WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Fundulus heteroclitus JXMV00000000.1 (JXMV01) 133 57 0 14 26 33 2 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Fundulus heteroclitus V36 trav JXMV01003996.1 8287 LVSNARIEQSLPQIVRENAQVQIYCSHDDKGRPFMLWYQQKNDSHPIFIGYEYGGKSQVYDGQFDEQFKMERESSLTGVLTLRSANLAHSAVYFCATT
Fundulus heteroclitus V35 trav JXMV01098116.1 127 SRGQVTVTQPAAVRADLGGSATISCKTSQNVYNNELAWYQQKDGEFPKLLMYDVNEQAAGIPGRFKGSGSRSDFTLTISGVQAEDAAVYL
Fundulus heteroclitus V34 igkv JXMV01098100.1 7081 SRGQVTVTQPAAVTADLGGPARITCRTSQNVYGNIHLAWYQQKDGQPPKLLFYYVGNRFSISIRFNDGGSKSDFTLTISGVQAEDAAVYYCQSYHEISSQVV
Fundulus heteroclitus V33 trav JXMV01064770.1 148 CKGDSVKQTEGDVVAAQGESLTLGCTFETSDTYPYLFWYRQEGNSYPNYILKRDPKNSENAPEFSKDRFSADLDIEPNRKSVNLKIQDPQLSDSAVYYCALQ
Fundulus heteroclitus V32 ighv JXMV01064142.1 16413 VYGQTLTESEPVVKRPGESHKLTCTTSGFSLSSYHMHWIRQAPGKGLEWVAYVSNGGGSTYYSQSVRGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCARE
Fundulus heteroclitus V31 ighv JXMV01064142.1 10444 VAGQTLTESESVVKRPRESHTLTCTASGFTLSSYAMNWIRQSPGKRLEWIAYIGTRGYPIYYSNSVQGRFTISRDDSNSKIYLKMNQLKTEDTAVYYCARE
Fundulus heteroclitus V30 ighv JXMV01064142.1 1142 VRCEQLTQPASLTVQPGQALRISCQVSYSVNTYTTTWVRQPAGKALEWMGAIWSGGSTYYANSVQGRIEITRDTSKNIVNLRLSTMRPEDSAVYYCAR
Fundulus heteroclitus V29 ighv JXMV01063323.1 142 VKCEQLTQPASVTVQPGQRLTISCQVSYDLSYWTAWIRQAAGKGLEWIGMNDSYGSSRYKDSLKNKFSIDVVTSSSTVTLNGQTMQPEDSAVYYCAR
Fundulus heteroclitus V28 igkv JXMV01062392.1 1855 IILTQSPGSHSVSSGQTVSIRCKTSSSVSTSYLHWYLQKPSEAPKLLIYSTSNRHSGVPARFSGSGSGSSDYTLTISGVQAEDSGVYYCQQGYD
Fundulus heteroclitus V27 ighv JXMV01062322.1 1279 VKCEQLTQPASVTVQPGQSLAISCQVSYSLSSYYTAWIRQPAGKGLEWIGMKFTRASYYKDSLQNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCARE
Fundulus heteroclitus V26 igkv JXMV01060161.1 997 VKCEQLTQPASVTVQPGHRLTISCQVSYDLDSYATAWIRQPAGKGLEWIGMKYTGDSAYKDSLKNKFSIDLDTSSKTVTLNGQNIQPEDSAVYYCVRYHS
Fundulus heteroclitus V25 ighv JXMV01059448.1 1124 TDGQTLTESESVVKRPGESHRLTCTYSGFSSTPHISWIRQAAGKGLEWIAYISSGSGYIYYSDLVKNRFTISRENSRNQVYLQMNSLTAEDSAVYYCARE
Fundulus heteroclitus V24 ighv JXMV01055884.1 970 VHSIDLIQPDSKVVQPGQSLTITCRPSGYSVTDSSYATGWIRHRQGKPMEWIFDMWGGGTFYQNDALKNKFSYSRDTSAGTVTITGQSLQPEDTAVYYCVRRPTEIQ
Fundulus heteroclitus V23 ighv JXMV01055883.1 1853 VYCIDLIQPDSKVVQPGQSLTITCRPSGYSLTDDDYATGWIRHRQGKPMEWIFHMWGTSGLVQNDALKNKFSYSRDTSAGTVRITGQSLQPEDTAVYYCVRRRTVIQ
Fundulus heteroclitus V22 ighv JXMV01055882.1 1962 VHSIDLIQPDSKVVQPGQSLTITCRPSGYSVTDSSYATGWIRHRQGKPMEWIFDMWGGGTFYQNDALKNKFSYSRDTSAGTVTITGQSLQPEDTAVYYCVRRPTEIQ
Fundulus heteroclitus V21 ighv JXMV01055063.1 4568 VKCEQLTQPASLIVQPGQALSISCQVSYSVTSYGTNWISQPAGKALEWMGVIWSGGSTYYANSVQGRIGMTRDTSKKIVNLRLSTMRPEDSAVYYCAR
