WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Ictalurus punctatus LBML00000000.1 (LBML01) 252 72 0 52 81 33 11 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Ictalurus punctatus V28 trav LBML01006647.1 24445 AVDSIITPVQTIISSSEGSNTTLTCKYDQSADYLYWYRQKPQSGPEFLLMIFVSTDHVTEQSDPRLSTKLRKMEKGVDLEIFPAAVSDSALYYCALK
Ictalurus punctatus V27 trav LBML01006644.1 57888 EAADNSITPDQTSMSVIEGSNITLSCTYTGSVYSLHWYRQQPGSRPEFLLLIDETSEHVTQAQPPHPQLSTKLDKKNTKVDLLISSVTVTDSALYYCALM
Ictalurus punctatus V26 trav LBML01006644.1 49984 SIEPRFIHKVLDEGDNVTLTCRYNSSFSGNYLHWYRQYPKSTPEFLLYIVDQSGDLSLNIPPRMSAKVNKNKEVDLLISSSAVSDSALYYCALA
Ictalurus punctatus V25 trav LBML01006644.1 43164 SIEPLFIHKVLDEGDNVTLSCRYNSSFTGINYLHWYRQYPKSTPEFLLYISQSGDLSFNIPPRMSAEVNGVKVHLLISSAAVSDSALYYCALA
Ictalurus punctatus V24 trav LBML01006644.1 30575 SVEPLSTHKIVDEDDNVILSCRYKTTSVRNYLHWYRQYPKSKPEFLLYIVDQSGDLSLNIPPRMSAKVNKNKEVDLLISSSAVSDSALYYCALA
Ictalurus punctatus V23 ighv LBML01002419.1 160 VHCVELIQPGAMILSPGQSMTLTCKVSGYSVSDGSYWTHWIRQPAGKALEYIGQISGSGSTYYSEKLKSRFQVSRDTSSSTVTLTGQNMQTEDTAVYYCARE
Ictalurus punctatus V21 ighv LBML01002417.1 3134 VHGEELTQPGTMTVQPGQSLSINCKVSYSVTSYHTAWIRQPAGKALEWIGYISSGGGTAYSDKLKNKFSISRDTATNTITIGGQNLQTEDTAMYYCARD
Ictalurus punctatus V20 ighv LBML01002414.1 14790 VHGEELTQPSSMTVQPGQSLSINCKVSYSVTSYDTAWIRQPAGKALEWIGYIYSGGSTYYSDKLKNKFSISRDTATNTITIRGQNLQTEDTAVYYCAR
Ictalurus punctatus V19 ighv LBML01002414.1 8401 VHCVELIQPGSTLLTPGQSMTLTCKVSGYSLTDNSYCTYWIRQPAGKALEWIGWICYDGGTGYSEKLKSRFQISRDTSSSTVTLTGQNMQTEDTAVYYCARY
Ictalurus punctatus V18 ighv LBML01002414.1 749 ELTQPASTIVQPGQSLSINCKVSYSVTSYHTAWIRQPAGKALEWIGYISGGGNTYYSDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCARGTV
Ictalurus punctatus V17 ighv LBML01002298.1 5982 GVGGVDLTQSASVLVKPGESFSISCKISVSSYCIHWIRQPAGKALEWLGYLCSGGSTNLKDTMKSKISFSQDTSISTVYLRGQNFQTEDTAVYYCARDTALQ
Ictalurus punctatus V16 ighv LBML01002298.1 1477 ELTQPASMTVQPGQSLSINCKVSYSVTSYYTAWIRQPAGKALEWIGYISGGGNTYYSDKLKNKFSISRDTATNTITIRGQNLQTEDTAVYYCAR
Ictalurus punctatus V15 ighv LBML01002298.1 356 LTPGQSMTLTFKVSGYSLTDSSYCTAWIRQPAGKALEWIRRICGSGSTLYSEKLKSSFQVSRDTSSSTVTLTGNNMQTEDTAVYYCARESQ
Ictalurus punctatus V14 ighv LBML01002297.1 11573 VFCATELTQPDSVVIKPGEILTITCRVSGASITDSSSHYGTAWIRKPAGKSLEWINIIDNDGDIYKEHSLKDKSVISRATSSNNVTLQGQNTQTEDTAVYYCI
Ictalurus punctatus V13 ighv LBML01002297.1 7246 VHGEELTQPASMTVQPGQSLSINCKVSYSVTSYTTAWIRQPAGKALEWIGYISSGGGTAYSDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCAR
Ictalurus punctatus V12 ighv LBML01002293.1 6350 LTPGQSVSLTCKVSGYSLTSTYCTAWIRQPAGKTLEWIGWICYDGSTGYSEKLKSRFQISRDTSSSTVTLTGQNMQTEDTAVYYCARQPQ
Ictalurus punctatus V11 ighv LBML01002292.1 37288 VHGEELTQPASMTVQPGQSLSINCKVSYSVTSYSTAWIRQPAGKALEWIGYISSGGSTAYSDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCAR
Ictalurus punctatus V10 ighv LBML01002292.1 36137 VHCVELIQPGSTLLTPGQSVTLTCKVTGYSLTDSSYCTHWIRQPAGKALEWVGEICGDGNTYYSEKLKSRFQVSRDTSSSTVTLTGKNMQTEDTAVYYCARE
Ictalurus punctatus V9 ighv LBML01002292.1 28145 VHGIELTQPASMTVQPGQSLSINCKVSYSVTSDHTAWIRQPAGKALEWIGNIYSSGGTAYIDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCAR
Ictalurus punctatus V8 ighv LBML01002292.1 24748 VGCAVELTQVTSVMLKPGDSLTLSCKVSSYSVTDNSYATAWIRQPAGKTLDWINYIWGGGSTYHKDSLKSKFSISKDGSSSTVTLRGQNLQTEDTAVYYCT
Ictalurus punctatus V7 ighv LBML01002292.1 968 VHGVELTQPASMTVQPGQSLSINCKVSYSVTSYSTAWIRQPAGKALEWIGYIHSSGSTAYSDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCAR
Ictalurus punctatus V6 ighv LBML01002291.1 7704 VHGEELTQPASMTVQPGQSLSINCKVSYSVTSDHTAWIRQPAGKAMQWIGYIHSSGSTYYNDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCAS
Ictalurus punctatus V5 ighv LBML01002291.1 6633 TLTCKVSGYSLFIITDSSCCTQWIQQPAGKALEWVGWICSSGGTGYSEKLKSRFQISRDLSSSTVTLTGQNMQTENTAVYYCARYPK
Ictalurus punctatus V4 ighv LBML01002290.1 1274 SYGQSLTSSASVVKRPGESVTLSCTVSGFSMGSYWMSWIRQKPGKGLEWIGRIDSGTGTTFAQSLQGQFSITKDTNKNMLYLEVKSLKAEDMAVYYCARE
Ictalurus punctatus V3 ighv LBML01002288.1 19104 VHGVELTQPASMTVQPGQSLSINCKVSYSVTSYHTAWIRQPAGKALEWIGYIHSSGSTAYSDKLKNKFSISRDTATNTITIGGQNLQTEDTTVYYCAR
Ictalurus punctatus V2 ighv LBML01002288.1 16701 VHCVELIQPGSTLLTPGQSMTLTCKVSGYSLTDSSYCTDWIRQPAGKPLVWVGEICGSGNTYYSEKLKIRFQVSRDTSSSTETLTGQNMQTEDTAVYYCARQ
Ictalurus punctatus V1 ighv LBML01002286.1 4986 VHGVELTQPASMTVQPGQSLSINCKVSYSVTSYDTAWIRQPAGKALEWISYISSGGSTYYNDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCARG
Ictalurus punctatus V0 ighv LBML01002286.1 2787 VHCVELIQPGSTVLTPGQSMTLTCKVSGYSLTDSNYCTNWIRQPAGKALEWVGEICGSGNTYYSEKLKSRFQVSRDTSSSTVTLKGQNMQTEDTAVYYCARQ
Ictalurus punctatus V65 ighv LBML01022983.1 58574 VYCVQLIQPETTILSPGQSMTLTCKVSGYSVSDGSYWTHWIRQPAGKALEYIGQISGSGSTYYSEKLKSRFQVSKDTSSSTVTLTGQNMQIEDTAVYYCARK
Ictalurus punctatus V64 ighv LBML01022983.1 55664 IKCIALVQPPVMVVKPGESFSVPCKITGYSATSTCTNWIRHKSGQALEWIGWYCSSSNTGSIDSLKNKIRFSAEASSNTVILHGQNFQSEDTAVYYCARE
