WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Kryptolebias marmoratus LWHD00000000.1 (LWHD01) 77 36 0 18 11 8 1 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Kryptolebias marmoratus V4 trbv LWHD01000002.1 10583000 ASDQTFVFQTPPSIIKKPGESVDGEIHCSHNASDSDHLLWYKQDKHQAPKCLGYLNRNMPHPEEDVEDRINFAGESSDYSNLTISAVSVNDSAVYFCAVS
Kryptolebias marmoratus V3 trbv LWHD01000002.1 10581538 SDVTQPSVVWKNKGENATMDCSHTKGDLYFQMYWYRQLPGETMKQIVFTSTGTSQHDFGDFSKDKFSATKTVASSGTFTVKNLGPEDEGLYFCAVS
Kryptolebias marmoratus V1 igkv LWHD01000002.1 9417469 CSGQVTVTQTPVETFTPGSTVTLRCKTNPVVRRWDDGDEGMSWYQQKPGQTPKLLIYLVKNLQSGTPARFSGSGSGSDFSLTISGVEAADAAVYYCKSIHVINSADVF
Kryptolebias marmoratus V0 igkv LWHD01000002.1 9417469 CSGQVTVTQTPVETFTPGSTVTLRCKTNPVVRRWDDGDEGMSWYQQKPGQTPKLLIYLVKNLQSGTPARFSGSGSGSDFSLTISGVEAADAAVYYCKSIHVINSADVF
Kryptolebias marmoratus V40 trav LWHD01000062.1 2612547 VKCEQLTQPASETLQPGQRLTISCQVSYALSSYYTAWIRQPAGKGLEWIGMKYTGASYYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDSAVYFCARE
Kryptolebias marmoratus V39 ighv LWHD01000062.1 2613795 VGGQTLTESESVIKRPGESHRLTCTGSGFTFSSYPMNWVRQAPGKGLEWIAFVHTGSSHFFYSQSVQDRFSISRDDSSSKVFLQMNSLKTEDTAVYYCARQ
Kryptolebias marmoratus V38 ighv LWHD01000062.1 2614873 TEGQTLTESESVVKRPGESHRLTCTYSGFGGHYWNAWIRQAAGKRLEWIATISDSSGSIYYSQSVKNRFTISRENSRDQVYLQMNSLTTEDSAVYYCARE
Kryptolebias marmoratus V37 ighv LWHD01000062.1 2623862 VCSQTLTESEPAVKRPGESHKLTCTYAEISDSDAFISWIRQAEGKGLEWVAQISAPSGSNKYYSTSVQNRFTISRDNDRDQVYLHMSSLKTEDSAVYYCARR
Kryptolebias marmoratus V36 ighv LWHD01000062.1 2625437 VFCIDLIQPESKVVQPGQSLSIICRVSGYSVTDNSYATGWIRQREGKPLEWIFHMWGGGGFYQNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVRR
Kryptolebias marmoratus V35 ighv LWHD01000062.1 2627505 CSGQSLESIPSSPVVKRPGETLSLSCRGSGFTFTYAMSWIKQPEGKALQWMGLAWGDSSTIYSSSFQGRIEITRDNSNNMVYLKLSNLRPEDSAVYYCARR
Kryptolebias marmoratus V34 ighv LWHD01000062.1 2628626 TEGQTLTESESVVKRPRESHRLTCTYSGFSSTPRIAWIRQAAGKGLEWIATISYDSSYIYYSESVKNQFTISRENSRYQVYLQMNSLTTEDSAVYYCARE
Kryptolebias marmoratus V33 ighv LWHD01000062.1 2630082 CSGQSMESIPSSPVVKRPGETLSLSCRGSGFTFSSYGINWIKQPEGKGLQWMGYIYTHGSNTYYSSSFQDRIEITRDNSNNMVYLKLSNLRPEDSAVYYCARD
