WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Hippocampus comes LVHJ00000000.1 (LVHJ01) 10 4 0 0 3 3 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Hippocampus comes V8 trav LVHJ01016515.1 20646 LTAAEGWSIEQSEPVVKKAGESHTLTCKISGLDFSDYPWSWVRKVPGKDFEFISYIGPSSTPKYYSPLLQERFTIARRDSSSQLDLNINSLKTEDTAAYFCAR
Hippocampus comes V7 ighv LVHJ01016515.1 22149 VKCEQLTQPPSLTLQSGRDLTITCQVSYDLDDYHTAWVRQVAGKGLEWIGMRALTGAYYRKDSLSSKFSIELNPSSRTVTLNGQNMQPEDTAVYYCARD
Hippocampus comes V6 ighv LVHJ01016515.1 24548 VKCEQLTQPPSVTLRSGQELNIACQVSYSIGSYHTAWVRQVAGKGLEWIGSRRHTGDYYRKNSLISKFSIELNPSSQTVTLNGQNMQPEDTAVYYCARQ
Hippocampus comes V5 ighv LVHJ01016515.1 25518 VKCEQLTQPPSVTLRSGQELNIACQVSYSIGSYHTAWVRQVAGKGLEWIGSRRHTGDYYRKNSLISKFSIELNPSSQTVTLNGQNMQPEDTAVYYCARQ
Hippocampus comes V4 ighv LVHJ01016515.1 29263 VKCEQLTQPPSVTLRSGQELNIACQVSYSLSSYYTAWVRQAAGKGLEWIGMRFTGAYYRKDSLSSKFSIELDPSSQTVTLNGQNMQPEDTAVYYCARQ
Hippocampus comes V3 trav LVHJ01008614.1 3263 ISGQTVHQQERDAHTVEGAAVTLDCSSDRAGNIDYTVWYKQEGNASPEFILSPFKIGHGKKAEKYVERFRSTMKASPRHAPLYIESVKPSDSGVSYCALQ
Hippocampus comes V2 trbv LVHJ01007908.1 25372 ASDALKVHQTPLYLMKKVREDTNELSCSHSITDYNMILWYKQDRGGAMELLGYLNQKFPAVEDHWKGKFSFSGDARQQSNLIINDLRINDSAVYFCAA
Hippocampus comes V1 trbv LVHJ01007908.1 27177 ASDALKVHQTPLYLMKKVREDTNELSCSHSITDYNMILWYKQDRGGAMELLGYLNQKFPAVEEHLKGKFSFSGDARQRSNLIINDLRINDSAVYFCAA
Hippocampus comes V0 trbv LVHJ01007908.1 29783 ASDALKVHQTPPYLMKQVEDDTNELSCSHSITGYDIILWYKQDRGGAMELLGYLNEKFPVVEDHWKGKFSFSGDSNQQSNLIITDLRINDSAVYFCAA
Hippocampus comes V9 trav LVHJ01016664.1 872 ISSQMVHQPERDARTVEGAAVKLDCSYDGAGNLDYILWYKQEAYSSPEFILSLFKIGHGKKAKKYVDRFRSTMNASARQAPLRIERVKPSDSGAFYCALQTTLTQ