Fundulus heteroclitus V20 trav JXMV01055063.1 1227 VRCEQLTQPASLTVQPGQALSISCQFSYSVTSYGTTWVRQPAGKALEWMRVIWSGGSTYYANSVQGRIGITRDTTKNIVNLRLSTMKPEDSAVYYCARDLQWLMG
Fundulus heteroclitus V19 ighv JXMV01055062.1 1885 VKCEQLTQPASMIVQPGQRLTISCQVSYSVRGFYTAWIRQPAGKRLEWIGAVAHGYTTSYKDSLRNKFRLSADLSSNTVALNGQNMQPEDSAVYYCAKQ
Fundulus heteroclitus V18 ighv JXMV01052735.1 3826 VKCEQLTQPASVTVQPGQRLTISCQVSYDLDSYYTAWIRQPAGKGLEWIGWKRAGYSLYKDSLKNKFSIDLDTSSKTATLNGQNMQPEDSAVYYCARR
Fundulus heteroclitus V17 trav JXMV01052732.1 223 VKCEQLTQPASVTVQPGQRLTISCQVSYDLSSYLTAWIRQPAGKGLEWIGHAGEGWTTRYKESLKNKFSISFVSSSKTVTLNGQNMQPEDSAVHYCARY
Fundulus heteroclitus V15 trav JXMV01049336.1 152 CKGDSVKQTEGDVVAAQGGALTLGCFYETTFTGYTLFWYKKEENSFPQYMLKQLTSSKDKAPEFNSNKFDANINTGEKTFNLTIQDLQLSDSAVYYCALQ
Fundulus heteroclitus V14 ighv JXMV01047443.1 400 VRCEQLTQPASLTVQPGQALSISCQVSYSVTSYSTTWVRQPAGKALEWMGAIWSFGVTVNANSLQGRIEITRDTSKNIVNLRLSTMKPEDSAVYYCARDTQ
Fundulus heteroclitus V13 ighv JXMV01047440.1 3915 VKCEQLTQPASLTVQPGQALSISCQVSYSVTSYGTTWVRQPAGKALEWMGIIWWDGNKAYANSVQGRIGITRDTSKNIVNLRLSTMRPEDSAVYYCARY
Fundulus heteroclitus V12 ighv JXMV01047439.1 14401 VKCEQLTQPASLTVQPDQPLTISCQVSYSLSSYWTHWIRQPAGKGLEWIGSVRIGYNTYYKDSLKNRFSITLQDSSKTVTLNGQNLQPEDSAVYYCARE
Fundulus heteroclitus V11 ighv JXMV01047439.1 10141 VRCEQLTQPASLTVQPGQALSINCQVSYSVTSYGTHWIRHPAGKALEYMGVLWGDGSNRHANSVQGRIGITRDTSKNIVNLRLSTMRPEDSAVYYCARLA
Fundulus heteroclitus V10 trav JXMV01047439.1 8075 VKCEQLTQPASMTVQPGQSLTISCQVSSVSSYTHWIRQPAGKGLEWIGAVAHGSTTYYKDSLRNKFSLSAVSSSNTVTLNGQTMQPGDSAVYYCARD
Fundulus heteroclitus V9 ighv JXMV01047439.1 3254 TEGQTLTESEPVVKRPGESHRLTCTYSGFSGNPWIAWIRQAAGKGLEWIAYTCNGCTPMYKDSLKNKFSIAIQTSSSTVTLNGQNLQPEDSAVYYCAR
Fundulus heteroclitus V8 igkv JXMV01047301.1 202 QVTITQTPGSQSVVPGQTVSIKCKVNPSTSYCFNWYLQKPGESPKLIVRCTNTRQSRVPDRFSGTNPENTDFTLTISGVEAEDVGVYYCQNSQRINSQDL
Fundulus heteroclitus V7 igkv JXMV01047296.1 156 QVTVTQPAAVTADLGGSAKITCRTSQDVFYSFFLTDSNECLAWYQQKDGQTPKLLIYNANTQASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSYHAINGEVV
Fundulus heteroclitus V6 igkv JXMV01046506.1 2829 SRGQVTVTQPAAVTADLGGSARIPCRTSQNVYGSDRLAWYQQKDGQPPKLLIYYASTRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Fundulus heteroclitus V5 ighv JXMV01046432.1 631 VHCIDLIQPDSEVVQPGQSLTITCRPSGYSVTDSSYATGWVRHRQGKPMEWIFHMWGSGSLTKNDALKNKFSGSRDTSAGTVTITGQSLQPEDTAVYYCVRCRTVMQ
Fundulus heteroclitus V4 ighv JXMV01046426.1 2111 VHCIDLIQPDSEVVQPGQSLTITCRPSGYSVTDNSYATGWVRHRQGKPMEWIFHMWGSGSFYQNDALKNKFSYSRDTSAGAVTITGQSLQPEDTAVYYCVRR