Kryptolebias marmoratus V32 ighv LWHD01000062.1 2631140 TEGQTLTESESVVKRPRESHRLTCTYYGFSSDPHIAWIRQAAGKGLEWIAYISGGSSSIYYSESVRNRFTISRENSRNQVYLQMNSLTTEDSAVYYCARE
Kryptolebias marmoratus V31 ighv LWHD01000038.1 52875 VEGQTLIESEPVVKRPGESHRLTCTVSGFTLSSFWMHWVRQAPGKGLEWIAADSGGAQYYSQSVQGRFTISRDNNRQQVYLQMNSLRTEDSAVYYCARD
Kryptolebias marmoratus V30 ighv LWHD01000038.1 57490 QTLTESEPVVKRPGESHRLTCTASGFTLSSYYMAWNRQTPGKGLEWVAWHDSGSGSARYYSQSVQGRFTVSRDDSRQQLILQMNNLRTEDSAVYYCA
Kryptolebias marmoratus V29 ighv LWHD01000038.1 59474 VTCEQLTQPASVTVQPGQRLTITCQVSYSVTGYWTAWIRQPAGEGLEWIGSRVGGSTSYKDSLKNKFSIDLDSSSNTVTLNGQNMQPEDSAVYYCARD
Kryptolebias marmoratus V28 ighv LWHD01000038.1 62776 VEGQTESDPVIKRPGESHRLTCTGSGFTFSSYHMNWVRQAPGKEPEWVALAHTGSSHFFYSQSVQGRFTISRDDSISKLYLQMTNLRTEDSAVYYCAR
Kryptolebias marmoratus V27 igkv LWHD01000002.1 9459439 CSGQVTVTQTPVETFTPGSTVTLRCKTDPDVLRYSDGDEGMSWYQQKPGQTPKLLIYLVKNLQSGTPARFSGSGSGSDFSLTISGVEAADAAVYYCQSYHNINSAYVF
Kryptolebias marmoratus V26 igkv LWHD01000002.1 9459439 CSGQVTVTQTPVETFTPGSTVTLRCKTDPDVLRYSDGDEGMSWYQQKPGQTPKLLIYLVKNLQSGTPARFSGSGSGSDFSLTISGVEAADAAVYYCQSYHNINSAYVF
Kryptolebias marmoratus V25 igkv LWHD01000002.1 9462418 LTAEPSVTQSPPVKSVGLGETVSLTCTASTGVDDDLSWYLQKPGQPPKLLFSQISSRESAPSHFSSSGSEPEFTLTIGGVQSDDAGDYYCMGVYEGPV
Kryptolebias marmoratus V24 igkv LWHD01000002.1 9462418 LTAEPSVTQSPPVKSVGLGETVSLTCTASTGVDDDLSWYLQKPGQPPKLLFSQISSRESAPSHFSSSGSEPEFTLTIGGVQSDDAGDYYCMGVYEGPV
Kryptolebias marmoratus V23 igkv LWHD01002394.1 6951 TQQPAAVSSAVGGSATIKCKTSQNVHVWSSYHLLAWYQQRDGESPKLLIYFASTQASGTPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHVINSQYV
Kryptolebias marmoratus V22 igkv LWHD01002394.1 2974 SSADIVVTQTPGAQSVASGQTVSMKCKTSTRVSSFMAWYLQKPGTAPKLLIYYSTTRQSGVSDRFIGSGSGSDYSLTISGVQAEDSGVYYCQQGYS
Kryptolebias marmoratus V21 trav LWHD01001764.1 13062 VSGQTLTQSESVIIKPGENHKLTCTGSGYTFSDRSMHWVRQAEGKGLEWLAYVRYDSSEIYYSQSVQGRFTISRDNGRQQLYLQMNSLRTEDSAVYYCARD
Kryptolebias marmoratus V20 ighv LWHD01001764.1 12064 VWSEIRMDQSSSVVKRPGETVKMSCVSSGFKMTDYYIHWIRQRPGRALEWIGRMNAGQNSASYASSFQSGFVLTEDVPSSTQYLEIRSLTAEDSAVYFCARQ