Ictalurus punctatus V63 ighv LBML01022983.1 38960 LTPGQSVTLTCKVSGYSLTDSNYCTDWIRQPAGKALEWIGEICGSGNTYYSEKLKSRFQVSRDTSSSTVTLTGQNMQTEDTAVYYCACE
Ictalurus punctatus V62 ighv LBML01022983.1 36497 LTPGQSMTLTCKVSGYSLTDSNYCTGWIRQPAGKALEWIGHICSSGGTAYSDKLKSRFQVSRDTSSSTVTLTGQNMQTEDTAVYYCARY
Ictalurus punctatus V61 ighv LBML01022983.1 12476 SYGQSLTSSASVVKRPGESVTLSCTVSGFSMSYGMTWIRQKPGQGLEWIGYIDGGTSTTFAQSLQGQFSITKDTNKNILYLEVNSLKAEDTAVYYCARE
Ictalurus punctatus V60 ighv LBML01022983.1 8483 LTQPASMTVQPGQSLSINCKVSYSVTSYRTDWIRQPAGKALEWIGYISSGGSTAYSDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCARVTV
Ictalurus punctatus V59 ighv LBML01022983.1 3759 VHGISLTPSPAEVKPLGASVKLSCQISGYALTSYSTGWIRKPPGKGLEWIGIIRGGGDIASGASFKTLFSISRDMSNNVLYLDISSLLPEDTAVYYCAK
Ictalurus punctatus V58 igkv LBML01018416.1 6058 QVTVTQTPSVQTVDPGKTVTFNCRTSSSVLAGSYLHWYLQKPGEAPKLLIYRATTLQSGTPARFSGSGSDTDFTLTIRGVQTEDAGDYYCQSYHYISSSGV
Ictalurus punctatus V57 igkv LBML01018415.1 5467 SRGQVTVTQTPSVQTADPGKTVTFNCRTSSSVHGGSYLHWYLQKPGEAPKLLIYYATSSYTGTPARFSGSGSNTDFTLTISGVQTEDAGDYYCQSL
Ictalurus punctatus V56 igkv LBML01018411.1 3054 QVTVTQTPSVQTADPGKTVTFNCRTSSRVNNGYELAWYLQKPGEAPKLLIYAATSLYTGTPARFSGSGSNTDFTLTIRGVQTEDAGDYYCQSFHVISGSWV
Ictalurus punctatus V55 igkv LBML01018411.1 251 QVTVTQTPSVQTADPGKTVTFNCRTSSRVYVGNDLHWYLQKPGEAPKLLIYDATRSYTGTPARFSGSGSDTDFTLTIRGVQTEDAGDYYCQSLHQISGSYV
Ictalurus punctatus V54 igkv LBML01014876.1 1390 QVIVTQTPSVQTADPGQTVTINCRTNLRVHSGTFLHWYLQKSGETPKLLINHVNKLFSGTPARFSGSGSDTDFTLTISGVQAEDAGDYYCLSDLQIRGVSV
Ictalurus punctatus V53 igkv LBML01014815.1 567 SFGEIVLTQSPGSQSVSPGQSVTLTCTSSQSVGSNLAWYLQKPGEAPKLLIYAATSRQSGIPDRFSGSGSGSQFSLKISGVRSEDAGDYYCQQYSSFP
Ictalurus punctatus V52 igkv LBML01014813.1 1406 QVTVTQSPAVKPVSPGETLTISCKTSPAVYSDFSGDHYLSWYQQKAGEAPKLLIYWASTRESGIPDRFSGSGSGSDFTLTISGVQTEDAGDYYCQSYHDISGSNV
Ictalurus punctatus V51 igkv LBML01014805.1 5568 SRGQVTVTQSPAVKPVSPGETLTISCKTSPAVYSGTYYYLSWYQQKAGEAPKLLIYYADERESGIPARFSGSGSGSDFTLTISGVQTEDAGDYYCQSVHDISGSGV
Ictalurus punctatus V50 igkv LBML01014805.1 3901 SFGEIVLTQSPGSQSVSPGQSVTLTCRASQTVSNDLHWYLQKPGEAPKLLIYNDVTRYTGVPDRFSGSRSGLQFSLEISGVQAEDAGDYYCQQSETTP
Ictalurus punctatus V49 igkv LBML01014792.1 8391 SFGEIVLTQSPGSQSVSPGQSVTLTCTSSQSVSSYLHWYLQKSGEAPKLLIYNAASRQSGIPDRFSGSGSGSQYSLKISGVQSEDAGDYYCQQSNSFP
Ictalurus punctatus V48 igkv LBML01014791.1 262 SFGEIVLTQSPGSQSVSPGQSVTLTCTSSQSISNNLHWYLQKPGEAPKLLIRYATSRESGIPDRFSGSGSGSQFSLKISGVQSEDAGDYYCQQGYSTP
Ictalurus punctatus V47 trgv LBML01006763.1 83167 TLEQKDLSVTKDEGKTVPINCKVTGLSSGSYVHWYQKKEGEALTRILYVKRDSSVIRDNHDDAKDFDVRIQYDNYDLKIASLKKSHSAVYYCASWESA
Ictalurus punctatus V46 trgv LBML01006763.1 79984 VLGVTLEQKDLSMTKEEGKSVYISCKVTGLTTIYVHWYQQKDGEALTRILYVKRGSKPVHDTTHLEAKEFDVRLQADNFDLKIANLKKSHSAVYYCVCWESA
Ictalurus punctatus V45 trgv LBML01006763.1 73108 AVLGVTLEQKDLSMTKGEGKSVYISCKVTGLTTTYVHWYQQKDGEALTRILYVSSGSKPVHDTNHLEAKDFDVRLQSDNYDLKIANLKKSHSAVYYCVCWTGVSS
Ictalurus punctatus V44 trgv LBML01006763.1 65543 AVLGVTLEQKDLSMTKGEGKSVYISCKVTGLTTTYVHWYQQKDGEALTRILYVSSGSKPVHDTTHPEAKDFDVRLQADNYDLKITNLKKSHSAVYYCASWETG
Ictalurus punctatus V43 trgv LBML01006763.1 62950 AVLGLTLEQKDLSMTKEEGKTVYISCKVTGLSSSNYVHWYQKKEGEALARILYIKSGSLEPVHDANHNEAKEFGVRKQDDNYDLKIANLKKSHSAVYYCACWE
Ictalurus punctatus V42 trav LBML01006652.1 48540 AVDNSNTPDQTIISSSEGSNTTLSCTYDASAYRLHWYRQKPQSGPEFLLMIRVSSDAVTEAKQPDPRLSTKLHKNGNKVDLEIVTVAISDSALYYCALE
Ictalurus punctatus V41 trav LBML01006652.1 28006 DSMANSIEPLVTHKVADEGDNVTLSCNYSGSINNLQWYRKYPKYNPEFLLYIFESGDLSHNIPPQMSAKVHKDKQVDLLISSAAVSDSALYYCALV
Ictalurus punctatus V40 trav LBML01006651.1 37311 TVDSSITPDQAIISSSEGSITTLTCTYNQSADSLHWYRQKPQSGPDFLLLIIVSSNYVIEAKQPDPRLSIRLRKDNKVDLEIFPAAVSDSALYYCALQ
Ictalurus punctatus V39 trav LBML01006651.1 25166 SVEPLFPHKVVDEGDDVTLSCRYETSSTASTLQWYRQYPKSKPEFLLYIFESGALSLNIPPHMSAKVYGDKVDLLISSAAVSDSALYYCAL
Ictalurus punctatus V38 trav LBML01006650.1 90522 SVGPLFTHTVVDEGDNVTLSCSYKTSGTTNYLHWYRQYSKSKPEFLLYIYQSGTLSENTPRRLSAEINNEKVDLLISFAAVSDSALYYCALA
Ictalurus punctatus V37 trav LBML01006650.1 71314 SIEPLFTHKLVDEGDNVTLSCSYKNSSVSANSNLYWYKQYTKSIPEFLLYIYPSGIVSPNIPQRMFAKVNGSIKQVDLLISSAAVSDSALYYCALR
Ictalurus punctatus V36 trav LBML01006650.1 30866 SIETLFIHKVLDEGDNVTLSCRYNSSYTRNNLHWYRQYPKSTPEFLLYISQSGDLSSNIPPRMSAEVNGDKMHLLISFAAVSDSALYYCALA
Ictalurus punctatus V35 trav LBML01006650.1 2165 PIEPLDTHKAVDEGDNLTLSCSYNKFTGVVTTLQWYRQYPKSNPEFLLQIFPSEGKSNTGPPRLSAEVDQNNKVDLLISSAAVSDSALYYCALQ
Ictalurus punctatus V34 trav LBML01006649.1 31892 EAAGNSITPEQSTMSVIEGSNTTLSCTYTGSVYSLHWYQQKPGSTPKFLLLITEAIEHVTQAQPPHPHLSIKLDKKNTKVDLLISSAAVTDSALYYCALG
Ictalurus punctatus V33 trav LBML01006647.1 112920 EAADNSITPEQSSMSVIEGSNITLSCTYTGSVYSLHWYQQKPGSRPGFLLLIAETSEHVTQAQPPHPQLSIKLDKKNTKVDLLISSATVTDSALYYCALM
Ictalurus punctatus V32 trav LBML01006647.1 87680 SVEPLSTHKVVDEDDNVTLSCRYKTTSVTNYLHWYRQYPKSKPEFLLYIVDQRGDLSLNIPPRMSAKVNNNEEVDLLISSSAVSDSALYYCALA