Fundulus heteroclitus V3 trav JXMV01043895.1 6955 SVKQTEGHAVAAQGDNATLQCTFETNSFANPYLFWYKQEKNKNLRHILTRVRGTGMNSELFNKDRFDADLQDTSISLTIQDLQLSDSAVYYCALQPTVTG
Fundulus heteroclitus V2 igkv JXMV01043481.1 467 CSAQVTVTQPPLVTFTPGSTATIKCTTNPAVYRWSDDDQGMYWYQQKPGQPPKLLIYRVNKLHSGTPARFSGSGSGTDFTLTISGVQAEDAADYYCQSLHYINKNV
Fundulus heteroclitus V1 igkv JXMV01015164.1 413 IILTQSPGSQSVASGQTVSIRCKTSSYVSSSLHWYLQKPSEAPKLLIYLASSRQSGVPARFSGSGSGSDFTLTISGVQAEDSGVYYCQQGYSYP
Fundulus heteroclitus V0 igkv JXMV01015162.1 9577 SEGQNVVVTQPAAKSVQLGQTVTIDCKASRQVGCSTPCLAWYHQKPGEAPKALIYGTSSRLSGISSRFSGSGAGNGLDFTLTISGVQAEDAGVYYCQSAHYINSQWL
Fundulus heteroclitus V74 igkv JXMV01053836.1 909 QNTGGSSSTFIRQEEGFHSASVGSSITLPCFYSEGAVMIYWFKQTLGQKPDVVVTFYKHDKHGTFYNEHKNNSRLALEVGNGKTHLQISDLHPSDSATYYCVAID
Fundulus heteroclitus V73 trav JXMV01053533.1 1065 CKGDSVKQTEGDVVAAQGGSLTLGCIYQSATTPTLFWYKQEENSFPKYMLKQLTSSKYKAPEFNNNRFEADINNDKKTFNLTIQDLQLSDSAVYYCALQ
Fundulus heteroclitus V72 igkv JXMV01052702.1 955 SRGQVTVTQPAAVTADLGGSARITCRTSQDVFYDYSDYYLAWYQQKNGQTPKRLIYYASSRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Fundulus heteroclitus V71 ighv JXMV01052048.1 1223 VAGQTLTESEPVVKRPGESHTLTCTASGFTFSSYEMSWIRQATGKGLEWVAYVSYGGGSTYSQSVRGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCALE
Fundulus heteroclitus V70 ighv JXMV01052048.1 4650 VRCEQLTQPASLTVQPDQALSISCQVSYSVTSYGTHWARQPAGKALEWMGVIWNGGGTAYANSVQGRIGITRDTSKNIVNLRLSSMRPEDSAVYYCARD
Fundulus heteroclitus V69 trdv JXMV01052047.1 3873 AWSQIRLDQSASEVKRPGETVKMSCVISGYSMTIHDIHWIRQRPGRALEWIGWMNTGNNDASYASSFQSGFIMTENVPSSTQYLEIRSLTAEDSAVYFCARR
Fundulus heteroclitus V68 ighv JXMV01052047.1 7120 VDGQTLTQSEPVVKRPGESHKLTCTTSGLSFSSWWMAWIRQAPGKGLEWIATDARGKGQYSQSVQGRFVVSRDNGREQLFLQMNSLKTEDSAVYYCARD
Fundulus heteroclitus V67 ighv JXMV01052046.1 589 VDGQTLTQSEPVVKRPGESHKLTCTTSGLSFSSVWMAWIRQAPGKGPEWVATEALGSVQFYSQSVQGRFVVSRDNGREQLFLQMNSLKTEDSAVYYCARV
Fundulus heteroclitus V66 ighv JXMV01048688.1 3379 VYCQILKESEPMVKRPGESHILTCTGSGFTFSSYLMAWIRQAPGKGLEWVSTIDVSSKYYSQSVRGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCA
Fundulus heteroclitus V65 trav JXMV01048686.1 1639 FNSQALESIPSTSVVKKPQEVLSLSCRGSGFDFSRYGMHWIRQSAGNPLEWMGLIYYDASKTVYASSVDGRIEITRDNSNSMVYLRLSDLKPEDSAVYYCAK
Fundulus heteroclitus V64 ighv JXMV01048682.1 1010 INAQTLMESESVIKRPGESHKLTCTASGFTFTDYAMAWIRQAPGKGLEWVARVSKPSGRDQYYSPPVQGRFTISRDNSKQQVHLQMNSLKAEDSAVYYCAR
Fundulus heteroclitus V63 ighv JXMV01048680.1 933 QTLRDDESVVKNPGDSHMLTCTASGFTFSDYWMAWIRQAPGKRLEWLASMYDSPNITYNPSNIYHSQSVQGRFIISRDNSKQQVYLQMNSLKTEDSAVYYCARE
Fundulus heteroclitus V62 trbv JXMV01048304.1 1255 VWSEIKLQQPPSEVKRPGETVRISCVTSGYTMTNNGMNWIRQKPGKGLEWIGWINTATTAATYASSFQSRFSFSQDVPSSTKYLEISSLTTEDSAVYFCAR