Kryptolebias marmoratus V19 ighv LWHD01001764.1 6967 VDGQTLTESESVVKKPGESHTLTCTASGFTISGWWMNWVRQAPGKGLEWIAAHYDSSNIHYSQSVRGRFTISRDDNKQQVYLQMNSLTTEDSAVYYCARE
Kryptolebias marmoratus V18 ighv LWHD01001764.1 103 VDGQTLTESESVVKRPGESHRLTCTASGFSFSDYWMNWVRQAPGKGPEWVASIIYHSGKTTYYSQSVQGRFTISRDNSKQQLFLQMNSLKTEDSAVYYCARE
Kryptolebias marmoratus V17 ighv LWHD01001761.1 9702 VKCEQLTQPASETVQPGQRLTISCQVSYALSSYYTAWIRQPAGKGLEWIGMKYTGASYYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDSAVYYCARE
Kryptolebias marmoratus V16 ighv LWHD01001761.1 8048 QTLTESESVIKRPGESHRLTCTGSGFTFSSYPMNWVRQAPGKGLEWIAYINSVSNYIYYSQSLKDRFTISRENSRNQVYLQMNSLTTEDSAVYYCARE
Kryptolebias marmoratus V15 ighv LWHD01001761.1 4640 QTLTESESVVKRPGESHRLTCTGSGFTFSSYSMNWVRQAAGKGLEWIAYISGGSSYIYYSESVKNRFTISRENSRDQVYLQMNSLTTEDSAVYYCAREPQ
Kryptolebias marmoratus V14 igkv LWHD01000208.1 721959 ITLTQTAGAQSAVPGQTVSIRCKSDRLIGDDINWYLQEDGKAPKLLIYDTTARQSGVPERFRANAQQTDFTLTISGVQTEDSGVYYCQQHNSLP
Kryptolebias marmoratus V13 igkv LWHD01000208.1 720387 QVSVTQQPAAVSSAVGGSATIRCKTSQDVYGNNLLAWYQQRDGETPKLLIYYASTRASGTPARFTGSGSNSDFTLTISGVQAEDAAVYYCQSFHVINSQYV
Kryptolebias marmoratus V12 ighv LWHD01000109.1 1567846 VDGQTLTESESVVKRPGESHTLTCTASGFTFSSSWMAWIRQAPGKGLEWIATIKYDSAYIYYSQSVQGRFTILRDNNRQQVYLQMNSLKTEDSAVYYCARE
Kryptolebias marmoratus V11 ighv LWHD01000109.1 1564050 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYWMAWIRQAPGKGLEWIAYISSGSGSSTYYPQSVQGRFTISRDNNKQQLYLQMNSLKTEDSAVYYCARE
Kryptolebias marmoratus V10 trdv LWHD01000109.1 1556967 VWSETKLDQSPSEVKKPGETVKMPCIVSGFNTATDYVHWIRQKTGRDLEWIGRQLMSHTEIFRFFTRRFTLSYDTSSSTVYLGITSLTEDDSALYFCAHT
Kryptolebias marmoratus V9 trav LWHD01000002.1 10625100 PSDGNVVTQSPLLWRNQGQPATINCSHTFGTSYWQMYWFQQLPGKPMKLIVFTTPTPPHKYEEGFTEDKFPAEKKDAPTGSLTVKELQPEDSVVYFCAVS
Kryptolebias marmoratus V8 trav LWHD01000002.1 10622578 CVDGSDVTQTPMLWKYKGHNATMECSHTKDSTYRQMYWYQQLPGKTMKQIVFTTSFSSHQYEEGFTEDKFPAEKKDAPTGSLTVKELQPEDSGVYFCAVS
Kryptolebias marmoratus V7 trbv LWHD01000002.1 10604141 VCESVLITQWPRYISTRSNDSVEMHCYQNDTNYQYLYWYKQLKGRYIQQIVYLVVKSSNFEKDFQTGFKAEQLNDKQWSLTISSIQEKDEAVYLCAAS