Ictalurus punctatus V31 trav LBML01006647.1 56681 AVDNNITPDQTIIYSSEGSNTTLSCTYDASAYRLHWYRQKPQSGPEFLLMILVSSNVVTEATQPDPRLSIKLHKKGNKVDLEIVTVAVSDSALYYCALE
Ictalurus punctatus V30 trav LBML01006647.1 52696 DSMADPIEPLVSHNVVDEGDNITLSCSYKGFTENIYNVQWYRQYPKSKPDFLLYITPSGELSLNIPPRMSAKVNGEKQVDLLIFSTAVSDSALYYCALA
Ictalurus punctatus V103 igkv LBML01005697.1 7841 FEAIVHLTQEKILNANVGQDVRILCRRDSGSWTISWYQQKAGDTPKYLLADSNRASGLSSRFTYTDNGNDEYLNIARVEAEDEAVYYCGCIICQD
Ictalurus punctatus V102 trgv LBML01005653.1 52684 LEALVLTQEKVISVQAGQNVKILCSPSTGSWAITWYQQKPGKAPTFLLSDSTRASGLPSRFTYSESGSQEYLHINGVEAEDEAVYYCA
Ictalurus punctatus V101 trgv LBML01005653.1 56215 GLETLVLTQEKVMSVKAGEHVKISCRSDASRDWVLRWYQQKPGKVPTFLLRDSTRASGLPSRFTYSGSGSQEYLHINGVEAEDEAVYYCA
Ictalurus punctatus V100 ighv LBML01002250.1 6130 VHCVELIQPGSTVLTPGQSMTLTCKVSGYSLTDSSYCTGWIRQPAGKALEWVGRICSSGGTDYSEKLKNKFQISRDMSSSTVTLTGQNMQTEDTAVYYCARY
Ictalurus punctatus V99 ighv LBML01002250.1 13437 LTPGQSMTLTCKVSGYSLTDSSYCINWIRQPAGKALEWIRVICSDGSTYYSEKLKSRFQVSRDTSSSTITLTGQNMQTEDTAVYYCAHQ
Ictalurus punctatus V98 ighv LBML01002249.1 2194 CGCQTLTESEPVVIKPGGSHQLTCTYSGISDGSADISWIRQAQRKGLEWISHISAPGGGTKLYSQSVQGRFTISRDNSKKQVYLHMTSLKTEDTAVYYCARR
Ictalurus punctatus V97 ighv LBML01002247.1 2368 CVCQTLTESEPLVIKPGESHQLTCTYSGISDSDAAISWIRQAQGKGLEWISFISAPSGSTKQYSQSVQGRFTISRDNSKKQVYLHMTSLKTEDTTVYYCARR
Ictalurus punctatus V96 trav LBML01032445.1 26 RTNCVKFEQTPSILATETSEITIQCSHDDSSLYYMYWYQQNSRTVMALIGYTTGASSDPNYEDGFKDRFKQSRQGTLNGSLTISSLRQSDSAVYYCAASMHNA
Ictalurus punctatus V95 igkv LBML01027840.1 287 SRGQVTVTQTPSVQTADPGKTVTFNCRTSSRVLGGSYLHWYLQKPGEAPKLLIYEATTLQSGTPARFSGSGSDTDFTLTISGVQTEDAGDYYCQSYHSGYV
Ictalurus punctatus V94 trav LBML01027236.1 268 TVDSSITPDQAIISSSEGSITTLTCTYNQSADYIHWYRQKPQSGPEFLLLIIVSSNSVINAKQPDPRLSIRLRKEKKVDLDIFPAAVSDSALYYCALQ
Ictalurus punctatus V93 trav LBML01026452.1 972 SIESLFIHKVADEGDNVTVSCTYKFSVSGNNYLHWYRQYPKSTPEFLLYISQSGALSSNIPPRMSAEVKGDKMDLLISSAAVSDSALYYCALA
Ictalurus punctatus V92 igkv LBML01025906.1 49 SRGQVTVTQTPSLQTADPGQTVTFNCRTSSSVDWNMFLGYYLHWYLQKPGEAPKLLIYGATTLQSGTPARFSGSGSDTDFTLTIRGVQTEDAGDYYCQSYHSGGV
Ictalurus punctatus V91 igkv LBML01025738.1 1030 QVTVTQTPSVQTVDPGQTVTFNCRTSSSVNWDMFFGYYLHWYLQKPGEAPELLIYYATSSYTGTPARFSGSGSDTDFTLTISGVQTEDAGDYYCQSFHYISSRDV
Ictalurus punctatus V90 igkv LBML01025504.1 263 QVTVTQTPSLQTVDPGKTVTINCRTSSSVYGGSFLHWYLQKPGEAPKLLIYGATNLQSGTPARFSGSGSNTDFTLTIRGFQTEDAGDYYCLSDHYIGSSWM
Ictalurus punctatus V89 igkv LBML01025232.1 7632 SFGEIVLTQSPGSQSVSPGQSVTLTCTSSQGVSNNLNWYLQKSGEAPKLLIYYASNRQSGIPDRFSGSGSGSQFSLKISGVQSEDAGDYYCQQGSSFP
Ictalurus punctatus V88 igkv LBML01025232.1 441 SFGEIVLTQSPGSQSVSPGQSVTLTCTSSQSVSNDLHWYLQKSGEAPKLLIYNDVTRYTGVPDRFSGSRSGLQFSLEISGVQAEDAGDYYCQQSETWP
Ictalurus punctatus V87 trav LBML01024731.1 4208 SIEPLFIHKVADEGDDVTVSCTYKFSVSGNNYLHWYRQYPKSTPEFLLYISQNGALSYNIPARMSAGVNGDKVHLLISSAAVSDSALYYCALV
Ictalurus punctatus V86 igkv LBML01023775.1 1354 QATVTQTPAVKSALPGETVTINCRTSQTVSKGSSGDYLFWYQQKPGEAPKLLIKYANQLQSGFPARFSGSGSGSDFTLTITGVQTEDAGDYYCQSRHEISGYW
Ictalurus punctatus V85 ighv LBML01023555.1 6210 IKCIELVQPAVMVVKLGESFSVPCKITGYSATSSCTNWIRYKSGQALEWIGRYCSSSNTGSKDSLKNKNRFSAEASSNTVILDGENFQTEDTAVYYCARN
Ictalurus punctatus V84 ighv LBML01023555.1 3127 VHCVELIQPGSTVLTPGQSLTLTCKVSGYSLTSTYCTDWIRQPAGKALEWIGRICYDGSTYYSEKLKSRFQVSRDTSSSTVTLTGQNMQTEDTAVYYCARE
Ictalurus punctatus V83 ighv LBML01023553.1 4016 VHGEELTQPASMTVQPGQSLSINCKVSYSVTSYTTFWIRQPAGKALEWIGYINNGGSTAYSDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCARD
Ictalurus punctatus V82 ighv LBML01023546.1 4515 LTQPASMTVQPGQSLSINCKVSYSVTSYRTDWIRQPAGKALEWIGYISSGGSTYYSDKLKNKFSISRDTATNTITIQGQNLQTEDTVVYYCAR
Ictalurus punctatus V81 ighv LBML01023545.1 4221 VHGEELTQPASMTVQPGQSLSINCKVSYSVTSYDTVWIRQPAGKALEWIGYISNNGGTAYSDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCAR
Ictalurus punctatus V80 ighv LBML01023541.1 17243 GIGGVDLTQSASVLVKPGESFSICKISVSRYCISWIRQPAGKALEWLGYLCSGGSTNLKDTMKSKISFSQDTSISTIYLRGQNFQTEDTAVYYCA
Ictalurus punctatus V79 ighv LBML01023541.1 15695 VSSDEIKLDQSSAMVKRPGEHVKISCKINGFDMTEYLMHWIRQKPGKALEWIGYVNSGTTDELTYANSMKGQFLISEDIPTSTQILEAKSLRTQDTAVYYCARD
Ictalurus punctatus V78 ighv LBML01023541.1 12517 VHCVELIQPGSMILTPGQSMTLTCKVSGYSLTSTYCTHWIRQPAGKALEWVGEICGDGNTYYSEKLKSRFQVSRDTSSSTVTLTGQNMQTEDTAVYYCARQ
Ictalurus punctatus V77 ighv LBML01023541.1 5390 VHGVELTQPASMTVQPGQSLSINCKVSYSVTSYTTAWIRQPAGKALEWIGYINSGGNTYYSDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCAR
Ictalurus punctatus V76 ighv LBML01022995.1 20582 VQGEELTQPASMTVQPSQSLSINCKVSYSVTSYYTAWIRQPAGKALEWIGYISNNGGTVYSDKLKNKFSISRDTATNTITIRGQNLQTEDTAVYYCAR
Ictalurus punctatus V75 ighv LBML01022994.1 10350 FCSAEIKLDQSPAVVKRHGESVKISCKISGYSMTSHNIHWIRQKPGKALEWIGRMSTGTNNAIYAESFKNQFTLTEDVPASTQYLEAKSLRTEDTAVYYCARE
Ictalurus punctatus V74 ighv LBML01022994.1 5162 VHCVELIQPGSTVLTPGQSMTLTCKVSGYSLTSTYCTGWIRQPAGKALEWVGEICYDGNTYNSEKLKSRFQISRDTSSSTVILTGQRMQTEDTAVYYCARD