Fundulus heteroclitus V61 ighv JXMV01048303.1 468 VRSEQLTQPPSLNVQPGHQLTISCQVSYSVSSYQTHWIRQPAGKGLEWIGYMCDGCSGASKDSLKNKFSITVQASSKTVTLNGQNMQPEDSAVYYCARR
Fundulus heteroclitus V60 trbv JXMV01048302.1 894 AWSEIKLDQSASEVKRPGETVKMSCVISGYSMTSYNIHWIRQRPGRALEWIGYMYTGDNNPSYASSFQSRFIMTENVPSSTQYLEISSLTAEDSAAYFCARE
Fundulus heteroclitus V59 ighv JXMV01048300.1 452 VHCIDLIQPDSKVVQPGQSLTITCRPSGYSVTDGSYATGWIRHRQGKPMEWIFHMWGSGTFYKNDALKNKFSYSRDTSAGTVTITGQSLQPEDTAVYYCVRRPTEIQ
Fundulus heteroclitus V57 ighv JXMV01033880.1 1411 VFSIDLIQPDSKVVQPGQSLTITCQPSGYSLTDRYATGWIRQREGKTMEWIFDKWGHNGDFYQNNALKNKFSYSKDTSAGTITITGQNVQPEDTAVYYCVRR
Fundulus heteroclitus V56 trbv JXMV01033880.1 4450 VFSEIKLEQSASVAKRPGETVKMSCITSGFDMTEYYMHWIRQKPGRALEWIGRMDAGENSAIYGSSFQSGFIMTENVPSSTQYLEISSLTAEDSAVYFCARE
Fundulus heteroclitus V55 ighv JXMV01033877.1 1571 VKGEQLTQPASVTVQPGQRLTISCQVSYSMSTYATAWIRQPDGKGLEWIGWKYTGGSYYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCAR
Fundulus heteroclitus V54 ighv JXMV01033877.1 6900 TDGQTLTESESVVKRPGESHRLTCTYSGFGGNPWIAWNRQAAGKGLEWVSAITESGGSTYYSQSVRGRFTISRENSRNQVYLQINSLTAEDSAVYYCARE
Fundulus heteroclitus V53 ighv JXMV01033876.1 1702 VFSIDLIQPDSKVVQPGQSLTITCRPSGYSLTDSYATGWIRQREGKTMEWIFHKWGHNGDFYQNNALKNKFSYSKDTSAGTITITGQNVQPEDTAVYYCVRR
Fundulus heteroclitus V52 ighv JXMV01033876.1 6605 VAGQTLTESEPVVKRPGESHRLTCTGSGFTFSSYHMNWVRQAPGKGLEWIAFVYTSSSYFFYSQSVQGRFTISRDDSSSKVYLQMNNLRTEDTAVYYCA
Fundulus heteroclitus V51 ighv JXMV01033876.1 8078 VAGQTLTESEPVVKRPGESHRLTCTGSGFTFSSYPMNWVRQASGKGLEWIAFVHTGSSHLFYSQSVQGRFTISRDDSSSKVYLQMNNLRSEDTAVYYCARG
Fundulus heteroclitus V50 ighv JXMV01033875.1 4334 IDGQTLTQSEPVVKRPGESHTLTCTASGFTFGDYWMNWVRQAPGKGLEWVATISYWAGSDKRYSQSVQGRFSISRDNGKQQLVLQMKNLKAEDSAVYYCARG
Fundulus heteroclitus V49 ighv JXMV01033875.1 5715 VKCEHLTQTASVALQPGQQLVLSCQVSYSVGSHHTHWIRKPAGKGLEWIGGARVGYASYQKDSLKNKFSYSLDSSSNTVTLNGQNMQPEDAAVYYCARQ
Fundulus heteroclitus V48 ighv JXMV01033875.1 8249 CTGQQMESIPSSPVVKRPGETLSLSCRGSGFTFSCCVMVWVRETSGKSLEWLGSGFSDASRNVYASSVRGRIEISRTDSDSMVHLRLSNLKPEDTAVYYCAKAA
Fundulus heteroclitus V47 ighv JXMV01033874.1 11214 SVGQTLTESEPVVKRPGESHRLTCKYSGFSGTPHIGWVRQEAGKGLEWIAWIHSNGGESYYSQSVKNRFTISRDNHRNQVDLQLNSLTSQDSAVYYCARK
Fundulus heteroclitus V46 ighv JXMV01033874.1 13246 TDGQTLTQSESVVKRPGESHRLTCTLSGFTSTPYINWIRHAAGKRLEWLGWINPAGDSSGFSESVRDRFTISRDNNKQQVYLQINSLKTEDSAVYYCVRD
Fundulus heteroclitus V45 ighv JXMV01033874.1 25905 VFSIDLIQPDSKVVQPGQSLTITCRPSGYSLTDRYATGWIRQREGKTMEWIFHMWGHDGDFYQNNALKNKFSYSRDTSAGTVTITGQNVQPEDTAVYYCVRR
Fundulus heteroclitus V44 ighv JXMV01033873.1 2511 QSLESIPSSQVVKMPGETLSLSCRGSGFTFGSYGMNWVKQPAGKALEWMGYIYTHGGSTDYSSSFRDRTEITRDNSNSMVYLRLSRLSPEDSAVYYCARS
