYKDSLKSKFSITRDTSSNTLFLKGQNLQTEDTAVYYCARD
Esox lucius V61 ighv AZJR03000142.1 565101 VHCEELTQPPSMTVQPGQPLTISCKVSYSVSSYWTAWIRQPAGKTLEWIGWKYTGGTHQKDSLKNKFSLTLDSSSSTVTLTGKNLQAEDTAVYYCAGEKQYNKP
Esox lucius V60 ighv AZJR03000142.1 570170 VHCEELTQPPSMTVQPGQPLTISCKVSYSVSSYYTNWIRQPAGKALEWIGYISNGGSTGYKESLKNKFSITRDTSSNTLFLKGQNLQTEDTAVYYCARD
Esox lucius V59 ighv AZJR03000142.1 581070 LNCQSLTSIPSSPIQTQPGETLSLSCQISGYTFSSHHSHWIRQPAGKALEWMGYSGLGTGYHSKSFEGRMETTKDDSNRMMTLKLSGLRAEDSAVYYCAR
Esox lucius V58 ighv AZJR03000106.1 5020805 VQGQSLTSSESVVKRPGEPVTLSCTVSGFSMGSYYMHWIRQKPGRGLEWIGMIFTGTSTAFAQSLQGQFSITKDNSKNKLNLDVKSLKAEDSAVYYCVRE
Esox lucius V57 ighv AZJR03000106.1 5039372 VCCDIRLDQSPSQVIKPGDPVKLSCKTSGFDMTSYNMDWIRQKPGKGLEWIGSMDSGSGSEPDYTDSLKGQFTLTEDVPTSTQFLEAKNLRAEDTAVYYCAR
Esox lucius V56 ighv AZJR03000106.1 5045761 VQGQSLTSSESVVKRPGEPVTLSCTVSGFSMSYWMHWIRQKPGKGLEWIGGIDGNSGTIFAQSLQGQFSITKDNSNNQLNLDVKSLKAEDSAVYYCAR
Esox lucius V55 trav AZJR03000064.1 5942 SSYEEDIIPVRSKEQVYEGEGVTLSCKYTGSSAIDTLLWYQQYPGLKPELLLLITEGGYKDKTHSGLSVKLNDEKTRVDLEISSVEMTDSALYYCALR
Esox lucius V54 trav AZJR03000064.1 5942 SSYEEDIIPVRSKEQVYEGEGVTLSCKYTGSSAIDTLLWYQQYPGLKPELLLLITEGGYKDKTHSGLSVKLNDEKTRVDLEISSVEMTDSALYYCALR
Esox lucius V53 ighv AZJR03000004.1 44665 VFCQTELTQQDSMTVKPGQSLTLSCKVSGYSLTDTSYCTYWVRQPAGKALEWIGGICGSGNTYYSDKLKNKFSCSRVTSSSTATLTGQSLQTEDTAVYYCARE
Esox lucius V52 ighv AZJR03000004.1 53494 VSCGSPELSQPSSMLVKPGESLTITCNVAGYSVSDGSVSYATGWVRKPAGKTMEWISHIWDNGDIYQNDALKNKFSISRDASINSVSLQGNSLKPEDTAVYYCVRRP
Esox lucius V51 ighv AZJR03000004.1 84864 VHCEELTQPPSMTVQPGQPLTISCKVSYSVSTYYTAWIRQPAGETLEWIGFIRPAGTTVYKDSLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYCARD
Esox lucius V50 trav AZJR03001172.1 560 STLAVNMVQHPPSLLSAEGKETLECSHDNAEFYRMFWYKQNTNRTIQLVAYSVGKGETETDPIFDKKKYTMTREEQLKSFLLIKDLRTGDSAVYYCAAQL
Esox lucius V49 trbv AZJR03001131.1 10621896 QSFSSKVHQTPVSLIVRPGGNVKLTCNHTFPDYFVILWYQESAGDTAIKLIGNIYTQSVTMETSYEKHFNVSGDGGKEAYLHIQSLRQPEDSSVYFCAAS
Esox lucius V48 trav AZJR03000984.1 59653 VSGVTVVTQKPPVVTVRKGEMVTMDCNLGTVTTSAARWYKQVPGGVPQFVLFFYHPNSAPTYGSGFSSPKFTSNHQSKSDYRLIINNVEESDSAVYYCHTYDSSAK
Esox lucius V47 igkv AZJR03000828.1 490913 QDVLTQSPAVQSVITGNSVTMNCKVSSNVYRNNRLAWYQQKPGGAPKLYLANTLQSGIPSRFSGSGSGRDFTLTISGVQTEDAGDYYCQS
Esox lucius V46 iglv AZJR03000744.1 2509223 VSGVTVVTQKPPVVTVRKGEMVTMDCNLGTVTDGARWYKQVPGGVTQFILYFHHSDSAPTYGSGFSSPKFTSNHQSTSDYRLIINNVEESDSAVYYCETWDSSAKENV
Esox lucius V45 trav AZJR03000744.1 2498584 RKGEMVTMDCNLGTVTNRAACWYKQVPGGVPQYVVCWYHGSKPEEIKYGSGFSSPKFTSNHQSTSDYRLIINNVEESDSAVYYCQTWDSSAKEYV