Kryptolebias marmoratus V6 trbv LWHD01000002.1 10604141 VCESVLITQWPRYISTRSNDSVEMHCYQNDTNYQYLYWYKQLKGRYIQQIVYLVVKSSNFEKDFQTGFKAEQLNDKQWSLTISSIQEKDEAVYLCAAS
Kryptolebias marmoratus V75 trav LWHD01002690.1 3999 VFISVSTEGQTLTESESVVKRPGESHRLTCTYYGFSDDPYIAWIRQAAGKGLEFVATIQVTDTYFSQSVQGRFTISRENSRKQVYLQMNGLKTEDSAVYYCASE
Kryptolebias marmoratus V74 ighv LWHD01002690.1 5405 VFCIDLIQPESKVVQPGQSLSIICRVSGYSVTDNSYATGWIRQREGKPLEWIFHMWGGGGFYQNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVRR
Kryptolebias marmoratus V73 ighv LWHD01002543.1 42 VDGQTLTESESVVKRPGESHTLTCTASGFTFSDYDMNWVRQAPGKGPEWVASIIYHSGKTTYYSQSVQGRFTISRDNSKQQLFLQMNSLKTEDSAVYYCARE
Kryptolebias marmoratus V72 trbv LWHD01002543.1 2116 VWSEIRLEQPPSEVKRPGETVRISCVTSGYTMTSYSINWIRQKPGKALEWMGWINTDTTVATYGSSFQSRFSFTQDVPSSTQHLEIKSLTTEDSAVYFCARE
Kryptolebias marmoratus V71 trav LWHD01002543.1 3710 GVDGQTLTESESVIKRPGESHTLTCTGSGFTFGDSKATAWIRQAPGKGLELIDYQYILTPDYPEYFSYPVYFSDLEDDSSSEVFLQMNNLTTEDSAVYFCAQETQ
Kryptolebias marmoratus V70 trdv LWHD01002543.1 5182 GAESWSITESEPAVKKPGESHKLTCTTSGFSFSSSVWVWIRQPPGKRLEWIALVHTSSTPIYYSDSVRGRFSISRDDSSSKVYLQMNSLKTEDSAVYFCARR
Kryptolebias marmoratus V69 ighv LWHD01002543.1 7430 VDGQTLTESESVVKRPGESHRLTCTASGFTFSDYEMAWVRQANGKGLEWVAHLTKPTGSSKYYSQSVQGRFTISRDNDKQQVYLQMNSLKTEDSAVYYCARR
Kryptolebias marmoratus V68 igkv LWHD01000893.1 4890 LVAMAAELVQDEGTLTRTAGDTVSFSCGGTDQCGSYVFWYQKTEIETFRLILYVYGSGCSTQKGYNHPQEKDFSAEKTQKGCELKIDQVKVDHSASYYCGCDI
Kryptolebias marmoratus V67 igkv LWHD01000298.1 427502 SSADIVVTQTPGAQSVASGQTVSIRCKTSTSVGTNLHWYLQKPGEALKFIIYRATARQSGVPYRFIGSGSGTDFTLTISRVQAEDSGVYYCQQGYSRP
Kryptolebias marmoratus V66 igkv LWHD01000136.1 970393 QEFNLTSASSVHQDSRFISAHVGDKVNLHCFYEGDDSAWICWYKQTLGQRPKLIASVFVYSTRTIFYDEFKNNPRFSLARENQRSQLTISDLKVSDSATYYCVLNY
Kryptolebias marmoratus V65 igkv LWHD01000136.1 970393 QEFNLTSASSVHQDSRFISAHVGDKVNLHCFYEGDDSAWICWYKQTLGQRPKLIASVFVYSTRTIFYDEFKNNPRFSLARENQRSQLTISDLKVSDSATYYCVLNY
Kryptolebias marmoratus V64 igkv LWHD01000136.1 976049 QEFNLTSASSVHQDSRFISAHVGDKVNLHCFYEGDDSAWICWYKQTLGQRPKLIASVFVYSTRTIFYDEFKNNPRFSLARENQRSQLTISDLKVSDSATYYCVLNY