Fundulus heteroclitus V43 ighv JXMV01033873.1 3779 IDGQTLTESEPVVKRPGESHTLTCTASGFTFGDYWMNWVRQAPGKGLEWVAAISFWAGSDKSYSQSVQGRFTISRDNGKQQLFLQMNNLKAEDSAVYYCARG
Fundulus heteroclitus V42 ighv JXMV01033871.1 4637 IDGQTLTESEPAVKKPGESHKLTCTTSGLSFSSHWMTWIRQAPGKGLEWIAIIEYDSDRKFYSQSVQGRFTISRDNGREQLYLQMNSLKTEDSAVYYCARR
Fundulus heteroclitus V41 ighv JXMV01033870.1 1826 MTITESGSAVKKPGQSHTLTCTTSGFSFSSSVWVWIRQPSGKGMEWIALVHTSSSPIYYSASVQGRFKISRDDSSSKVYLQMDSLKTEDSAVYYCARR
Fundulus heteroclitus V40 ighv JXMV01033870.1 9089 IDGQTLTESEPAVQKPGESHKLTCTTSGISFSSNWMAWIRQAPGKGLEWIALIKYDSNEIYYSQSVQGRFTISRDNGREQLYLQMNSLKTEDSAVYYCARE
Fundulus heteroclitus V39 ighv JXMV01033869.1 1781 AQGQSLTSSEAVVHRAGQSATLSCTVQGISLAWLHWIRQKAGKGLEWIGRIDSGTGTIFAQNFQGQFSITKDTSQNRVFLTVKSLKPEDSAVYYCARE
Fundulus heteroclitus V38 ighv JXMV01033868.1 5958 VVCIDLIQPNSKAVQPGQSLSITCQLSGYSLYDSFGTGWIRQRDGKGMEYIFHQWGGSSGSLYQNNALKNKFSFSRDMTAETVTITGQTLQPEDTAVYYCVRY
Fundulus heteroclitus V112 trbv JXMV01117771.1 15731 SSLSDQVYQTPAAMFLNPGGAALINCSHSIQGYDVILWYKHSDSKQMQLLGYNDVINGYPEPGLKVKINGSANKDKICTLTVEDLSASSSAVYFCAAR
Fundulus heteroclitus V111 trbv JXMV01117771.1 18403 SSLSDQVRQTPAYIQANPGGSATISCSHSIQSYDVILWYKRSEDAQLQLLGHVYLDNKNPEPGVDVEMGGRADKDEICTLTIKPLNVKSSAVYFCAARYHSAA
Fundulus heteroclitus V110 trbv JXMV01117771.1 19141 SSPSDQIFQTPIEIFKPPGETAQISCSHSLQDYNRILWYKQSEHQMLLLGHAVGKSGFPEEGLNVEIGGSADKDQICTLTIKELNASSSAVYFCAAR
Fundulus heteroclitus V109 trbv JXMV01117771.1 21550 TSKNSVHQTPVAVIKGPGESFHLKCNHSNTDFNMIQWYKQPPGKTDMSLLGYTRFISNVVEDQFKSLYNVTGNGQSQSSLVVLKLRHPEDSAVYFCAASR
Fundulus heteroclitus V108 trav JXMV01117768.1 539 ISLGLEVHQSHSDLIKQTADKVQIFCSHERTNYQIMLWYQQSPGDTAMKLIGYLYFKDTSIEEEYKKDFGIYRDLGGNTAKNGSLMIRTVEQNHTAVYYCAASE
Fundulus heteroclitus V107 trav JXMV01117768.1 3991 ISLGLEVHQSHSDLIKQTADKVQIFCSHERTDYRMMLWYQQSPGDTAMRLIGNLLYKNPSIEDAYKKDFGLDGDLNGDTAKNGSLIIQAVEQSHTAVYYCAASD
Fundulus heteroclitus V106 trav JXMV01117768.1 5169 LSVGLEVHQSHSDLIKKTGDKVLIFCSHERTDYRVMLWYQQSPGDTAMKLIGYLYYEKPSLEDAYKKDFGLDGDLGGNTAKNGSLIIPAVEQNHTAVYYCAARE
Fundulus heteroclitus V105 trbv JXMV01117768.1 6958 YCQDVIQEPTISWSFESKSAELKCSHKKDITYNQMYWYRQRPGETMTLIVYTAFGGQPDYGESPQSKYSAVKDSIETGALTVNDLQPDDGGLYFCAVS
Fundulus heteroclitus V104 trbv JXMV01117767.1 585 FSNGVIIDQPPSLFPEDGEGAVNLKCEQDDNQHLNMYWYRQTRGKGMELVAYSVGKDISTIEAPFNKSKYSMLRPTTLSTTLRIHPAEAGDSAVYYCASSK
Fundulus heteroclitus V103 trbv JXMV01117766.1 8318 YCQDVIQEPTISWSFESAKMNCSHKKDISHTQMYWYTQRPGETMTLIVYTAFGGQPDYGESPQSKYSAVKDSIETGALTVKDMQPDDGGVYFCAVS