Ictalurus punctatus V73 ighv LBML01022989.1 17823 VNSVEFTQSDNIVVRAGEAFTISCKFSGFSISSYCPRWIRQMPSKTLEYIGYVCGSSSNVKDSLKSKISFSADVSSSTVFLKGQNFQTEDTAVYYCARE
Ictalurus punctatus V72 ighv LBML01022987.1 2208 VHGEELTQPSSMTVQPGQSLSINCKVSYSVTSYYTAWIRQPAGKALEWIGNIYSGGSTAYSDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCARD
Ictalurus punctatus V71 ighv LBML01022987.1 548 VHGISLTSFPAEVKPPGASVKLSCQISGYALTSYGTGWIRQPPGKGLEWIWIIWGGGNINFGASFKTRFSISRDMSNNVLYIDISSLVPEDTAVYYCVK
Ictalurus punctatus V70 trav LBML01022986.1 14712 VHCVELIQPGSTLITPVQSMTLTCKVSGYSVTDSSYCTDWIRQPAGKALEWVAGACGDGKTYHSEKLKSRFQVSRDTSNGTVTLTGQNMQTEDSAVYYCARE
Ictalurus punctatus V69 ighv LBML01022986.1 9496 SYGQSLTSSASVVKRPGESVTLSCTVSGFSMGSYWMSWIRQKPRRGLEWIGYIDGGTGTGFAQSLQGQFSITKDTNKNMLYIEVKSLKAEDTAVYYCARD
Ictalurus punctatus V68 ighv LBML01022986.1 3813 SCSQTLIESDSVIIKPDQSHKLTCTASGLDISSSWMAWIRQAPGKGLEFVAIIESDSDRKFYSNAVNGRFTISRDNSKKQVYLQMNNVRTEDTAVYYCARD
Ictalurus punctatus V67 ighv LBML01022985.1 2509 SYGQSLTSSASVVKRPGESVTLCCTVSGFSTGSNYMSWICQKPGRGLEWIGYIDGGTSTGFAQPLQGQFSITKDTNKNMLYLEVKSLKAEDTAVYYCA
Ictalurus punctatus V141 trav LBML01013524.1 131656 KANCVKVEQTPLLLANETSDVTIHCRHDDGTLLVMLWYQQNSRTVMSLIGYTSGASGDPNYEDGFKDRFNLGRKSTTEGSLTISNLGQSDSAVYYCAARKHSA
Ictalurus punctatus V140 trav LBML01013524.1 131656 KANCVKVEQTPLLLANETSDVTIHCRHDDGTLLVMLWYQQNSRTVMSLIGYTSGASGDPNYEDGFKDRFNLGRKSTTEGSLTISNLGQSDSAVYYCAARKHSA
Ictalurus punctatus V139 trav LBML01013524.1 131656 KANCVKVEQTPLLLANETSDVTIHCRHDDGTLLVMLWYQQNSRTVMSLIGYTSGASGDPNYEDGFKDRFNLGRKSTTEGSLTISNLGQSDSAVYYCAARKHSA
Ictalurus punctatus V138 trav LBML01013524.1 133956 KANCVTFQQTSLILANETGDITISCSHDPSTLPVMLWYQQKSHTVMALIGYTTGTTSDPNYENGFKDQFNLSRKSITEGSLTISNLRQSDSAVYYCAASQHSA
Ictalurus punctatus V137 trav LBML01013524.1 133956 KANCVTFQQTSLILANETGDITISCSHDPSTLPVMLWYQQKSHTVMALIGYTTGTTSDPNYENGFKDQFNLSRKSITEGSLTISNLRQSDSAVYYCAASQHSA
Ictalurus punctatus V136 trav LBML01013524.1 133956 KANCVTFQQTSLILANETGDITISCSHDPSTLPVMLWYQQKSHTVMALIGYTTGTTSDPNYENGFKDQFNLSRKSITEGSLTISNLRQSDSAVYYCAASQHSA
Ictalurus punctatus V135 trav LBML01013524.1 136093 KANCVTFQQSPSTVGGETENITIDCSHDDTNLDCMLWFQRNSRTVLSLIGYTFTDMSDLMYEDELNDRFKLSRQSRTKGSLTISNLHQSDSAVYYCLL
Ictalurus punctatus V134 trav LBML01013524.1 136093 KANCVTFQQSPSTVGGETENITIDCSHDDTNLDCMLWFQRNSRTVLSLIGYTFTDMSDLMYEDELNDRFKLSRQSRTKGSLTISNLHQSDSAVYYCLL
Ictalurus punctatus V133 trbv LBML01013524.1 137097 RVNCVNFQHIPSLLVNETKEVIIQCIHDGTNLNNMLWYQQKSISSMGLIGYIYGATGSPNYEDGFKDRFKMSRKSITEGSLTISKLLQSDSAVYYCAASQHSA
Ictalurus punctatus V132 trav LBML01013524.1 138199 KANCVTFQQTQSTLVNETENITIDCSHDDTNLDSMLWYQQNSRTVMALIGYTFTEASVPKYEDEFTKRFKLSRQGRTKGTLTISNLHQSDSAVYYCAARKHSA
Ictalurus punctatus V131 trav LBML01013524.1 141721 RTNGVTFQQTPSLLVNETENITVSCSHNDNNLARMYWYRQNSRTVLALIGYTLTAMSEPKYEEEFNDRFTLSRQGTLAGTLTISNLRQSDSAVYYCAASKHSA
Ictalurus punctatus V130 trav LBML01013524.1 142937 RTNSVTFQQTPSLLVNETENITVSCSHNDNSLDRMLWYRQNSRTVLALIGYTMTAMSDPKYEEEFNDRFKLSRQGTLAGTLTISNLRQSDSAVYYCAAS
Ictalurus punctatus V129 trav LBML01013524.1 144906 RTNCAKVQQTPSILVNEKENITVSCSHNDNNLDRMLWYRQNSRTVLALIGYTMTAKSDPKYEEEFNDRFTLSRQSTLAGTLTISNLRQSDSAVYYCAASQHSA
Ictalurus punctatus V128 trav LBML01013524.1 146525 RINCVKFQTISSLLVNETEVTIQCSHNDNTLQTMLWYLQNSNTVMALIGYTYTATSKPEYEDGFNVRYKQSRKSITEGSLTISKLLQSDSAVYYCAAR
Ictalurus punctatus V127 trav LBML01013524.1 147600 RANCVKFEQIPSVLANETGDVTIQCSHDDSNLEVMLWYQKKISTVITLIGYTYGAAGEPNYEDGFKDRFKQSRQNTLAGTLTISKLLQSDSALYYCAARKHSA
Ictalurus punctatus V126 trav LBML01013524.1 149208 RTNCVKFEQTLSILATEASDITIQCSHDDSNLYNIYWYQQSSLAIMALIGYTVGANGDPNYEDRFKDRFKQSRQSTLKGNLTISSLRQSDSAVYYCAASIHNA
Ictalurus punctatus V125 igkv LBML01008196.1 25120 SPVYQPDKELSVNIGDSATLQCCISEKEFGMMAWFKQPNRKKPQTIAKVFKTSVETFYSGFKKSRFHIERSSNCFSMMILNITQSDEAMYYC
Ictalurus punctatus V124 igkv LBML01008196.1 25120 SPVYQPDKELSVNIGDSATLQCCISEKEFGMMAWFKQPNRKKPQTIAKVFKTSVETFYSGFKKSRFHIERSSNCFSMMILNITQSDEAMYYC
Ictalurus punctatus V123 trgv LBML01007188.1 17003 HSDVELHQKFLMTKPTTKLAKIECTFPSECRFYIHWYQKKNGEPFKRVQYVDIDDQTTRNDPGFETLKSEKIGNKFVLIIPNLKQEHSATYYCACWVW
Ictalurus punctatus V122 trgv LBML01007188.1 27626 VLGVTVEQKDLSMTKGEGKSVYISCKVTELTTDYVHWYQKKDGEALTRILYVKKNSPVIRDNHLEVNDFDVRTQSDNFDLKIAKLKKSHSAVYYCASWKRD
Ictalurus punctatus V121 trgv LBML01007187.1 111533 DNAVELHQKFLMTKPANKLTEIECTFPSNCRFYIHWYQKKNGEPFKRVQYVDIDDQSICNEPGFETLKSEKRGNKFVLIIPNLKREHSATYYCACWVD
Ictalurus punctatus V120 trgv LBML01007187.1 117261 DNAVELHQKFLMTKPANKLTEIECTFPTDCNYYIHWYQKKNGEPFKRVQYVGIINAYQSNDRGFEFLQSEKIASNKVVLIIPNVKPEHSATYYCACWVD
Ictalurus punctatus V119 trdv LBML01006685.1 8231 DSMADPIKSLFPHKDQYEGDNVILSCSYSGTVRNLYWYRQYPKSKPEFLLYIYPNGDKSVSIPPRLSAEVDDDDNKKQVDLLISSAAVSDSALYYCALE
Ictalurus punctatus V118 trav LBML01006683.1 2425 DSMTEAIKPLLSHKVVHEDDDVTLSCSYKDFSGSVNNLQWYRQYPKSKPEFLLYITPSGFKSPSIPPRLSAKVDDDNNKKQVDLLISSAAVSDSALYYCALR