Kryptolebias marmoratus V63 igkv LWHD01000104.1 5831 QVSVTQQPAAVSSAVGGSATIRCTTNENVINSDSVEWYQQKPSESPKLIIYYAVNRKSYTPDRFTGSGSKTDFTLIIDRVEDEDAAVYYCI
Kryptolebias marmoratus V62 igkv LWHD01000104.1 5831 QVSVTQQPAAVSSAVGGSATIRCTTNENVINSDSVEWYQQKPSESPKLIIYYAVNRKSYTPDRFTGSGSKTDFTLIIDRVEDEDAAVYYCI
Kryptolebias marmoratus V61 igkv LWHD01000104.1 5831 QVSVTQQPAAVSSAVGGSATIRCTTNENVINSDSVEWYQQKPSESPKLIIYYAVNRKSYTPDRFTGSGSKTDFTLIIDRVEDEDAAVYYCI
Kryptolebias marmoratus V60 ighv LWHD01000062.1 2577674 VCSQTLTESEPAVKRPGESHKLTCTYAEISDSDAFISWIRQAEGKGLEWVAQISAPSGSNKYYSTSVQNRFTISRDNDRDQVYLHMSSLKTEDSAVYYCARR
Kryptolebias marmoratus V59 trav LWHD01000062.1 2579126 VSGQTLTQSESVIIKPGENHKLTCTGSGYTFSSNSMGWVRQAEGKGLEWITYVRYDSVEIYYSQSVRGRFTISRDNGRQQLYLQMNSLRTEDSAVYYCA
Kryptolebias marmoratus V58 trbv LWHD01000062.1 2580935 FSESLDQSPSEVKRPEETVKMSCVISGYSMTSYNIHWIRQKPGRALEWIGWMNTGQNSASYASSFQSRFFMTENVPSSTQYLEIRSLTAEDSAVYFCARQ
Kryptolebias marmoratus V57 trav LWHD01000062.1 2584466 VDSQTLTESEPAVRSPGNSHRLTCTASGFSISRSWMAWIRQAPGKALEWIATIEYDSDRIFYSQSVQGRFTISRDNSKQQVYLQMNSLTTDDSAVYYCARE
Kryptolebias marmoratus V56 ighv LWHD01000062.1 2585636 VFSEIRLDQSLSEVKRPEETVKMSCVISGYSMTSYNIHWIRQKPGRALEWIGWMSTGSNSASYASSFQSRFFMTENVPSSTQYLEIRSLTAEDSAVYFCARR
Kryptolebias marmoratus V55 ighv LWHD01000062.1 2587540 VFCIDLIQPESKLVQPGQSLSIICRVSGYSVTAAYGTGWIRQSEGKSFEYIFHMWGTNGDLHKNNALKNKFSFSRDTSAGTVTITGQNLQPEDTAFYYCVRY
Kryptolebias marmoratus V54 trav LWHD01000062.1 2589488 ARGQSLTSSEPVVHRAGESASLSCKVQGLSLAWLHWIRQKPGKGLEWIGRIDRGTGTIFAQSLQGQFSITKDTSQNVVYLSVKSLKQDDSAVYYCARE
Kryptolebias marmoratus V53 ighv LWHD01000062.1 2590780 VKCEQLTQPASETVQPGQRLTISCQVSYALSSYYTAWIRQPAGKGLEWIGYTCSGCTGARKDSLKNKFSLSLDSSSKTVTLTGQNLQPEDSAVYYCARQRG
Kryptolebias marmoratus V52 ighv LWHD01000062.1 2592232 VSGQTLTESESVVKRPAESHKLTCTTSGILFSSSWMAWIRQAPGKGLEWIATETKGDTNNYYSQSVQGRFVVSRDNSREQLFLQMNSLKTEDSAVYYCARE
Kryptolebias marmoratus V51 ighv LWHD01000062.1 2594123 VHGQTLTESESVVKRPGESHTLTCTGSGFTFSSYWMGWVRQAPGKGLEWIAAHYDSSNIHYSQSVRGRFTISRDNSKQQVYLQMNSLKTEDSAVYYCARE
Kryptolebias marmoratus V50 trdv LWHD01000062.1 2595211 GAESWSITESEPAVKKPGESHKLTCTTSGFSFSSSVWVWIRQPPGKRLEWIALVHTSSTPIYYSDSVRGRFSISRDDSSSKVYLQMNSLKTEDSAVYFCARR
Kryptolebias marmoratus V49 ighv LWHD01000062.1 2596582 VWSEIRMDQSSSVVKRPGETVKMSCVSSGFKMTDYYIHWIRQRPGRALEWIGRMNAGRNSASYASSFQSGFVLTEDVPSSTQYLEIRSLTAEDSAVYFCARQ
Kryptolebias marmoratus V48 trbv LWHD01000062.1 2598346 IDGQTLTESESVVKRPEESHRLTCTASGFTLSSYAMAWIRQAPGKGLEWIAYISTSSYPIYYSQSVQGRFTISRDDSNSKIYLQMNSLKTDDTAVYFCARR
Kryptolebias marmoratus V47 ighv LWHD01000062.1 2599994 VDCQTLTESESVVKRPGESHRLTCTGSGFTFSDYWMHWVRQAPGKGLEWISIIRYDSAEIYYSQSVQGRFTISRDNNKQQVYLQMNSLTTEDSAVYYCARE
Kryptolebias marmoratus V46 ighv LWHD01000062.1 2602789 CSGQSLESIPSSPVVKRPGETLSLSCRGSGFTFTYAMSWIKQPEGKALQWMGLAWGDSSTIYSSSFQGRIEITRDNSNNMVYLKLSNLRPEDSAVYYCA
Kryptolebias marmoratus V45 trav LWHD01000062.1 2604922 VKCEQLTQPASETVQPGQRLTISCQVSYSLGYYTAWIRQPAGKGLEWIGMKYTGGSYYKDSLKNKFSIDLDTSSKTVTLNGQNMQPEDSAVYFCAR
Kryptolebias marmoratus V44 ighv LWHD01000062.1 2605761 VDGQTLTESEPVVKSIGESHKLSCTVSAFTFRDYSMHWVRQAPGKGLEWFAYINTNSRDIHYSPSVQCRFTISRDNNRQQLFLQMNSLTTEDSAVYYCAR
Kryptolebias marmoratus V43 ighv LWHD01000062.1 2607318 VFCVDLIQPESKVVQPGQSLSIICRVSGYSLTSSSYATGWIRQREGKPLEWIFDQWGSSSGSFYQNDALKNKFSYSRDMSAGTVTITGQNLQPEDTAVYYCVRR
Kryptolebias marmoratus V42 ighv LWHD01000062.1 2608385 TEGQTLTESESVVKRPRESHILTCTYPGFGGHYDNAWIRQAAGKGLEWIAYISRGSSSIHYSESVKNRFTISRENSRNQVYLQMNSLTTEDSAVYYCARE
Kryptolebias marmoratus V76 trav LWHD01002690.1 3999 VFISVSTEGQTLTESESVVKRPGESHRLTCTYYGFSDDPYIAWIRQAAGKGLEFVATIQVTDTYFSQSVQGRFTISRENSRKQVYLQMNGLKTEDSAVYYCASE
Kryptolebias marmoratus V41 ighv LWHD01000062.1 2610681 VKCEQLTQPASMTVQPGGGLTIRCQVSYSLSSSRTHWIRQPAGKGLEWICSAHIGHGTYYKDSLKNKFSIGLETSSKTVTLTGQNMQPGDSAVYYCARE
Kryptolebias marmoratus V5 trgv LWHD01000002.1 10593122 FSLGLEVRQSHSDLIKHPGEKVEIFCSHDKTDYTMMFWYQQPPGDTALKLTGYLNYRTVKMEDQYEDHFNLTGDLGGDAAKNGSLQIKSIKHEHSAVYYCAASY
Kryptolebias marmoratus V2 trbv LWHD01000002.1 10579835 ASDTKQVDQTPPFIIKKTGQSVDSEIKCSHKIPSFDFILWYKQDEHKALHLLGYLNLQFVNLENNVKGKINFTGDGRKDSSLTVYDLKLSDSAVYFCAAKM