Fundulus heteroclitus V102 trbv JXMV01117766.1 9171 SSPSEQVHQVPESILKSPGAGATIKCSHSIPNYDRILWYKQMNGGQLELLGYMYITQSYPEPGLDVKLSGNADRDQTCALTLEALNPNSSAVYFCAAS
Fundulus heteroclitus V101 trbv JXMV01117766.1 15605 SSLSDQVHQTPFYIQANPGETVEISCSHSIQNYDRILWYRRSQDTQLHFLGYMLQSLGNPEPAANVTMKGSANKDKTCTLIIKELRVNSSAVYFCAAS
Fundulus heteroclitus V100 trbv JXMV01117766.1 18024 SSLSDQVRQTPAYIQANPGGSATISCSHSIQSYNVILWYKRSEDTQLQLLGYVYKSNKNPEPGVDVEMGGRADKDQTCTMKIKELLMNSSAVYFCAARYHSAA
Fundulus heteroclitus V99 trbv JXMV01117766.1 18740 SSLSDQVRQTPADIHANPGGSATISCSHSIQNYNVILWYKRSEDAQLQLLGYRFLSTSYPEPGVDVDMEGGADKNQICTMKIKELYVNSSAVYFCAAS
Fundulus heteroclitus V98 trbv JXMV01117766.1 19457 SSLSEQIVQTPVEMFVRPGQEITISCSHSIQSYDQIFWYKQSAGHEMQLLGYMYGTGAFPEKDQNVTIEGDANRNKNCTLTINRVGLESRAVYFCAARLHSA
Fundulus heteroclitus V97 trav JXMV01117766.1 22670 LSLSSNVQQDPPSILGNPEGPTTIKCSHSIDTYNVILWYQKPIGDSALKLIGYVYYTNPTLEDEFKDHFNVTGDGTTKAELSVQKLQPEDSGTYYCAAS
Fundulus heteroclitus V96 trbv JXMV01117766.1 27236 CAGGSDVSQTPMLWLYKGEDATMECSHTKGAGYYQMYWYRQLPGENMKLIVFTSTTKKDHDFGDFSKEKFSATKNTTERGSFTVKNLQPEDKGLYFCAVSQHSDT
Fundulus heteroclitus V95 trbv JXMV01117764.1 689 AAVSIHQPPSVFTRDGEQSVTLRCEQDNDQHYYMYWYRQASSGELQLLIYSPGKNTSSIEAPFSLSKYTMTRPELLRSSLQIHPVEAGDSAMYFCASS
Fundulus heteroclitus V94 trgv JXMV01107719.1 7667 TRVRQTPETASVQEGDMVTLHCSLLSKTPVVSSQCSAKYNVYWFRVGSGESHLSFIYTHKNSSDAHNSSCVHRLSKTIRNSSDTGIYYCAV
Fundulus heteroclitus V93 trgv JXMV01107719.1 16971 TVTRVRQTPETASVQEGEMVTLHCSLLSKTPVVSSQCSAKYDVHWFRVGSGESHLSFIYTHKNSSDTHKSSCVHRLSKTIRTSSDTGIYYCAV
Fundulus heteroclitus V92 igkv JXMV01098109.1 3456 SRGQVTVTQPTAVTADLGGSVTISCRTSYRVDDGVDLSWYQQKDGQTPKLLIYRASSQASGTPSRFTGSGSNTDFTLTISGVQAEDAEVYYCLGEFYIS
Fundulus heteroclitus V91 igkv JXMV01098109.1 3456 SRGQVTVTQPTAVTADLGGSVTISCRTSYRVDDGVDLSWYQQKDGQTPKLLIYRASSQASGTPSRFTGSGSNTDFTLTISGVQAEDAEVYYCLGEFYIS
Fundulus heteroclitus V89 trav JXMV01093676.1 1161 VAPGLEVHQSHSDLIKNRGDKVQVFCSHDKTDYRMMFWYQSQPGNTSLKLIGYLNYGTATMEDLFKESFSLGGDLGGNAAKNGSLQIQQVERKHSAVYYCAASK
Fundulus heteroclitus V88 trbv JXMV01093676.1 3100 SSLNDKVQQHPAEMYKSLTDSEAEIQCLHNDDSFNQILWYKQSNRGLQLLGYMYAGTENLEKDVKVKIEGRANKGERCTLKIKDISLNSSAVYFCAAR
Fundulus heteroclitus V87 trbv JXMV01093676.1 4493 FVEGSDVTQTPLVWKNKGENATISCSHTKGDLYFQMYWYRQLPGETMKLIVFTTTGGSKHDFGSFSKEKFSATKTVAQSGTFTVKNLEPKDEGLYFCAVS
Fundulus heteroclitus V86 trav JXMV01064916.1 1658 VNCQQLTALKTEESTSEGGSLTLSCNYTKGSVDYLFWYRKYPEKPPEFLKLHFPSGEAEHLDRMKFEGNKEEMKMTISSAAVTDSAVYYCAVR
Fundulus heteroclitus V85 trav JXMV01063501.1 1158 VKCEQLTQPASVTVQPGQRLTISCQVSYDVSSYATHWIRQPAGKGLEWIGRAGEGFTTRYKESLKNKFSISFVSSSKTVTLNGQNMQLVDSAEYYCARE