Esox lucius V122 trav AZJR03000277.1 20756554 GSYEQTIEPNQIQVYAYVGSKVQHSCKYSSEDRLLWYKQSPGSAPQYLLVIQLFTGDVVEDGFLDPRFSAKLNKEKTRVDLEISSAEVTDSALYYCALQ
Esox lucius V121 trdv AZJR03000277.1 20764867 DSIEQAITPLNPEVIAVEGTDITLSCNYKGNINNLQWYRQYSGSRPECLLLILKGSMFVQNTSITTARHTVKLKDKKTRVDLEISSAEVTDSALYYCALE
Esox lucius V119 trdv AZJR03000277.1 20822173 LTAGDHITPVVDEVIKTEGESVTLNCNYDLSSNYPILYWYRHYLNQAPQFILWKKARTWSGEQIPNNRYASTTSRISTKLVIQQLTLSDTALYYCALSDD
Esox lucius V118 trdv AZJR03000277.1 20848826 LAAKDQITPDKDEVISKEGKSVSLSCTYDTSSDSIFLYWYRHYPNQAPQFILWKGARSYSDPIYEQSSHERFKSTTSRTSTELVIQQLTLSDTAFYYCAVR
Esox lucius V117 trav AZJR03000277.1 20853712 CRGDNVNQQTGHVIVTEGGKVSLTCEYSTSATTPYLFWYKQETNDFPKHMLSRYPFGDGQNAAGFDKERFDADLNTKTKSVPLTIQRLHLSDSAVYYCALR
Esox lucius V116 trav AZJR03000277.1 20855978 VSSEDLTPLKNEEIGLEGTSVTLSCKYSRTANVGDYFYWYRQDTAQRPEFLLSIFGSDDITKVDSLNPRRSVKMNEEKNRVDLMISSAQVTDSALYYCAVR
Esox lucius V115 trav AZJR03000277.1 20866588 GSYENDIKPTSETEHVMEGSNITLSCNYSGSVRSLQWYCQYPRTEPKFLLSTTVSSKPFINRAQPEDPRLSVKLNEKKSQVNLEISSAEVTDSALYYCALE
Esox lucius V114 trdv AZJR03000277.1 20888149 SSLEDSITPTSPVEYFMEGSTVNLSCNYNVKANNLQWYRQYMGSAPAFLLLITDTSSPTVVNATLPYPRLTAKLNKERSRVDLEISSAEVTDSALYYCALQ
Esox lucius V113 trav AZJR03000277.1 20902135 GSYEDDIKPTSETEHVMEGSNITLSCNYSGSVRSLQWYRQYPRTEPKFLLSTTVSSKPSINRAQPEDPRLSIKVNEGRTRVDLEISSAKVTDSALYYCALQ
Esox lucius V112 trav AZJR03000277.1 20905143 DSVTQPTGDVITTEGGQVKLGCTFNTQVTNPYLFWYKQGANDHPKYMLMRFKLGSGDNAADFKDRFHADVDANANSVPLRIQDLQLSDSAVYYCALR
Esox lucius V111 trav AZJR03000277.1 20913018 EDSVTQPTEDVIATEGGQVTLGCTFNTQVTNPYLFWYKQGANDHPKYMLMRFKVGTTPGDNAADFKDRFHADVDANANSVPLRIQDLQLSDSAVYYCALK
Esox lucius V110 trav AZJR03000277.1 20917331 SVTQPTGDVITTEGEQVTLGCTFDTQDGGPYLFWYKQGANDHPKYMLMRPKYGTGDNAADFKDRFQADLDTKTNSIPLTIQRLQLSDSAVYYCALR
Esox lucius V109 trav AZJR03000277.1 20932708 SYEQTIEPNQQEVYVDEGSNVHLSCNYTSADSLLWYKQSPGSAPQYLMLILGPENVLRDDSLDSRFSGNQNKEKTCVDLYISSAEVTDSALYYCALR
Esox lucius V108 igkv AZJR03000257.1 141251 SIGQVTVTQTPVVEAVLPGQTVSLKCRTSSNVYGAGTSYPHMAWYQQKPGGAPKLLIYYAKTLQSGTPSRFSGSGDYSDFTLTISGVQAEDAGDYYCQS
Esox lucius V107 ighv AZJR03000142.1 18610 VHSEELTQPSSMTVQPGQPLTISCKVSYSVTSYHTGWIRQPAGKTLEWIGFIDSNGNTAYKESLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYCARY
Esox lucius V106 ighv AZJR03000142.1 20454 VFCQIELKQQDSTTVQPGQSLTLSCKVSGYSLTDTSYCTDWVRQPAGKALEWIGGICGSGNTYYSDKLKNKFSCSRDTSSSTVTLTGQSLQTEDTAVYYCARE
Esox lucius V105 trav AZJR03000142.1 22917 VNGQSTDSIPSNPVLKKPRETVNLSCKGSGFTFSSYGINWIRQPAGRELEWIVLIYYDASKTIYAKSIEGRIEITRDNNNSEVYLKLSGLRAEDSAVYYCAR