Ictalurus punctatus V117 trav LBML01006682.1 6777 DSMADPIKSLFPHKDQYEGDNVILSCSYSGTVRNLYWYRQYPKSKPEFLLYIYPNGDKTASIPPRLSAEVDDDDDKKQVDLLISSAAVSDSALYYCALQ
Ictalurus punctatus V116 trav LBML01006680.1 2587 DSMTEAIKPLFSHKVVHEDDDVTLSCSYKDFSGSVENLQWYRQYPKSKPEFLLYIYPNGDKSPSIPPRLSAKVDNNKKQVDLLISSAAVSDSALYYCALR
Ictalurus punctatus V115 trav LBML01006679.1 23448 SIEPLFIHKVVDEGDNVTLSCTYKGSASVNYYLHWYRQYPKSTPEFLLYIHQSGALSSNIPARMSAEVKGDKVDLLISSAAVSDSALYYCALV
Ictalurus punctatus V114 trav LBML01006678.1 21292 SVGPRFTHKVVDEDDDVTLSCSYKTTSPTGNYLHWYRQYPKSTPEFLLYISDGGALSSNIPTRMTAKVNRDNKEVDLLISSAAVSDSALYYCALV
Ictalurus punctatus V113 trav LBML01006678.1 30216 SIKALFPHMVVDEGDDVTLSCRYQTSDTASTLQWYRQYPKSKPEFLLYILQSGVQSPNIPPQMSAKVHGDKVHLIISSAAVSDSALYYCALK
Ictalurus punctatus V112 trav LBML01006676.1 2697 DSMTEAIKPLFSHKVVHEDDDVTLSCSYKDFSGRVDNLQWYRQYPKSKPEFLLYITPRGFKSPSIPPRLSAEVDDDDNKKQVDLLISSAAVSDSALYYCALR
Ictalurus punctatus V111 trav LBML01006676.1 8140 DSMADPIKSLFPHKDQYEGDNVTLSCSYSGTVSILYWYRQYPKSKPEFLLYITPSGVKSDPIPRLSAEVDDDKKQVDLLISSAAVSDSALYYCALQ
Ictalurus punctatus V110 trav LBML01006676.1 11915 DSMTEAIKPLLSHKVVHEDDDVTLSCSYKDFRGTVENLHWYRQYPKSKPEFLLYIYPNGDKSPSIPPRLSAEVDDDDNKKQVDLLISSAAVSDSALYYCALR
Ictalurus punctatus V109 trdv LBML01006676.1 27588 DSLADPIEPLLTHKVVDEGHDVTLSCSYKDFSGTVNTLYWYKQYPKTTPEFLLYIFPNGGKGNSVPRLSAKVYDDKKQVDLLISSAAVSDSALYYCALR
Ictalurus punctatus V108 trav LBML01006675.1 2853 DSMTEAIKPLFSHKVVHEDDDVTLSCNYKDFSGSVNNLQWYRQYPKSKPEFLLYITPRGFKSPSIPPRLSAEVDDDNNKKQVDLLISSAAVSDSALYYCALV
Ictalurus punctatus V107 trav LBML01006675.1 9772 PIEPLSTHKVVDEGDDVTLSCSYKDFSGTVNTLQWYKQYPKSTPEFLLYIYPSGGRSNSVPRLSAKVDNNKKQVDLLISSAAVSDSALYHCAVE
Ictalurus punctatus V106 trdv LBML01006671.1 7033 DSMADPIKSLFPHKDQYEGDNVILSCSYSGTVRTLYWYRQYPKSKPEFLLYITPSGVKSASIPPRLSAEVDDDDNKKQVDLLISSAAVSDSALYYCALE
Ictalurus punctatus V105 trav LBML01006664.1 10101 PIKPLLTSKDVDEGDNVTLSCSYKNSASVPDYLYWYKQYPKSKPEYLLFLTPSGFKSDSIPRLSAKVDNNKKQVDLLISSAAVSDSALYYCALR
Ictalurus punctatus V179 trbv LBML01013532.1 44032 SGVCSVVQSPPDVIKNQDEFAEIKCAHTVNSYNQILWYKHSQDTGFKYVGYLSNAYPKLEEEFETKIKLSGDGSKNGSLSIKSLSVNDSAVYFCAAY
Ictalurus punctatus V178 trav LBML01013532.1 45229 TKDVFQPSILWAKMGQSATINCSHSKDANHNQMYWYRQYHGESMELIVFTTSFGTQDFGKFSQSKFSAIKTVPESGSFTVKDVDYSDSAVYFCAVREHSAI
Ictalurus punctatus V177 trbv LBML01013532.1 46234 SGVCSVVQNPPDLIKYKDEFAEIKCAHTVNNYDRILWYKHNQDTGFTLMGYLYTVSSTLEEEFETKIKLSGDGRNNGSLTIKSLSVNDSAVYFCAAY
Ictalurus punctatus V176 trav LBML01013532.1 48009 GDDVSQPNLISAKMGQSATINCSHTKGSTYYLMYWFRQYHGESMELIVLTNAFGTPDFGKFSESKFSAIQTVPESGSFTVKDVDYSDSAVYFCAVSKHSVI
Ictalurus punctatus V175 trbv LBML01013532.1 49236 SAVFTVDQNPPDLIKYQNETVEMKCEHSVNTYDRMLWYKHSQDTGFKYMGYLNTIFPKEEAEFGTKIKLSGDGRKSGSMTINSLSVNDSAVYFCVA
Ictalurus punctatus V174 trbv LBML01013532.1 51124 FAASKEVFQTPHDLLRKHGESSEIQCAHKISGYDRILWYKQTQDREYLFMGYNFLSQSQLEPEFNNQMTLTGNGDSKGILTIKSLTPNDSAEYFCAAY
Ictalurus punctatus V173 trav LBML01013532.1 52800 VNDVSQPNILWAKFGQSATINCSHTKGSSYNQMYWFRQHHGQSMELIVYTGTFITADFGKFSQSKFSTIKTVAESGSFTVNDVDYNDSAVYFCAVS
Ictalurus punctatus V172 trbv LBML01013532.1 55747 YAASTDVFQTPNDLLRKHGDSSELHCSHSISGYNTIQWYKQTRNTEIQFMGYLVGSQPQLEPEFRNMVTLTGNGYSNGTLTIKSLTPNDSAEYFCAAF
Ictalurus punctatus V171 trbv LBML01013531.1 816 AVISSLNIQQTPQRLLMTPEQIEAKLKCRHGDTNYYYMYWYQQKTVSESIELIGMLQNGRSIPEEKFKARFNISGHATGDAFLLISSLTPEDSAVYFCAASKH
Ictalurus punctatus V170 trbv LBML01013531.1 1869 ISSLNIQQSPKHLLMTPEQNEAKLNCRHGDTNYQYMYWYQQKTVGGLIELIGILHYEKFTPEEKFKARFNISGHSKGDAFLLISSITTEDSAVYFCAAS
Ictalurus punctatus V169 trav LBML01013531.1 8876 DGSGVFQMPDVIWGSPGSSAEMNCSHNKDINYRQMYWFKQLPGEGITLLVFTSVGVEPDYGKFSKDKYGAIKTVVESGSLTVKNLDRGDSALYFCAVS
Ictalurus punctatus V168 trbv LBML01013531.1 20912 SLICKDVHQSPADVLCLPDESVTLTCNHSIPNYNTILWYQRKQGDTGLKLIGYVYYTKPEYENNYEGNFTVRGEGKSSVPLQIPKATQVLHSALYFCAAS
Ictalurus punctatus V167 trav LBML01013531.1 22849 SLICKDVHQSPADVLCLSEESVTLTCNHSITNYDTILWYQRTQEDTGLKLIGYVYATSPKYEGNYEGNFTMSGNGRSSASLQIPKARQVLHSALYFCAAYYTQ
Ictalurus punctatus V166 trbv LBML01013531.1 32618 NGVTQSPRVAWHLKGESAVMKCSHNKDATYYQMYWYRQRQGESMELIVYTTPSSEPEFGSVDKNKFSTVKKIAANGSLTVKDLDTEDSAVYFCAVK
Ictalurus punctatus V165 trbv LBML01013531.1 34000 RSSAAKDVHQTPTDLIKDTQESTNLSCSHAIPSHQVMLWYRRSENKQLQLLGYLNSKFPYPEDSLKAKIELHGDGNNEGKLTIKNLQPDDSAVYFCAVRL
Ictalurus punctatus V164 trbv LBML01013531.1 35617 FSQSDLVFQTPLDLFGNHKQSVKIQCVHSVPNYNRIIWYKETQDQGLTLIGYQVGKSSPQIENDFKLKVEIAGDGNKNVSLTIKNLSSNDSVVYFCAAY
Ictalurus punctatus V163 trbv LBML01013531.1 38948 RSSAAKDVHQTPPDLIKNIQESTDLSCSHSIPNHEFMLWYKRSENKQLQLLGYLNSKFPYPEDSLKAKIELHGDGNNEGKLTIKNLQPDDSAVYFCAVRL
Ictalurus punctatus V162 trbv LBML01013531.1 42178 RSSAAKDVHQTPTDLIKDIQESTNLSCSHAITSHQVMLWYRRSENKQLQLLGYLNLKFPYPEDSLKAKIELHGDGLNEGKLTIKNLQPDDSAVYFCAVKQ
Ictalurus punctatus V160 trbv LBML01013530.1 774 AVISSLNIQQTPQRLLMTPEQIEAKLKCRHGDASYPYMYWYQQKTVSDSIELIGMLQYGRSIPEEKFKARFNISGHATGDAFLLISSITTEDSAVYFCAAS