Fundulus heteroclitus V84 ighv JXMV01063125.1 515 AAGQTLTESEPVVKRPGESHTLTCTASGFTFSDYEIHWFRQATGKGVEWVALVTKPTGSSQYYSLAVRGRFTISRDNSKQQVYMQMNTLKTEDSAVYYCARR
Fundulus heteroclitus V83 ighv JXMV01062642.1 870 VRCEQLTQPASLTVQPGQALSISCQVSYSVTTYSTTWVRQPAGKALEWMGVIWSSGSTAYANSVQGRIEITRDTSKNIVNLRLSTMRPEDSAVYYCAK
Fundulus heteroclitus V82 ighv JXMV01062642.1 870 VRCEQLTQPASLTVQPGQALSISCQVSYSVTTYSTTWVRQPAGKALEWMGVIWSSGSTAYANSVQGRIEITRDTSKNIVNLRLSTMRPEDSAVYYCAK
Fundulus heteroclitus V81 trav JXMV01060330.1 197 VSCQRVSPLKTEELSSEGSSVALSCNFTKGEADYFFWYRQNPGKRLEFLIFNTGYEEPQKDSLSKLSGRVRKTEAQMDLLISSAAVSDSAVYYCALQ
Fundulus heteroclitus V80 ighv JXMV01056331.1 206 VKCEQLTQPASVTVQPGQRLTISCQVSYSVSSYATHWIRQPAGKGLEWIGYKATGGSNYKDSLKNKFSIDLDTSSKILTLNGQNMQPEDSAVYYCAR
Fundulus heteroclitus V79 ighv JXMV01056330.1 921 VKCEQLTQPASVTVQPGQSLAISCQVSYSLSSRPTAWIRQPAGKGLEWIGEAGEGWTTYYKDSLKNKFSISFVSSSKTVTLNGQNMQPEDSAVYYCARY
Fundulus heteroclitus V78 trav JXMV01056327.1 2236 VKCEQLTQPASVTVQPGQRLTISCQVSYSLSSYWTHWIRQPAGKGLEWIGMKHGGGASYYKDSLKNKFSIDADSSSKTVTLNGNNLQPEDSAVYHCARE
Fundulus heteroclitus V77 trav JXMV01055857.1 1244 QTDSVLQPEGEDVVAAEGETRTLGCLYNTSASNHYLYWYKQDGGSSPKFLLSRFKVGDGKTAAEKRFSSSLDPSVRSVPLTIQDLQLSDSAVYYCALQPTVTGN
Fundulus heteroclitus V76 ighv JXMV01055395.1 1717 VRCEQLTQPASLTVQPGQALSISCQVSYSVTSYYTHWIRQPAGKALEWMGAIWTGGGTAYANSVQGRIEITRDTSKNLVNLRLSTMKPEDSAVYYCARD
Fundulus heteroclitus V132 trav JXMV01120237.1 1424 VQQQAAAVPASTLLVRVGEDATLQCPLLDASNGTGPATLSWYRKAAGHGPRLLVSISPANGSILRYGDGVSPDKVSAAANGSLLLRGSEQSDSAVYYCGVSNGS
Fundulus heteroclitus V131 trav JXMV01118940.1 6042 VWSQIRLEQSPFSVVKKPGETVMISCAVNGFDIDGEYVHWTRQKSGKALEWIGRHSRSSEEYSSSFASRSDLSYDESGITARLSIRSLTEGDAATYFCAHTAQ
Fundulus heteroclitus V130 trav JXMV01117777.1 327 FSLGVQVHQSPSVVLRRAGENAQLVCNHGQGDYRVMLWYQRQPGEDALKLIGYGYVEFKNDSVEETFRKKGFSLAGDLSGNKAKNGSLFIKNLNAVEHTATYFCAASK
Fundulus heteroclitus V129 trav JXMV01117777.1 2372 VCLSVDVQQTPPAAQRKLGQKIQMACSHGKTDYTLMQWYQKSPGDQALKRIGHVYYSTIEHEESFKEHFNITGDMSGETAKNGSLFITDLKTEHTAVYYCAASY
Fundulus heteroclitus V128 trav JXMV01117777.1 3018 QCQDVTQEPEISWISAAESAEIQLKCSHTRDKGHNQMYWYRQRPRETMSLVVYTVFGGKPDYGESPQSKYSAVKDSIETGALTVKDLQPDDSGVYFCAVS
Fundulus heteroclitus V127 trbv JXMV01117777.1 3785 SSLQDKVHQSPTDLCKRRNQTAEISCLHNIDNYDRILWYKQTDRDLQLLGYMYVGRENLEKGANVKIKGGANKGETCKLTFEGLSLNSSAVYFCAAS
Fundulus heteroclitus V126 trbv JXMV01117777.1 7610 SSLSGEVRQTPADLYKELKQTAKVSCSHNIKNYDRILWYKQTKNKQLEFLAHMLANIGFAEEGAMVKIDGNANKGQTCTLSIESLTLNSSAVYFCAAS
Fundulus heteroclitus V125 trbv JXMV01117777.1 12322 LTAGSDVHQPDMLWRNQGDNATIECKHSKGASYYQMYWYRQLPGETMKQIVFTIANSKPDFEAEFKSEKFSVTKPDALSGTFTVSKLVPGDKGLYFCAVS