Esox lucius V104 ighv AZJR03000142.1 27499 VSCGSPELSQPSSMLVKPGESLTITCNVAGYSVSDGSVSYATGWVRKPAGKTMEWISHIWDNGDIYQNDALKNKFSISRDASINSVSLQGNSLKPEDTAVYYCVRCP
Esox lucius V103 ighv AZJR03000142.1 53309 VQGQSLTSSESVVKRPGERVTLSCTVSGFSMGSYYMHWIRQKPGKGLEWIGQIDTGTGTAFAQSLQGQFSITKDNSKNQLNLEVKSLKAEDSAVYYCAR
Esox lucius V102 ighv AZJR03000142.1 67598 VCCDIRLDQSRSQVIKPGDPVKLSCKTSGFQMTSFLMAWIRQKPGKGLEWIGTINCGSGSDPYYADSLKGQFTLTEDVPTSTQFLEANNLRAEDTAVYYCARQ
Esox lucius V101 ighv AZJR03000142.1 79442 VHCEELTQPPSMTVQPGQPLTISCKVSYSVSTYATAWIRQPAGKALEWIGWIYTGGSAYKDSLKNKFSLTLDSSSKTVTLTGQNLLAEDTAVYYCARD
Esox lucius V100 ighv AZJR03000142.1 84692 VQCQTLTESEPVVKKPGESDKLTCTGSGFTFSSYWMGWIRQVPGKGLEWIGSISGTTAYYSQSVQGRFTMSRDDSSSKLYLQMNSLKSEDTAVYYCA
Esox lucius V99 ighv AZJR03000142.1 98616 VHCEKLTQPPSMTVQPGQPLTISCKVSYSVSSYYTHWIRQPAGKALEWIGYPGGTIQKDSLKKKFSLTEDSSSNTVTLTGQNLEAEDTAVYYCARH
Esox lucius V98 ighv AZJR03000142.1 103995 VHCEELTQPPSMTVQPGQPLTISCKVSYSVSSYYTGWIRQPAGKALEWIGEIYTGGSTAYKDSLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYCAR
Esox lucius V97 ighv AZJR03000142.1 110024 VQSQTLTQSGPVVIKPGESHKMTCTASNLDINGWWMSWIRQAPGKGLEWIAAIGGSDSSSTYYSQSVQGRFTISRKNSIKQLYLQMNSLKTEDSAVYYCAR
Esox lucius V96 ighv AZJR03000142.1 117301 VQGQSLTSSESVVKRPGEPVTLSCTVSGFSMGSYWMHWIRQKPGKGLEWIGGIDGGTGTIFPQSLQGQFSITKDNSKNQLNLDVKSLKAEDSAVYYCAR
Esox lucius V95 ighv AZJR03000142.1 127178 VHSEELTQPPSMTVQPGQPLTISCKVSYSVSSYGTGWIRQPAGKALEWIGVIYYGGSTAYKESLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYCARY
Esox lucius V94 ighv AZJR03000142.1 129903 STTVQPGQSLTLSCKVSGYSLTDTSYCTNWVRQPAGKALEWIGKICGSGNTYYSDKLKNKFSCSRDTSSSTATLTGQSLQTADTAVYYCARE
Esox lucius V93 ighv AZJR03000142.1 146555 VQCQTLTESEPVVKKPGESHKLTCTGSGFTFSSYWMGWIRQVPGKGLEWIGSIHGTTAYYSQSIQGRFTMSRDDSSSKLYLQMNSLKSEDTAVYYCAR
Esox lucius V92 ighv AZJR03000142.1 152644 VQSQTLTQSGPVVIKPGESHQLTCTASNLDINSRWMAWIRQAPGKGLEWIATIQSSDGGSTYYSQSVQGRFTISRKNSIKQVYLQMNSLKTEDSAVYYCAR
Esox lucius V91 ighv AZJR03000142.1 161130 VQGQSLTSSESVVKRPGEPVTLSCTVSGFSMGSNYMHWIRQKPGKGLEWIGRIDTGTGTIFAQSLQGQFSITKDNSKNQLNLEVKSLKAEDSAVYYCAR
Esox lucius V90 ighv AZJR03000142.1 171087 VHCEELTQPPSMTAQPGQPLTISCKVSYSVSSYWTGWIRQPAGKALEWIGSIYTGNVAYKDSLKNKFSLTVDSSSSTVTLTGQNLQAEDTAVYYCARD
Esox lucius V89 ighv AZJR03000142.1 174873 VQGQSLTSSESVVKRPGEPVTLSCTVSGFSMGSYYMHWIRQKPGKGLEWIGRIDTGTGTAFSQSLQGQFSITKDNSKNQLSLEVKSLKAEDSAVYYCAR
Esox lucius V88 ighv AZJR03000142.1 183734 VHCEELTQPPSITVQPGQPLTISCKVSYSVSSYWTAWIRQPAGKALEWIGRIDTDGSTAYKGSLKNKFSITRDTSSNTLFLKGQSLQTEDTAVYYCARY
Esox lucius V87 ighv AZJR03000142.1 188536 VFCQTELTQPDSMTVQPGQSLTLSCKVSGYSLTDTSYCTHWVRQPAGKALEWIGEICGDGNTYYSDKLKNKFSCSRDTSSSTATLTGQSLQTEDTAVYYCARE
Esox lucius V86 ighv AZJR03000142.1 190979 VNGQSMESIPSNPVLKKPGETVNLSCKGSGFTFSSYGMHWIRQPAGRELEWIGVIWSDASKTVYAKSIEGRIEITRDNSNSEVYLKLSGLRAEDSAVYYCA
Esox lucius V85 ighv AZJR03000142.1 205369 VQCQTLTESEPVVKKPGESHKLTCTGSGFSFSSYWMGWIRQVPGKGLEWIGYIHGTTAYYSQSIQGRFTMSRDDSSSKLYLHMNSLKSEDTAVYYCAR
Esox lucius V84 ighv AZJR03000142.1 212960 VFCQIELKQQDSMTVKPGHSLTLSCKVSGYSLTDTSYCTNWVRQPAGKALEWIGRICGNGNTYYSDKLKNKFSCSRDTSSSTVTLTGQSLQTEDTAVYYCARE
Esox lucius V161 igkv AZJR03000634.1 1013590 SSADVILTQSPKSRSVSPGETVSISCSTSTSVGSYVSWYLQKPGDAPKLLVYYATSRQSGIPDRFSGSGSGSQFTLTISGIQGEDAGDYYCQQYD
Esox lucius V159 trgv AZJR03000277.1 4481671 SVSGQNLYQDQISETRRKGQRVAFKCKVTGECWGNYVFWYQRKEGGPFTWILFIQDNNVMLDNNFPQIADFSASLESGTYEVKIQSVKESHSATYYCACYKSG
Esox lucius V158 trgv AZJR03000277.1 4488390 SVSGQNLYQDQISETRRKGQRVAFKCKVTRECGGSYVFWYQRKEGGPFTWILWANLDYNSVSLDSTHPQRADFTATKQSDASQLKIQSVKESHSATYYCACYAG
Esox lucius V157 trgv AZJR03000277.1 4488390 SVSGQNLYQDQISETRRKGQRVAFKCKVTRECGGSYVFWYQRKEGGPFTWILWANLDYNSVSLDSTHPQRADFTATKQSDASQLKIQSVKESHSATYYCACYAG
Esox lucius V156 trgv AZJR03000277.1 4526767 QNLFQDQISETNRVKQSVYLNCKITGQCAGNIIHWYPKIESEPLTWILYIDLDDNTVSPDTTHPQKPDFSATKQSDSSQLKIRSVKESHSATYYCACYQSG
Esox lucius V155 igkv AZJR03000277.1 4538341 SGQKLDQEISFTRTQDQSVSFSCKNTDQCGSYIFWYQKKEGEPFNGIVSLQKVDCKVDTIYNHPEKNDFAVVRKENQCDLKIQSVKEYHSATYYCACFQSG
Esox lucius V154 igkv AZJR03000277.1 4538341 SGQKLDQEISFTRTQDQSVSFSCKNTDQCGSYIFWYQKKEGEPFNGIVSLQKVDCKVDTIYNHPEKNDFAVVRKENQCDLKIQSVKEYHSATYYCACFQSG
Esox lucius V153 trgv AZJR03000277.1 4544273 SVTGQTLDQEISFTRTQDQSVSFSCKNINQCGTYIFWYQKKEGEPFTVILNIKKSNGAVDAGYNHPQKDNFSASRKENQFHLKIQSVKESHSATYYCACYDTSG
Esox lucius V152 trgv AZJR03000277.1 4553912 SGQKLEQEISFTKKKDQSVSFSCKNTNQCSTYIYWYQKKEGEPFTVILDIKKNDGAVDASYNHPQKDDFSASRKENQCDLKIQSVKEYHSATYYCACYQSGTHSEN
Esox lucius V151 trgv AZJR03000277.1 4578759 SVSGQNLYQDQISETRRRGLTVSFRCKVIGRCLGSYVHWYQKKGEPFTWILWIDFDDNSFSNNKMHPQRSDFLVGRVSDSCDLTIQSVKDSHSATYYCACYDG
Esox lucius V150 trgv AZJR03000277.1 4579563 SGQTLEQEISFTRTQDQSVSFSCKNINQCGSYIFWYQKKEGEPFIVILDIQKSNGAVDAGYNHPQKDDFSASRKENQFHLKIQSVKESHSATYYCACYQSG
Esox lucius V149 trgv AZJR03000277.1 4593131 AEAVNLRQEQITLTRTVGKSGVIECRATDFSTSNIYWYFQKDGEALTRILFMNKGGGKPTRDPGYDHYQAEKGEGSLYTLRIPSLKTDNVGTYYCASFH
Esox lucius V148 trgv AZJR03000277.1 4594132 TEAVNLHQEKLTLTRTVGKSGVIECRATDFSTSNIYWYFQKDGEALTRILFMHKGGGKPTRDPGYDHYQAEKGEGSLYTLTIPSLSKDNAATYYCASFD
Esox lucius V147 trgv AZJR03000277.1 4595748 SENALLQQELSLTKAASKTALIRCHVKDLRSPYLHWYVHPEGETLTRVLYMATGSERTPEMRKQNKRWISEPGFEKFTVETAVGGQTYTLMISDLKTNNSGTYYC
Esox lucius V146 trdv AZJR03000277.1 20376548 ITTGAKMTPVKDEVINTEGESGTLSCTYDTSYTGTWFYWYRYYPDEAPKLLLYKSAKGSSYSDYIPDERYESTIHWSTNELVIKHVTLADTGLYYCALYDD
Esox lucius V145 trdv AZJR03000277.1 20392237 LTTGAKMTPVQDEVINTEGEPGTLSCTYDTSYTVTWFYWFRYYPDEAPKLLLYKSGKLSGASDYIPDERYESTIHWSTNELVIKHLTLADTGLYYCALFDD
Esox lucius V144 trdv AZJR03000277.1 20401833 MVNVDGVTPEKGEYTATEGSPVALTCTYETKSSNIYLYWYKQYANQEPQYLLYKGAGTNRDEQSSSKRYKCLTSQTSTTLEIKQVTLADTALYYCALKD
Esox lucius V143 trbv AZJR03000277.1 20417939 GCNGQTIEPTRHEVYSQSGSNVTLSCTYSSALSLLWYRQDPGSAPQFLSLVMNNAGTETPDKSLDPRLSAKRNNEKTRVDLEISSVKVADSALYFCALE
Esox lucius V142 trav AZJR03000277.1 20428950 GCNGQTIEPTRHEVYSLSGSNVTLSCTYSSAVYLLWYHQDPGSAPQFLSLVMNNAGTETPDKSLDPRFSAKRNNEKTRVDLEISSVEVADSALYFCALQ
Esox lucius V141 trav AZJR03000277.1 20432949 RSYEEDINPVRTEEHVFEGDVVTFSCKYTGSYATDTLMWYQQYPGSKPEFLLLVMEGMEKSTQNRLSVRVNEEKTHVDLKISSVEVTDSALYYCALQ
Esox lucius V140 trav AZJR03000277.1 20469599 GCNGQTIEPTRHEVYSLSGSNVTLSCTYSSAFSLLWYRQDPGSAPQFLSLVMNNAGTETPDKSLDPRLSAKRNNEKTRVDLEISSVEVADSALYYCALT
Esox lucius V139 trdv AZJR03000277.1 20480010 LTSGDSITPVNNEVISTEGESVTLNCTYETTDTNIWLYWFRHYPNQAPQYILFKSARQSKTEHIPDDRYQCTTSDTSTELVIQRLTLSDTALYYCAIEL
Esox lucius V138 trav AZJR03000277.1 20491517 YSLGDSINPLTTEELVQEGRNVNLSCKYDGNIFNVQWYRQYPRSRPHFLLFITPDGSVVPATSPYPRLKVTINKDEKRVDLEISSVDVTDSALYYCAMQ
Esox lucius V137 trav AZJR03000277.1 20492185 ISYEEDINPVRTEEHVFEGDVVTLSCKYTGSYGTSTLMWYQQHPGSKPEFLLLATEVMKESTQNRFSFRVNEEKTHVDLKISSVEVTDSALYYCALQ
Esox lucius V136 trdv AZJR03000277.1 20504243 LTAGDSITPGNNEVISSEGESVNLNCTYETTDTFPYLYWYRHYPNQAPQFILYKGARSSSAEHIPDKRYKSKTSATLTELIIQRLTLSDTALYYCAV
Esox lucius V135 trav AZJR03000277.1 20517646 LSSEQGITAYTDVQLATEKDRVKLSCNYTSGDTLQWYRQFPQAAPQLLIMEHIPSQTERITLNNDKNAKRLDLEISSAEVTDSALYYCAKR
Esox lucius V134 trav AZJR03000277.1 20519730 SVSQPREDETAIEGGQIILACHYKTENPSPYLFWYKQGANDYPKYMLMRFKFGTGDNATEFRDRFHADLDTETNSVPLTIQRLQLSDSAVYYCALRPTVTTG
Esox lucius V133 trav AZJR03000277.1 20528893 SRAEDSVTQPTEDVMAVEGQSTTLSCNFTADQTPYLFWYKQQGNSNPVFMMRRDQYSSGETDGEFENRFHAHLDVTTKSVPLTIQRLHLSDSAVYYCALK
Esox lucius V132 trav AZJR03000277.1 20547345 ISYEEDINPVRTEEHVFEGDVVTLSCNYTGSYSSDTLMWYQQHPGSKPEFLLLATEVIKESTQNRLSVRVNEEKNRVDLKISPVEVTDSALYYCALQ
Esox lucius V131 trdv AZJR03000277.1 20570393 LTAGDSITPGNNEVISTEGESVTLNCTYETTDTYPYLYWYRHHPNQAPQFILYKQARTSTEHIPDKRYKSTTTATLTELLIQRLTLSDTALYYCAV
Esox lucius V130 trdv AZJR03000277.1 20579179 LIDGDSITPGNNEVISSEGESVTLNCTYETTYTPYLYWFRHYPNQAPQFILWKGARSSSAEHIPDKRYKSTTTATLTELVIQQLTLSDTALYYCALR
Esox lucius V129 trav AZJR03000277.1 20611573 DSVTQPTEDVMAVEGQSTTLSCKFTTDQTPYLFWYKQQGNSNPVFMMRRDQYSSGETDVEFENRFHAHLNVTTKSVPLRIQRLHLSDSAVYYCALR
Esox lucius V128 trav AZJR03000277.1 20665731 CGGDSVSQPREDVTAIEGGQIILACDYKTDDPSPYLFWYKQGANDYKKYMLMRFKFGTGDNATEFRDRFHADLDAEKKSVPLTIQRLQLSDSAVYYCALR
Esox lucius V127 trav AZJR03000277.1 20682240 DSIEQETITPLNPEFNAVEGTDITLSCNYKGNINYLHWYRQYPGSRPECLLLILQANSFVQNTSITTARHTGGVNDEKTRVDLNISSVEVTDSALYYCALQ
Esox lucius V126 trav AZJR03000277.1 20711977 LSAGDSITPGNNEVISTEGESVTLNCTYETTYTPYLYWFRQYPNQAPQFILYKGAKSASDEEEIPDKRYKSKTTDTSTELVIQQLTLSDTALYYCAV
Esox lucius V125 trav AZJR03000277.1 20717289 LSSEQVITPYTDVQLATEKDRVKLSCNYTSGDTLQWYRQFPQSAPQLLIMEHIPSQTERITLNNDKNAKRVDLKISSAEVTDSALYYCAMR
Esox lucius V124 trav AZJR03000277.1 20727554 SRAEDSVTQPTEDVMAVEGQSTTLSCKFTADLTPNLFWYKQQGNSNPVFMMRRDQYSSGETDGEFENRFHAHLNVTTKSVPLTIQGLHLSDSAVYYCALR
Esox lucius V200 igkv AZJR03001173.1 12792 SRGQVTVTQTPVVEAVLPGQTVSLKCRTSSNVYQAGTSTPRMAWYQQKPGGAPKLLIYNAKTLQSGTPSRFSGSGDYSDFTLTINGVQAEDAGDYYCQS
Esox lucius V199 igkv AZJR03001173.1 22155 QYILTQSPAVQSVTTGNSVTMTAKSAVMCIIIDLAWYQQKPGGAPKLLIYLANRLQSGIPSRFSGSGAGSDFALIISGVQAEDAGDYYCQS
Esox lucius V198 igkv AZJR03001173.1 41457 SRGQATVTQTPAVEAVLPGQTVSLKCKTSSDVYQAGTSNPRMAWYQQKPGGAPKLLIYYAKTLQSGIPSRFSGSGEYSDFTLTISGVETEDAGDYYCQS
Esox lucius V197 igkv AZJR03001164.1 13216 SRGQYILTQSPAVQSVRTGNSVTMNCKVSSNVLGNDYLAWYQQKPGGAPKLLIYYANTLQSGTPSRFSGSGSGSDFTLTISGVQGEDAGDYYCQS
Esox lucius V196 trbv AZJR03001131.1 10449170 LSLNVEVHQNPSAVISRPGENVQLFCHHQKTDYGVMLWYQKSPGETALKLIVYLNFQSQSVERLYENHFNMSGDLSGNSPKNASLNVFNLGPEDTAVYFCAASYAQC
Esox lucius V195 trbv AZJR03001131.1 10449170 LSLNVEVHQNPSAVISRPGENVQLFCHHQKTDYGVMLWYQKSPGETALKLIVYLNFQSQSVERLYENHFNMSGDLSGNSPKNASLNVFNLGPEDTAVYFCAASYAQC
Esox lucius V194 trbv AZJR03001131.1 10449170 LSLNVEVHQNPSAVISRPGENVQLFCHHQKTDYGVMLWYQKSPGETALKLIVYLNFQSQSVERLYENHFNMSGDLSGNSPKNASLNVFNLGPEDTAVYFCAASYAQC
Esox lucius V193 trbv AZJR03001131.1 10449829 VSLSKEVYQSPSMMLVMPGGPLTLNCSHKISNYDTILWYHFSVGDTALKLIGYSYYKTPNVEPTYKGYFNVSGDGEKEASLHFLKLRQTEDTAVYFCAASY
Esox lucius V192 trav AZJR03001131.1 10463189 LAEGSEVTQSPEVLLQLKGYNAQINCKHTKDFSYSQMYWYRQLPGEGMKQIIYITTTNKPEYSGGFSEDKFSATKTVAESGSFTVKKLETGDSGMYFCAVS
Esox lucius V191 trav AZJR03001131.1 10463189 LAEGSEVTQSPEVLLQLKGYNAQINCKHTKDFSYSQMYWYRQLPGEGMKQIIYITTTNKPEYSGGFSEDKFSATKTVAESGSFTVKKLETGDSGMYFCAVS
Esox lucius V190 trav AZJR03001131.1 10463189 LAEGSEVTQSPEVLLQLKGYNAQINCKHTKDFSYSQMYWYRQLPGEGMKQIIYITTTNKPEYSGGFSEDKFSATKTVAESGSFTVKKLETGDSGMYFCAVS
Esox lucius V189 trbv AZJR03001131.1 10464567 LAEGSEVTQGPMVLLQPKGRNAQMNCRHTKDVGYSQMYWYRQLPGEGMKQIIYITTSNKPEYSGEFSEVKFSANKTEAQSGSFTVKKLETGDSGMYFCAVS
Esox lucius V188 trbv AZJR03001131.1 10464567 LAEGSEVTQGPMVLLQPKGRNAQMNCRHTKDVGYSQMYWYRQLPGEGMKQIIYITTSNKPEYSGEFSEVKFSANKTEAQSGSFTVKKLETGDSGMYFCAVS
Esox lucius V187 trbv AZJR03001131.1 10464567 LAEGSEVTQGPMVLLQPKGRNAQMNCRHTKDVGYSQMYWYRQLPGEGMKQIIYITTSNKPEYSGEFSEVKFSANKTEAQSGSFTVKKLETGDSGMYFCAVS
Esox lucius V186 trbv AZJR03001131.1 10469027 SSQSDQVHQSPADLFKNQGDSAKMECSHSIPMFNTILWYKQDGHRKLIFIGYMLLKTGTPEPGFNITLDGDANQGGTSTLTINQLTPECSAVYFCAAS
Esox lucius V185 trbv AZJR03001131.1 10469027 SSQSDQVHQSPADLFKNQGDSAKMECSHSIPMFNTILWYKQDGHRKLIFIGYMLLKTGTPEPGFNITLDGDANQGGTSTLTINQLTPECSAVYFCAAS
Esox lucius V184 trbv AZJR03001131.1 10469027 SSQSDQVHQSPADLFKNQGDSAKMECSHSIPMFNTILWYKQDGHRKLIFIGYMLLKTGTPEPGFNITLDGDANQGGTSTLTINQLTPECSAVYFCAAS
Esox lucius V183 trbv AZJR03001131.1 10479556 SSLSDQVHQNPADLFANQRESAKIECSHSISSSNVILWYKQDQHRKLIFLGYMAGTSKKPDTGFNITLDGNASANHKSTLTINPTTPEFSAVYFCAAS
Esox lucius V182 trbv AZJR03001131.1 10479556 SSLSDQVHQNPADLFANQRESAKIECSHSISSSNVILWYKQDQHRKLIFLGYMAGTSKKPDTGFNITLDGNASANHKSTLTINPTTPEFSAVYFCAAS
Esox lucius V181 trbv AZJR03001131.1 10479556 SSLSDQVHQNPADLFANQRESAKIECSHSISSSNVILWYKQDQHRKLIFLGYMAGTSKKPDTGFNITLDGNASANHKSTLTINPTTPEFSAVYFCAAS
Esox lucius V180 trdv AZJR03001081.1 2622425 WPFTKALTQPDPVIVTHFGCTVSLTCFCSSNMMNNVVWFKQSPLPMVSSSHFSLKSFYFNNSIKEFNGNKRLSVKRAEDCFNLTISKTEPGDSATYYCAALY
Esox lucius V179 trdv AZJR03001050.1 10746 LTAGDSITPGNNEVISTEGESVTLNCTYETTDTTPWLYWYRHYPNQAPQFILYKLARSSSSEHIPDKRYKSKTSATLTELVIQQLTLSDTALYYCALR
Esox lucius V178 trav AZJR03001050.1 13899 GCNGQTIEPTRHEVYSLSGNNVTLSCTYSSAYSLLWYRQDPGSAPQFILLVLHGTGSEARASNLDSCLSAILNNDKTCVDLEVDCVEVADSALYYC
Esox lucius V177 trdv AZJR03001050.1 31472 LIAGDSITPGNNEVISSEAESVTLNCTYQTLYTYIYLYWYRHYPNQAPQFILWKGAKSYKDRKHIPYNRYESTTSDTSTKLVIQQLTLSDTALYYCAV
Esox lucius V176 trdv AZJR03001050.1 54530 ISYEEDINPVRTEEHGFEGDVVTLSCNYTGSYSSDALMWYQQHPGSKPEFLLLATEVIKESTQNRLSVRVNEEKTHVDLKISPVEVTDAALYYCALQ
Esox lucius V175 ighv AZJR03001014.1 36330 VHSEELTQPPFMTVQPGQPLTISCKVSYSVSSYGTGWIRQPAGKALEWIGWIYTGATYQKDSLKNKFSLTLDSSSKTITLTGQNLQAEDTAVYYCAR
Esox lucius V174 igkv AZJR03001001.1 51208 SRGQVTMTETPAVEAVPPGKTASLKCRTSSNVYGAGSTPRMTWYQQKPGGSPKLLIYWANRRASGTPSRFSGSGDYSDFTLTISGVQTEDAGDYYCQSYHEINSKSV
Esox lucius V173 igkv AZJR03001001.1 51208 SRGQVTMTETPAVEAVPPGKTASLKCRTSSNVYGAGSTPRMTWYQQKPGGSPKLLIYWANRRASGTPSRFSGSGDYSDFTLTISGVQTEDAGDYYCQSYHEINSKSV
Esox lucius V172 igkv AZJR03000695.1 132020 SRGQVTVTQTPASEAVLPGQTVSLKCRTSSDVHPNCGSLLPCMAWYQQKPGSIPKLLVYQGSTLNSGIPSTYSGSGSGSDFTLTISGVQTEDAGDYYCQS
Esox lucius V171 igkv AZJR03000695.1 145477 SRGQYILTQSPAVQSVTTGNSVTMNCKVSSNVYGNDRLAWYQQKPGGAPKLLIYLAKTLQSGTPSRFSGSGSGSDFTLTISGVQTEDAGDYCQS
Esox lucius V170 igkv AZJR03000695.1 181712 QYTVTQTPAVEAVLPGQTVSLKCRNSSNVHGTCWNGQSSHDRQCLAWYQQKPGGAPKLLIYSANILQSGTPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQSFPSWVI
Esox lucius V169 igkv AZJR03000695.1 185391 QYILTQSPVVQSVTTGNSVTMNCKVSSNVYNNNYLAWYQQKLGGAPKLLIYYANTLQSGVPSRFSGSGSGSDFTLTISGVQAEDAGDYYCQS
Esox lucius V168 igkv AZJR03000666.1 254249 QYILTQSPAVQSVLTGNSVTMNCKVSSNVYNNDYLAWYQQKSGGAPKLLIYRASTLPSSAPSRFSGSGSGSDFTLTISGVQGEDAGDYYCQSYHEISSKSV
Esox lucius V167 igkv AZJR03000666.1 267052 SRGQYILTQSPAVQTVTTGNSVTMNCKVSSNVFGNDRLAWYQQKPGGAPKLLIYYANTLQSGVPSRFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Esox lucius V166 igkv AZJR03000666.1 267052 SRGQYILTQSPAVQTVTTGNSVTMNCKVSSNVFGNDRLAWYQQKPGGAPKLLIYYANTLQSGVPSRFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Esox lucius V165 igkv AZJR03000664.1 7804558 QHTLTQTPVVETVLVGKTVSVKCKASSDVYPDCNKSGKPYLAWYQQKPGETPKALVYHGRQSYSWTPSRFSGSGSGSDFTLTISGVQPEDTGDYYCQSVHSGDV
Esox lucius V164 igkv AZJR03000664.1 7804558 QHTLTQTPVVETVLVGKTVSVKCKASSDVYPDCNKSGKPYLAWYQQKPGETPKALVYHGRQSYSWTPSRFSGSGSGSDFTLTISGVQPEDTGDYYCQSVHSGDV
Esox lucius V163 igkv AZJR03000664.1 7804558 QHTLTQTPVVETVLVGKTVSVKCKASSDVYPDCNKSGKPYLAWYQQKPGETPKALVYHGRQSYSWTPSRFSGSGSGSDFTLTISGVQPEDTGDYYCQSVHSGDV
Esox lucius V201 igkv AZJR03001173.1 12792 SRGQVTVTQTPVVEAVLPGQTVSLKCRTSSNVYQAGTSTPRMAWYQQKPGGAPKLLIYNAKTLQSGTPSRFSGSGDYSDFTLTINGVQAEDAGDYYCQS
Esox lucius V162 igkv AZJR03000664.1 7804558 QHTLTQTPVVETVLVGKTVSVKCKASSDVYPDCNKSGKPYLAWYQQKPGETPKALVYHGRQSYSWTPSRFSGSGSGSDFTLTISGVQPEDTGDYYCQSVHSGDV
Esox lucius V123 trgv AZJR03000277.1 20751300 LTAGDSITSVNNQVISTEGESVTLNCTYETSSDYPYLYWYRHHPNQAPQFILYKGAKSFKDHKYIPDNRYESTTSDTSTKLVIQQLTLSDTALYYCALW
Esox lucius V120 trav AZJR03000277.1 20782514 SYEQTIEPNQLQVYADVGSKVQHSCKYSSEDRLLWYKQSPGSAPQYLLVIQLFTGDVVEDGFLDPRFSAKLNKEKTRVDLEISSAEVTDSALYYCALQ
Esox lucius V83 ighv AZJR03000142.1 224865 VHCEELTQPPSMTVQPGQPLTISCKVSYSVTGYYTAWNRQPAGETLEWIGYIRTDGSIVYKDSLKNKFSITRDTSRNTLFLKGQSLQTEDTAVYYCARE
Esox lucius V44 iglv AZJR03000744.1 2170180 VSGVVVVTQKPPVVTVRKGEMVTLDCNTGGDGKIAFWYKHVQGGVPRFVLYYHHSYSSVKYGSGFSSPKFTCNHQSQSDYQFIINNVEESDSAVYYCKTLDGSAKEYV
Esox lucius V21 trav AZJR03000505.1 22419 SVTQPPGDVITTEGGQVTLGCTFNSQVANSYLFWYKQGANDHPKYMLMQPKYGTGDNAADFKDRFHADLDTKTNSIPLTIQRLQLSDSAVYYCALR