Ictalurus punctatus V159 trav LBML01013529.1 10952 RTSCVKVQQIPRSLIAREQDNIMIQCSHDDSSLLLMLWYQQKSDSTDFSLITYAYGTGQPTNEDGFKDRFKLSKESGLKGTLTISNLLQSDSAVYYCAASKHSA
Ictalurus punctatus V158 trav LBML01013529.1 12112 MVDSINFQQDPHLIVSQTAKAKISCSHNDRTLTVMLWYRQERASTHLTLISYGYSTGTPFYEPGFNERFEMTRQDALSGELSISNPGLSDSAVYYCAAS
Ictalurus punctatus V157 trav LBML01013529.1 12971 RTNCAKVQQSSSLLVNETQNVTIHCSHDDGDLDIMLWYQQKINSEMALIGYSYGMNEPNNEDNFKDRFKQSREDTQNGKLTISNVLQSDSAVYYCA
Ictalurus punctatus V156 trbv LBML01013529.1 14728 SCMGVLITQWPKYISSFKSTSVDMHCYQNDTDYDYTYWYRQIEGKEPVLIARYVAGSPIQEKGFENGFKAWGTKKKWSLTVDVEEDSDAVYLCAAS
Ictalurus punctatus V155 trav LBML01013529.1 15310 LSDCVQFEQPSDLIVNLKDNVKISCKHNDKNLDVMLWYHKWRESTTMALIGYSYATVPPNNEPGYPDTRFTQTRIDTVTGDLTISNLNLSDSAVYYCGAR
Ictalurus punctatus V154 trav LBML01013529.1 16614 RTNCANIQQSSSLLVKETQNVTIQCSHENNNLYVMLWYQQKTNGGMALIGYSYGMTEPKNEEDFKDRFEQSRQSIMAGKLTISKVLQSDSAVYYCA
Ictalurus punctatus V153 trbv LBML01013529.1 18141 SSKGVLITQWPKYISSFKSTSVDMHCYQNDTDYQYTYWYRQIEGKEPVLIATYIARSPSYETGFGKGFKVWGSETKKWSLTVDVEEDSDAVYLCAAN
Ictalurus punctatus V152 trav LBML01013529.1 18706 CVRFEQPSDLIANLTDNVKISCKHDDKNLYVMLWYQQRRESTTMALISYNYDTATPNYEAGYTTRFEHNRIDTVTGDLTISNLNLSDSAVYYCAARMHSASVS
Ictalurus punctatus V151 trbv LBML01013529.1 23698 TAISSLNIQQSPKHLLLTPEQNEAKLKCRHGDTNYQYMYWYQQKAVGGSFELIGILVYGRSTPEEKFKARFNISGQSTGDAFLLISSITTEDSAVYFCAASKH
Ictalurus punctatus V150 trbv LBML01013529.1 26768 TVLSSLNIQQSPKHLLLTTEQSEAKLSCRHGDTSYQYMYWYQQKAVGGAFDLIGMLLFERSTPEEKFKARFNISGHSTGDAFLLISSITTEDSAVYFCAAS
Ictalurus punctatus V149 trbv LBML01013529.1 28947 IFSLNIQQSPKHLLLTPEQNEAKLNCRHGDTSYLYMYWYQQKAVGGLVELIGMLQYERSTPEEKFKARFNISGHSTGDGFLLISSTTTEDSAVYFCAAS
Ictalurus punctatus V148 trbv LBML01013529.1 32199 AVISSLNIQQTPQRLLMKPEQIEAKLKCRHGDTNYYYMYWYQQKTVSDSIELIGMLQYGTSTPEEKFKARFNISGHATGDAFLLISSITTEDSAVYFCAAR
Ictalurus punctatus V147 trav LBML01013526.1 1247 RTNCVKFLQTPSLIENASSNVTIQCSHDDSSLTRMYWYQQNSRTIMALIGYTVGASSDPNYEDGFKDRFKQSRQGTLNGSLTISNLRQSDSAVYYCAASMHNA
Ictalurus punctatus V146 trbv LBML01013524.1 125100 SLHGVSIIQNPTLLIKKGGESVEIVCQHDDTSHYYMYWYRQRSLGEMDMITMSSGKDTAQTVEPYNDSKYSMIRTEVKHSTLQIKALEANDSAVYFCASSSTVF
Ictalurus punctatus V145 trbv LBML01013524.1 125100 SLHGVSIIQNPTLLIKKGGESVEIVCQHDDTSHYYMYWYRQRSLGEMDMITMSSGKDTAQTVEPYNDSKYSMIRTEVKHSTLQIKALEANDSAVYFCASSSTVF
Ictalurus punctatus V144 trav LBML01013524.1 130195 RANCVKIEQISSLLANETGEVTIQCSHDDNNLEVMLWYVQNSRTVMALIGYTNTAIGQPNYEDEFNDRYKQSRTSMTEGSLTISKLLQSDSAVYYCAASQHSAVY
Ictalurus punctatus V143 trav LBML01013524.1 130195 RANCVKIEQISSLLANETGEVTIQCSHDDNNLEVMLWYVQNSRTVMALIGYTNTAIGQPNYEDEFNDRYKQSRTSMTEGSLTISKLLQSDSAVYYCAASQHSAVY
Ictalurus punctatus V217 ighv LBML01023428.1 6528 VHCVELIQPGSTVLTPGQSMTLTCKVSGYSLTDSSYCTGWIRQPAGKALEWVALACGSGSTYHSEKLKSRFQVSRDTSSSTVTLTGQNMQTEDTAVYYCAR
Ictalurus punctatus V216 ighv LBML01022995.1 28037 VFGAIDFAQPGHVVVQPGQALTIGCKVSGYSLTDNSYCTNWIRHATGENMQWIGYICSSGSTGYTDSLKNRFSITQDTSSNTVTLQGQNVQMEDTAVYYCVRYR
Ictalurus punctatus V215 ighv LBML01022995.1 28037 VFGAIDFAQPGHVVVQPGQALTIGCKVSGYSLTDNSYCTNWIRHATGENMQWIGYICSSGSTGYTDSLKNRFSITQDTSSNTVTLQGQNVQMEDTAVYYCVRYR
Ictalurus punctatus V214 igkv LBML01018420.1 4937 QVTVTQTPSVQTVDPGKTVTFNCRTSSSVHGGSNLHWYLQKPGEAPKLLIYLATYLQSGTPARFSGSGSNTDFTLTIRGVQTEDAGDYYCQS
Ictalurus punctatus V213 igkv LBML01018420.1 4937 QVTVTQTPSVQTVDPGKTVTFNCRTSSSVHGGSNLHWYLQKPGEAPKLLIYLATYLQSGTPARFSGSGSNTDFTLTIRGVQTEDAGDYYCQS
Ictalurus punctatus V212 igkv LBML01018328.1 84934 QVTVTQTPSVQTVDPGKTVTFNCRTSSSVAGGTDLAWYLQKPGEAPKLLIYYATSLQSGTPARFSGSGSNTDFTLTIRGVQTEDAGDYYCQSYHYISSRDV
Ictalurus punctatus V211 igkv LBML01018328.1 95820 QVTVTQTPSVQTVDPGNTVTFNCRTSSSVYNGNGLAWYLQKPGEAPKLLIYDATSLQSGTPARFSGSGSNTDFTLTIRGVQTEDAGDYYCTSFHVISSSWV
Ictalurus punctatus V210 igkv LBML01015041.1 15058 CSGQATVTQTPAVKSALPGETVTINCRTSQAVYHHSSYGHYLHWYQQKPGEAPKLLIKLANQLQSGIPARFSGSGSGSDFTLTISGVQTEDAGDYYCQSYHE
Ictalurus punctatus V209 igkv LBML01015041.1 25213 CRGQVTVTQTPAVKSALPGETVTINCRSNPAVYKDSDGEWLHWYQQKPGEAPKVLIKLVNQLQSGIPARFSGSGSGSDFTLTISGVQTEDAGDYYCQSWHSISGYW
Ictalurus punctatus V208 igkv LBML01015041.1 31078 CSGQATITQTPAVKFALPGETVTINCRSNPAVHHHSSYGHYLHWYQQKPGEAPKLLIKFANQLQSGFPARFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Ictalurus punctatus V207 igkv LBML01015040.1 2461 TQTPAVKSALPGETVTINCRTSQAVYKDSNGDWLHWYQQKPGEAPKLLIKLGNRLQSGIPARFSGSGSGSDFTLTISGVQTEDAGDYYCQSYHA
Ictalurus punctatus V206 igkv LBML01015039.1 4181 TQTPAVKSALPGETVTINCRTNPQVYQGWDYQPLAWYQQKPGEAPKLLIIKANQVQSGIPARFSGSGSGSDFTLTISGVQTEDAADYYCQS
Ictalurus punctatus V205 igkv LBML01015037.1 1898 QVTVTQTPAVKSALPGETVTINCRTSQAVYSSNYLHWYQQKPGEAPKLLIKIANQLQSGFPARFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Ictalurus punctatus V204 igkv LBML01015036.1 1854 QVTVTQTPAVKSALPGETVTINCRTNPAVYYYSSYGHYLNWYQQKPGEAPKLLIKFANQLHSGIPARFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Ictalurus punctatus V203 igkv LBML01015035.1 6709 TQTPAVKSALPGETVTINCRTNPQVYQGWGYQPLAWYQQKPGEAPKLLIIKANQLQSGIPARFSGSGSGSDFTLTISGVQTEDAGDYYCQSWHDITGYW
Ictalurus punctatus V202 igkv LBML01015034.1 3612 CRGQATVTQTPAVKSALPGETVTINCRTSQAVYSSNYLHWYQQKPGEAPKLLIKIANQLQSGIPARFSGSGSGSDFTLTISGVQTEDAADYYCQSWHAISGYW
Ictalurus punctatus V201 igkv LBML01015034.1 11337 CRGQVTVTQTPAVKSALPGETVTINCRTSQAVYSSNYLFWYQQKPGEAPKLLIKLVNQLQSGFPARFSGSGSGSDFTLTISGVQTEDAGDYYCQSYHYIS
Ictalurus punctatus V200 igkv LBML01015033.1 2628 CRGQITVTQTPAVKSALPGETVTINCRTSQAGINDNWLHWYQQKPGEAPKLLILYANRLQSGFPARFKGSGSRSDFTLTITGVQTEDAGDYYCQSYHYIS
Ictalurus punctatus V199 igkv LBML01015033.1 9839 CSGQATVTQTPAVKSALPGETVTINCRTSQTVSKDSNGDRLHWYQQKPGEAPKLLIKYVKQLQSGFPARFSGSGSGSDFTLTISGVQTEDAGDYYCQSYHAISGYW
Ictalurus punctatus V198 igkv LBML01015032.1 64927 QVTVTQTPAVKSALPGETVTINCRTNPAVYKSLSGDWLHWYQQKPGEAPKLLIKLANQLLSGIPARFSGSGSGSDFTLTISGVQTEDAGDYYCQS
Ictalurus punctatus V197 igkv LBML01015032.1 73494 TQTPAVKSALPGETVTINCRTSQAVSSHSSYGHYLHWYQQKPGEAPKLLIKYVKQLQSGFPARFSGSGSGSDFTLTISGVQTEDAGDYYCQ
Ictalurus punctatus V196 igkv LBML01014873.1 52937 QVTVTQTPSVETVVPGNTVTINCRFSTAVYHDCGPTGVSYDCLAWYLQKPGEAPKLLVHYVSHLFSGTPARFSGSGSKTDFTLTISGVQAEDAGDYYCQSYHSGGV
Ictalurus punctatus V195 igkv LBML01014873.1 59242 QVTVTQTPSVQTVVPGNTVTINCRFSTAVYHDCGPTGVSYDCLAWYLQKPGEAPKLLVHYVSHLFSGTPTRFSGSGSKTDFTLTISGVQAEDAGDYYCQSYHSGDV
Ictalurus punctatus V194 igkv LBML01014873.1 63472 QVTVTQTPSVETVVPGNTVTINCRFSTAVWHDCGPTGVSYDCLAWYLQKPGEAPKLLVHYVSHLFSGTPARFSGGGSKTDFTLTISGVQAEDAGDYYCQS
Ictalurus punctatus V193 igkv LBML01014769.1 18830 SFGETVLTQSPGSQSVSPGQSVTLTCTSSQGVSYYLAWYLQKPGEAPKLLIYYASNRQSGIPDRFSGSYSGSQFSLKISGVQSEDAGDYYCQLEYVPY
Ictalurus punctatus V192 trav LBML01013532.1 780 SLICKDVHQSPADVLCLPEESVTLTCNHSIPDYYTILWYQRTQEDTGLKLIGYVYTTNPKYEGNYEGNFTVSGDGRSSVSLQIPKARQVLHSALYFCAAYYTQ
Ictalurus punctatus V191 trbv LBML01013532.1 2287 LSQSNLVFQTPPDLFGNHKQSVKIQCEHSVPNYNQINWYRETQDQGLTLIGYQYGTSSPQIENDFKLKVEIARDGNKNVSLTIKNLSSNDSVVYFCAAS
Ictalurus punctatus V190 trav LBML01013532.1 6084 WSSAVKNVHQTPPDLIKNLQQSTELNCSHSIPGYDVMLWYKQSDSNELQILGHLNMHLKNPEQSLTNKISLDGNGENTGKITIKNLQLNDSAVYYCAVR
Ictalurus punctatus V189 trav LBML01013532.1 6839 ENGVTQSPSVAWHLKGESAEMKCSHNKGAEYYQMYWYRQRQGESMELIVYTTASSEPDFGSVDKNKFSTVKKLATNGSLTVKDLDTEDSAVYFCAVR
Ictalurus punctatus V188 trbv LBML01013532.1 10318 NGASQNPRVAWHLKGESAEMKCSHNKGASYFQMYWYRQRQGESMELIVYTTPSSEPDFGAVDKNKFSTVKKIAANGSLTVKDLDTEDSAVYFCAVSEHSVT
Ictalurus punctatus V186 trbv LBML01013532.1 27786 QQQNYEIHQSPSKLMTFPGENTELHCKHSVSLFYTILWYQQSLNDISMKLIGYVYYRQVNVENSFKSHFNVSGDGQKQSTLHLVKVRAAEHSAVYYCAASR
Ictalurus punctatus V185 trav LBML01013532.1 30396 ANDVFQPNILWAEMGQSPTINCSHTKGVDYNKMYWFRQHQGESMELIVYTTSFGTPDFGKFDPNKFSAIKPNPESGSFTVKDVDNSDSAVYFCAVSKHSVL
Ictalurus punctatus V184 trbv LBML01013532.1 32096 AVFSSKVQQSPSDLIQSRGDTVELKCLHSIESYNIILWYKSNASHTFELMGYLWNKKDYVEPNFTEKIELKGDASKNGALIIKTLSSDDSTMYFCAAS
Ictalurus punctatus V183 trbv LBML01013532.1 34061 LTSGMVVEQTPPDLIKNQGESAKIRCSHKIEKYDRIMWYKETKNKEFIFMGYLISKNANPETDFKDKIRIGGDAFDGFGSLEVINLSLKSEGVYFCAAY
Ictalurus punctatus V182 trbv LBML01013532.1 35543 STVSAVLQNPPDLIKNQNEFVELKCAHTVKSYNRILWYKRSQDTRFTLMGYLFNNSPRLEADIKMKINLTGDGRNNGSLTIDNVSVNDSAVYFCAAY
Ictalurus punctatus V181 trav LBML01013532.1 36622 ANDVLQPDILWAQFGQSVTINCSHTKGSVYREMYWFRQYQGESMELIVYTTSFGTQDFGKSDQKKFSAIKTVPENGSFTVKDADYNDNAVYFCAVREHSAI
Ictalurus punctatus V250 trav LBML01029313.1 765 SIEPLFIHKVADEGDNVTVSCTYKFSVSGNNYLHWYRQYPKSTPDFLLSIHQSGALSSNIPPRMSAEVKGDKVDLLISSAAVSDSALYYCALA
Ictalurus punctatus V249 ighv LBML01028810.1 128 VHGISLTSSPAEVKPLGASVKLSCQISGYALTSYSTGWIRKPPGKGLEWIGIIRGGGGIASGASFKTLFSISRDTSNNVLYLDISSLVPEDTAVYYCAK
Ictalurus punctatus V248 trav LBML01028584.1 136 DSMADPIRPLVSHSVVDEGDNVTLSCSYKGFTGSIYSVQWYRQYPKSKPDFLLYITPSGDLSLNIPPRMSANINGEKQVDLLIFSTAVSDSALYYCALV
Ictalurus punctatus V247 trav LBML01027636.1 476 SIEPLFIHKVADEGDDVTLSCTYKFSVSVNNYLHWYRQYPKSTPEFLLYISQSGALSSNIPARMSAEVKGDKVDLLISSAAVSDSALYYCALV
Ictalurus punctatus V246 igkv LBML01026958.1 812 QVTVTQTPSVQTADPGKTVTINCRTSSSVYGGSYLHWYLQKPGEAPKLLIYYATSLQSGTPARFSGSGSDTDFTLTIRGVQTEDAGDYYCLSDHYIGSSYV
Ictalurus punctatus V245 ighv LBML01026777.1 1172 SYGQSLTSSASVVKRPGESVTLSCTVSGFSMSSYYMQWIRQKPRRGLEWIGYINYGTGTGFTQSLQGQFSITKDTNKNMLYLEVKSLKAEDTAVYYCARE
Ictalurus punctatus V244 ighv LBML01026710.1 480 VHCVELIQPGSTVLTPGQSMTLTCKVSGYSLTDSSYCTGWIRQPAGKALEWIGHICGSGNTYYSEKLKSRFQVSRDTSSSTVTLTGQNMQTEDTAVYYCARQ
Ictalurus punctatus V243 ighv LBML01026604.1 152 LTPGQSMTLTFKVSGYSLTDSSYCTAWIRQPAGKALEWIGRICGSGSTLYSEKLKSSFQVSRDTSSSTVTLTGNNMQTEDTAVYYCARE
Ictalurus punctatus V242 trav LBML01026338.1 1556 SIEPLFIHKVVDEGDNVTLSCRYNSSASQNNYLHWYRQYPKSTPEFLLYIHQSGALSSNIPPRMSAEVNGDNKQVDLHISFTAVSDSALYYCALA
Ictalurus punctatus V241 igkv LBML01025796.1 2095 QVTVTQTPSVQTADPGKTVTFNCRTSSRVYSGDTLHWYLQKPGEAPKLLIHDATSSYTGTPARFSGSGSDTDFTLTIRGVQTEDAGDYYCQSYHEIGSSYV
Ictalurus punctatus V240 trav LBML01025780.1 108 LAGENGVTQNPSVAWHLKGESAEMKCSHNKGSGYYQMYWYRQRQGESMEFIVYTTTSESDFGSVDKNKFSTVKKIAANGSLTVKDLDTEDSAVYFCAVK
Ictalurus punctatus V239 trbv LBML01025780.1 2782 LSQSNLVFQTPPDLFGNHTQSVKIQCEHSVPNYNQINWYRETQDQGLTLIGYQLRTSSPQIENDFKLNVEIAGDGNKNVSLTIKNLSSNDSVVYFCAAY
Ictalurus punctatus V238 ighv LBML01025503.1 913 SCSQTLIESDSVIIKPDQSHKLTCTASGLDISSYYMAWIRQAPGKGLEFVATVYSSNKYYSSAVNGRFTISRDDSKKQVYLHMTSVRTEDTAVYYCARD
Ictalurus punctatus V237 ighv LBML01025196.1 1384 VFCATELIQPDSLVIKPGETLTITCRVSGASITDSSSHFGTAWIRQPAGKSLEWINTIDYDGDIYEKDSLKDKFVVSRDISSNTLTLRGQNMQTEDTAVYYCARD
Ictalurus punctatus V236 ighv LBML01025033.1 3184 VHGEELTQPASMTVQPGQSLSINCKVSYSVTSYRTAWIRQPAGKALEWIGYISSGGSTAYSDKLKNKFSISRDTATNTITIGGQNLQTEDTAVYYCAR
Ictalurus punctatus V235 ighv LBML01025033.1 5695 SYGQSLTSSASVVKRPGESVTLSCTVSGFSMGSYYMSWIRQKPGRGLEWIRYVDTGTSTTFAQSLQGQFSITKDTNKNMLYLEVKSLKAEDTAVYYCA
Ictalurus punctatus V234 ighv LBML01025033.1 8009 CGCQTLTESEPVVIKPGGSHQLTCTYSGISDGSADISWIRQAQEKGLEWISFISAPSGSTKQYSQSVQGRFTISRDNSKKQVYLHMTSLKTEDTAVYYCART
Ictalurus punctatus V233 ighv LBML01025033.1 10219 GVDLTQSASVLVKPGDSFSISCKISVSSYCIHWIRQPAGKALEWLGYLCSSGSTNLKDTMKSKISFSQDTSISTVYLRGQNFQTEDTAVYYCARDTDLQ
Ictalurus punctatus V232 trav LBML01025011.1 3081 KTSDVEDLQVQIVKRGENVTIKCDDFNGDKNKLVWFKQSFGKLPQLIVKPVEKTIRYGAGFNEGRFSTSVDKLFHLNIKEIKEEDSGTYFCAEELNS
Ictalurus punctatus V231 igkv LBML01024873.1 5554 TVTQTPAVKSALPGETVTINCRTSQAVYSSNYLHWYQQKPGEAPKLLIKLVNQLQSGFPARFSGSGSGSDFTLTISGVQTQDAGDYYCQS
Ictalurus punctatus V230 igkv LBML01024871.1 1170 CSAQATVTQTPAVKSALPGETVTINCRTSQTVSKGSSGEHLFWYQQKPGEAPKLLIKYANQLQSGIPARFSGSGSGSDFTLTISGVQTEDAGDYYCQSRHSISGYW
Ictalurus punctatus V229 trav LBML01024630.1 164 DSMADPIRPLVSHNVVDEGDNVTLSCSYKGFTENIYNVQWYRQYPKSKPDFLLYITPSGELSLNIPPRMSAKVNGDKQVDLLIFSTAVSDSALYYCALV
Ictalurus punctatus V228 trav LBML01024630.1 8996 TVDSSITPDQTIISSSEGSITTLTCTYNQSAYSLHWYRQKPQSGPEFLLLIILSSNDVINAKQPDPRLSIRLREGKKVDLEIFPAAVSDSALYYCALQPTA
Ictalurus punctatus V227 igkv LBML01024343.1 23197 QVTVTQTPSVQTVDPGQTVTFNCRTSSRVDDGTDLAWYLQKPGEAPKLLIYAATRSYTGTPARFSGSGSNTDFTLTIRGVQTEDAGDYYCQS
Ictalurus punctatus V226 igkv LBML01024340.1 3707 SRGQVTVTQTPSVQTADPGKTVTFNCRTSSSVHGGSNLHWYLQKPGEAPKLLIYYATSSYTGTPARFSGSGSNTDFTLTIRGVQTEDAGDYYCQS
Ictalurus punctatus V225 igkv LBML01024340.1 14279 SRGQVTVTQTPSVQTADPGKTVTFNCRTSSKVDGGTDLAWYLQKPGEAPKLLIHDATSSYTGTPARFSGSGSNTDFTLTIRGVQTEDAGDYYCQS
Ictalurus punctatus V224 igkv LBML01024287.1 7602 QVTVTQSPAVKPVSPGETLTISCKTSSAVHRWSDGDEGIFWYQQKAGEAPKLLIKYVKKLESGIPARFSGSGSGSDFTLTISGVQTEDAGDYYCQSYHSISGSDV
Ictalurus punctatus V223 ighv LBML01023705.1 1753 VHCVELIQPGSTVLTPGQSMTLTCKVSGYSLTDSSYCTHWIRQPAGKALEWIGRICSSGGTEYSEKLKSRFQVSRDTSSSTVTLTGNNMQTEDTAVYYCARE
Ictalurus punctatus V222 ighv LBML01023705.1 3610 VHGISLTSCPAEVKPPGASVKLSCQISGYALTSYGTGWIRQPPGKGLEWIRIIWGGGGIDSGASFKTRFSISRDTSNSVLYLDISSLVPEDMVVYYCAK
Ictalurus punctatus V221 ighv LBML01023431.1 1852 IKCIELVQPPVMVVKPGESFSVPCKITGYSATSGSTCTNWIRHKSGQALEWIGWYCSSSDTGSKDSLKNKIRFSAEVSSNTVILHGQNFQTEDTAVYYCARN
Ictalurus punctatus V220 ighv LBML01023431.1 5032 VHCVELIQPGSTVLTPGQSLTLTCKVSGYSLTSTYCTHWIRQPAGKALEWIGCICYDGSTYYSEKLKSRFQVSRDTSSSTVTLTGQNMQTEDTAVYYCARE
Ictalurus punctatus V219 ighv LBML01023430.1 4256 SCSQTLIESDSVIIKPDQSHKLTCTASGLDFGGYWMAWIRQAPGKGLEFVAATYDTSNIRYSSAVNGRFTISRDNSEKQVYLQMNSVRTEDTAVYYCARD
Ictalurus punctatus V251 igkv LBML01029766.1 498 SFGEIVLTQSPGSQSVSPGQSVTLTCTSSQGVSNYLHWYLQKSGEAPKLLIYYASNRQSGIPDRFSGSGSGSQYNLKISGVQSEDAGDYYCQLEYVP
Ictalurus punctatus V218 ighv LBML01023429.1 8239 VHCVELTQPASMTVQPGQSLSINCKVSYSVTSYSTAWIRQPAGKALEWINLIYYDGDIRQKDSLKNKFVISRDTSSNTVTLQGQNMQTEDTAVYYCARY
Ictalurus punctatus V187 trbv LBML01013532.1 17426 QLQKYSIHQSPSDLVKFPEENTEVHCKHSVSEFYVMMWYQQSLNNTSMKLIAHLYFKQATVENSFSSHFNVSGDGEKHSTLHLIKLTEAEHSAVYYCAASR
Ictalurus punctatus V180 trbv LBML01013532.1 40013 NDVFQSSILWAKMGQSATINCSHNRDATHNQMYWYRQYHGESMELIVYTTSFGTQDFGRFDQSKFSAIKTVPESGSFTVKDVDYNDNAVYFCAVSKHSAI
Ictalurus punctatus V161 trbv LBML01013531.1 45354 FSQSDLVFQTPLDLFGNHKQSVKIQCVHSVPSYNQINWYRETQDQGLTLIGYQLGKSSPQIENDFKLKVEIAGDGNKNVSLTINNLSSNDSVVYFCAAY
Ictalurus punctatus V142 trav LBML01013524.1 130211 RANCVKIEQISSLLANETGEVTIQCSHDDNNLEVMLWYVQNSRTVMALIGYTNTAIGQPNYEDEFNDRYKQSRTSMTEGSLTISKLLQSDSAVYYCAAS
Ictalurus punctatus V104 trav LBML01006663.1 111694 DSMTEAIKPLFSHKVVHEDDDVTLSCSYKDFSGRVDNLQWYRQYPKSKPEFLLYITPRGIKSPSIPPRLSAEVDDDNNKKQVDLLISSAAVSDSALYYCALR
Ictalurus punctatus V66 trav LBML01022984.1 8118 VHCVELIQPGSTLITSGQSMTLSCKVSGYSVTDSSYCTDWIRQPAGKALEWIAGACGDGKTYHSEKLKSRFQISRDTSSGTVTLTGQNMQTEDSAVYYCTRE
Ictalurus punctatus V29 trav LBML01006647.1 44017 AVDSSITPDQTIISSSEGSITTLTCTYNQSAYSLHWYRQKPQSGPEFLLLIIVSSNDVINAKQPDPRLSIRLREGKKVDLEIFPAAVSDSALYYCALEPT
Ictalurus punctatus V22 ighv LBML01002418.1 4834 VHCVQLIQPGAMILSPGQSITLTCKVSGYSVSDGSYWTHWIRQPAGKALEWVGQISGSGSTYYSEKLKSRFQVSRDTSSSTVTLTGQNMQTEDTAVYYCARE