Fundulus heteroclitus V124 ighv JXMV01117776.1 204 LSLSSNVHQEPPSIIGSPEGPATISCSHSVNTYDTILWYQKLTGDSALKLIGYNLISGAKLEDEFKDHFSMKGDGSKKSELSVQKLQPEDSGTYYCAAS
Fundulus heteroclitus V123 trbv JXMV01117776.1 2800 LTDGSDVSQTPLLWTNESQSATMNCSHTKGVDYNQMYWYQQLPGQNMKQIVFTTAYSAHQYEQGFSKEKFPAEKKDYSTGSLTVKNLQPGDSGVYFCAVS
Fundulus heteroclitus V122 trbv JXMV01117776.1 6945 DSVSQTPVLWKHQDDNATLECSHTKGGTYRQMYWYQQLPGQMMKQIVFTTAYSAHQYEQGFSEEKFPSEKKVAENGSLTVKKLQPADSGVYFCAVS
Fundulus heteroclitus V121 trav JXMV01117776.1 18096 SSISIEIQQPPFVIGREKDPSVTLKCEQDHDEHYYMYWYKQESTGKLELVAQSLGENTWDIEAPFNKSKYTVLRPTILDTALQIHRPQARDSAVYYCASRR
Fundulus heteroclitus V120 trbv JXMV01117776.1 23446 QAKSVEFQPTYPKIVNVTDNVDFHCQHSDNSLNVMLWYQQTDAGAMNLIGYSYVGSEAVYEKPFEHNFKITRKDTQTGALNINSVDVSNSGVYFCAGS
Fundulus heteroclitus V119 trbv JXMV01117776.1 25695 VCESVLITQWPRYIPCNATDRAEIHCYQNDTDYEYLYWYRQLKGKEIQLIVYLLAGNPNFESDFATGFEAVRSNTKQWSLTITSVQEKDEAVYLCAA
Fundulus heteroclitus V118 trbv JXMV01117772.1 2386 TSKNSVHQTPVAVIKGPGESFNLKCNHSNTDFDMIQWYKQPPGKTDMSLLGYTRFTSNVVEDQFKSLYNVTGNGKSQSSLVILKLRHPEDSAVYFCAASG
Fundulus heteroclitus V117 trbv JXMV01117771.1 1032 SSCSQRVFQAPTNIYSRAGRTAKIYCSHSDQNYNQILWYKQSDRGLLLLGYVYYTDVYPETGLDGKMEGSADPHQNCTLTLERLSSHSSAVYFCAASRHS
Fundulus heteroclitus V116 trbv JXMV01117771.1 1742 SSLSDQVYQTPAEMLLNPGGQALINCSHSIESYNRILWYKHSDNMEMQFLGYMNVMFGTPEPGVNVLINGSANKDQICTLTVKDLSASSSAVYFCAAR
Fundulus heteroclitus V115 trbv JXMV01117771.1 5335 SSLSDKVHQVPADMLKNAGEDIAIQCSHSVTNYDQILWYKQSMDHPMQFLGYMNVMNGYPETGVNVKIDGRGTEGQTCTLTIERVNQSSTGVYFCAAS
Fundulus heteroclitus V114 trbv JXMV01117771.1 12590 SSLSDQVRQTPAYIQANSGDSATISCSHSIQSYDVILWYKRSEDTQLQLLGYRYLGTSFPEPGVDVDMEGGADKNQICTMKIKELLVNSSAVYFCAASYHSSA
Fundulus heteroclitus V113 trbv JXMV01117771.1 13306 SSLSDQVFQTPAEMFKTPGETAKISCSHSLPDYDRILWYEQPKVPQMHFLGVMLGDTGYPEKGLSVTMDGNANKDKICTLTINDLNVNSSAVYFCAAS
Fundulus heteroclitus V90 trbv JXMV01093677.1 273 SSDSKQVNQSHPFIIRGTGGSVDQIHCSHNIPNHEVILWYKQDEHKSLKLLGYLNLEYPSIEEDVKGKIDFKGDGRKQSSLTISDLALNDSAVYFCAARM
Fundulus heteroclitus V75 ighv JXMV01055395.1 5868 VECEQLTQPASVNVRTGQRLIISCQVSYSVSGYWTNWIRHPDGKGLEWIGRAAGSTTYYKDTLRNKFSISTDSSSSTVTLNGQNVQPEDTAVYYCARDPE
Fundulus heteroclitus V58 ighv JXMV01033882.1 730 VYCIDLIQPHSEVLQPGQSLTITCRVSGYSLTDNSYATGWIRHRQGKPMEWIFHMWGTSGLRQNDALKNKFSYSREPSAGTVTITGQSLQPEDTAVYYCVRCSAQ
Fundulus heteroclitus V37 igkv JXMV01020211.1 604 HCQQSDYCVTLNENISTEAGLCAVIPCSFKSGFEAEVIIWYKCDQPVERCKNSDIIFHSDKNNVNVQSGFKGRVSLLEPDVTQKKCSIMINDLRPSDSGYYQLRVKG
Fundulus heteroclitus V16 ighv JXMV01052731.1 216 VKCEQLTQPASVTVQPGQRLTISCQVSYNLGSYYTSWIRQPAGKGLEWIGMKYTGASYYKDSLKSKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCARY