WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Labrus bergylta FKLU00000000.1 (FKLU01) 1180 411 0 207 505 49 2 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Labrus bergylta V825 trav FKLU01003588.1 17130 SSEELVTPFREVMMAVDGENVTLSCNYSGTANNLYWYQQKSGSSPQHLIGEYSEKTEKLSTRHDKQSNEFHLEISSAALNDSAVYYCALR
Labrus bergylta V1168 trav FKLU01011181.1 6598 SSEELVTPFREVMMAVDGENATLSCKYSGSAKYLYWYQQKSGSSPQLLIGEYSEKIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALE
Labrus bergylta V1 igkv FKLU01000327.1 405357 SRGQVTVTQPAAVTSTLGASVSISCTTSQNVYVYDSNHFLAWYQQKDGGTPKRLIYAASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V0 igkv FKLU01000101.1 1005465 SRGQVTVTQPAAVTSALGASISISCRTSQNVYDNKRLHWFQQKDGGTPKLLIHYASNRASGIPDRFSGSGSHSDFTLTISGVQTEDAAVYYCQS
Labrus bergylta V39 ighv FKLU01001361.1 1429 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQPAGKGLEWIGIRYTGGTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V38 ighv FKLU01001334.1 29656 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGWRYTGGTHYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V37 ighv FKLU01001334.1 27651 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISHRWGGGDFYQNNALKNKFSYRTDTSARAVTLTGQNMQPEDTAVYYCVRR
Labrus bergylta V36 ighv FKLU01001334.1 26686 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSFAMSWVRQAPGKGLEWIAHINSGGQYYSNSVRSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V35 ighv FKLU01001334.1 25575 VKCEQLTQPASVTVQPGQSLTITCQVSYSVNSYATAWIRQPAGKGLEGIILGGGGYSTYTKDSLKNQFSINLDSSSNRVTLNGLNMQPADSAVYYCAREPQ
Labrus bergylta V34 ighv FKLU01001334.1 21883 VHCIDLITPGSMVVQPGQTLTLTCQVSGYSLTDSSHATGWIRQREGKPMDWISHQRGGSSGSFYQNNALKNKFSYRTDMSARTMTLTGQSLQPEDTAVYYCVRD
Labrus bergylta V33 ighv FKLU01001334.1 20920 VDGQTLTESEAVVKSPGESHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIATISNGGSIYYSNSVKSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V32 ighv FKLU01001334.1 9842 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGYWTAWIRQPAGKGLEWIGIGSGSSRYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V31 ighv FKLU01001334.1 7292 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIATISNGGSSQYYSNSVRSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V30 ighv FKLU01001334.1 6185 VKCEQLTQPASVTVQPGQSLTITCQVSYSVGSYYTAWIRQPAGKGLEWIIRGAVGYSTHTKDSLKNQFSIDLDSSRKTATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V29 trav FKLU01001322.1 9349 SSKELVTPFREIMMAVDGENVTLSCNYSGSANNLYWYQQKSGSSPQLLIGEYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALK
Labrus bergylta V28 trav FKLU01001322.1 5424 NVLQPEGDVTATEGEAVTLGCQYNSSSSNDDLYWYKQDGNNSPKFILSHFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V27 igkv FKLU01001294.1 10223 SRGQVTVTQPAAVTSTLGASVSISCRTSQNVNNNNRLQWYQQKDGGTPKLLIYTASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V26 igkv FKLU01001294.1 5282 SRGQVTVTQPAAVTSALGASVSISCRTSQNVYNNNFLHWYQQKDGGTPKLLIYAASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSEHNINSQPV
Labrus bergylta V25 ighv FKLU01001181.1 46311 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIILGAVGYSTYTKDSLKNQFSINFDSSSNTATLNGLNMQPADTAVYYCARE
Labrus bergylta V24 ighv FKLU01001181.1 43319 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIAEISSSGSSQYYSNSVKSRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARD
Labrus bergylta V23 ighv FKLU01001181.1 41746 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWICHRLGGGNLYQNNALKNKFSSSRDTSVRKVTLTWQNMQPEDTAVYYCVRE
Labrus bergylta V22 ighv FKLU01001181.1 40775 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYHMNWVRQAPGEGLEWIAFISSGSGSIYYSNSVKSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V21 ighv FKLU01001181.1 36285 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISYQWGGSSGSFYQNNALKNKFSYSRDTSAGTVTLTGQSLQPEDTAVYYCVRD
Labrus bergylta V20 ighv FKLU01001181.1 31777 VKCQQLTQPASVTVQPGQSLTITCQVSYSVGSYWTAWIRQPTGKGLEWIGHKYGSTAYYKDSLKNQFSIDLDASRNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V19 ighv FKLU01001181.1 30569 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIANIRHDSASSNSVRSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V18 trav FKLU01000951.1 83907 IQPTEDVFASEGDTVTLDCKFETTDIAPSLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLMIQKLQLTDSAVYYCALR
Labrus bergylta V17 trav FKLU01000951.1 82497 VQPTEDVFTSEGDTVTLDCKFETSTTLYFFWYRQEMGEIPKYLWRGNAGFSENAPGISGDRFKATINGTSIPLKIQKLQLTDSAVYYCALK
Labrus bergylta V16 ighv FKLU01000951.1 80649 KIYPEVDEVRGTEGESVTLRCNYETTEQIVYLYWYRHHSDLQAPQFILLKGARSRSDSKYKYIPDERYESQTSSSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V15 trav FKLU01000951.1 62357 EDRVIQPTEDVFASEGDTVTLGCTFETTDPYPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V14 trav FKLU01000951.1 56785 SSEELVTPFREVMMAVDGENATLSCNYSGSANYLCWYQQKSGSSPQLLIGEYSEKIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V13 trav FKLU01000951.1 54743 IQPTEDVFASQGDTVTLDCKFETTDTTPSLFWYRQEMGDFPKYLWKSYVGISENAPGISGDRFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V12 trav FKLU01000951.1 49072 SSEELVTPFREVMMAVDGDDVTLSCNYSGSANYLYWYQQKSGSSPQHLIGEYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V11 trav FKLU01000951.1 47231 SSEELVTPFREVMMAVDGDDVTLSCNYSGSVNNLYWYQQKSGSSPQLLIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V10 trav FKLU01000951.1 44879 DRVIQPTEDVFASEGDTVTLGCTFETTDPYPNLFWYRQKMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V9 trav FKLU01000951.1 39421 DRVIQPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYC
Labrus bergylta V8 trav FKLU01000951.1 34972 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSLSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V7 trav FKLU01000951.1 34227 IQPTQDVFASEGDTVTLDCQFETSTTPSLFWYRKEMGDFPKYLWKSYGSFSENAPGISEDRFNVTINGTSVPLKIQKLQLSDSAVYYCALR
Labrus bergylta V6 trav FKLU01000951.1 30225 DRVIQPTEDVFASEGDTVTLGCTFETTDPYPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNATINGISVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V5 trav FKLU01000951.1 21353 SSEELVTPFREVMMAVDGENVTLSCNYSGSVNNLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V4 trav FKLU01000951.1 11852 IQPTEDVFASEGDTVTIDCQFETSTTPYLFWYRQEMGDFPKYMWKSYAGSSENAPGFSEDRFNVTINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V2 trav FKLU01000951.1 9003 SSEELVTPFREVMMAVDGENVTLSCNYSGSANNLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V78 ighv FKLU01001684.1 3829 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYSTAWIRQPAGKGLEWIGMRSTGYTYYKDSLKNQFSIDLDSSRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V77 ighv FKLU01001684.1 1814 VHCIDLITPGSMVVQPGQTLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISYQWGGSSGSFYQNNALKNKFSYSRDTSAGTVTLTGQSLQPEDTAVYYCVE
Labrus bergylta V76 igkv FKLU01001665.1 29207 SRGQVTVTQPAAVSSALGASVSISCRPVRMFMSIAVTTLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V75 igkv FKLU01001665.1 26621 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYYSSYHLLAWYQQKDGGTPKLLIYCASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V73 ighv FKLU01001643.1 23911 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLRQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V72 ighv FKLU01001643.1 15736 VDGQTLTESEAVVKSPGGSHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIAIISSSGGSSQYYSNSVRSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V71 trav FKLU01001643.1 14638 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMRYTGAAYYKDSLKNQFSIDLDSSRKTATLNGLNMQPADSAVYYCARD
Labrus bergylta V70 ighv FKLU01001643.1 8682 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSRQPAGKGLEWIGMRVGSTTHYKDSLRNQFSIDLDASGNTTTLNGQNMQPADTAVYYCARDQE
Labrus bergylta V69 ighv FKLU01001643.1 4231 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMRSTGYTFYKDSLKTQFSIDLDSSRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V68 igkv FKLU01001503.1 32581 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVYSSYHYLAWYQQKDGGTPKLLIYYASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V67 igkv FKLU01001503.1 30972 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVGTNLNWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSSP
Labrus bergylta V66 trav FKLU01001449.1 33673 CMAQKDNVLQPEGDVTATEGEAVTLGCQYNSSSSNYYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V65 trav FKLU01001449.1 32931 SSEELVTPFREVMMAVDGDDVTLSCNYSGSVNNLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V64 trav FKLU01001449.1 22970 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V63 trav FKLU01001449.1 17467 NVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNKSLKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCAVR
Labrus bergylta V62 trav FKLU01001449.1 11611 IQPTEDVFASEGDTVTLDCKFETSTTPYLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLSDSAVYYCAVK
Labrus bergylta V61 trav FKLU01001449.1 9570 EDRVIQPTQDVFASEGDTVTIDCQFETSTTPSLFWYRQKMGEIPRYLWRGNAGFSENAPGISGDRFKATINGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V60 trav FKLU01001449.1 1317 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALSPQ
Labrus bergylta V59 ighv FKLU01001417.1 39811 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIAEISSGSGSIYSNSVKSRFTISRDNSRQQVYLQMNSLKTEDTAVYYCARE
Labrus bergylta V58 ighv FKLU01001417.1 37425 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGYWTAWIRQPAGKGLEWIGSGAGSTRFYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V57 ighv FKLU01001417.1 33308 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYHTAWIRQPAGKGLEWIGLRYTGDTYYKDSLKNQFSIDLDASRNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V56 ighv FKLU01001417.1 29683 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYATAWIRQPAGKGLEWIIVGRVGYNTDTKDSLKNQFSINFDSSSNTVTLNGLNMQPADTAVYYCARE
Labrus bergylta V55 ighv FKLU01001417.1 25111 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQPAGKGLEWIGIRYTGGTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V54 ighv FKLU01001417.1 21911 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIATITNGGSSQYYSNSVKGRFTISRDDSRQQLYLQMNSLKTADTAVYYCARD
Labrus bergylta V53 ighv FKLU01001417.1 20518 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYMTAWIRQPAGKGLEWIGMRSTGSTYYKDSLKNQFSIDLDASRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V52 ighv FKLU01001417.1 17533 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAFISSGSGSIYYSNSVRSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V51 ighv FKLU01001417.1 8612 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGSGYQSYRYYKDSLKNQFSIDLDSSRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V50 ighv FKLU01001417.1 7389 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPTDWICHRWGGGYFYQNNALKNKFSYRTDTSARTVTLTGQSLQPEDTAVYYCVRK
Labrus bergylta V49 ighv FKLU01001361.1 40986 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYSTAWIRQPAGKGLEWIGMRSTGYTYYKDSLKNQFSIDLDSSRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V48 ighv FKLU01001361.1 38962 VHCIDLITPGSMVVQPGQTLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISYQWGGSSGSFYQNNALKNKFSYSRDTSAGTVTLTGQSLQPEDTAVYYCARV
Labrus bergylta V47 ighv FKLU01001361.1 37687 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYFTAWIRQPAGKGLEWIGSGAGSTRYYQDSLKNQFSIDLDSSSNRVTLNGLNMQTADTAVYYCARDPQ
Labrus bergylta V46 ighv FKLU01001361.1 32746 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYYMAWFRQAAGKGLEWIVTISNDGSSYIYCSTSVKGRFTVSRDNSRQQLYLQMNSLQAEDSAVYYCARE
Labrus bergylta V45 ighv FKLU01001361.1 25469 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGSEAGSTRFYKDSLKNQFSINFDSSRKIATLNGLNMQPADTAVYYCVREPQ
Labrus bergylta V44 ighv FKLU01001361.1 16141 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIAEISSGSGSIYYSNSVKSRFTISRDNSRQQVYLQMNSLKTEDTAVYYCARE
Labrus bergylta V43 ighv FKLU01001361.1 13753 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGYWTAWIRQPAGKGLEWIGSGAGSTRFYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V42 ighv FKLU01001361.1 9632 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGLRYTGDTYYKDSLKNQFSIDLDASRNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V41 ighv FKLU01001361.1 7422 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISHQWGTSGLSQNNALKNKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V117 ighv FKLU01002151.1 10092 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWFRHAAGKGLEWIATISNDGSSYIYYSTSVKGRFTVSRDNSRQQLYLQMNSLQAEDSAVYYCARE
Labrus bergylta V116 ighv FKLU01002151.1 9253 VKCQQLTQPASVTVQPGQRLTITCQVSYSVSGYYTAWIRQPAGKGLEWIGVRSTGYTHYKDSLKNQFSIDLDSSRKTATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V115 ighv FKLU01002151.1 8032 VDGQTLTESEAMVKRPGESHRLTCSASGFTFSSYEMRWVRQAPGKGLEWLSFISTASTPIYYSLSVRGRFIISRDDSNSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V114 trav FKLU01002126.1 24804 IQPTEDVFASQGDTVTLDCKFETTDTTPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALQ
Labrus bergylta V113 trav FKLU01002126.1 15341 SSEELVTPFREVMMAVDGENATLSCNYSGSANYLCWYQQKSGSSPQLLIGEYSEKIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V112 trav FKLU01002126.1 11477 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYLWKSYENFRNAPGISETDLKLQKWTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V111 ighv FKLU01002021.1 12349 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSNYHMNWVRQAAGKGLEWIAWVERDNDRKFYSQSVKGRFTISRDNSRQQMYLQMNSLKTEDSAVYYCAR
Labrus bergylta V110 trbv FKLU01002021.1 10859 QSLTSSEPVVSRAGEPATLYCNVNGLALSWLHWIRQKTGKGLEWIGRIDSGTGTIFAQNLQGQFSITKDTSNNVVYLEVKSLKQEDSAVYFCARE
Labrus bergylta V109 igkv FKLU01002003.1 24610 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVGAYLHWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSYP
Labrus bergylta V108 trav FKLU01001938.1 25201 SSEELVTPFREVMMAVDGENATLSCNYSGSANYLCWYQQKSGSSPQLLIGEYSEKIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V107 trav FKLU01001938.1 7243 IQPTQDVFASEGDTVTIDCQFETSTTPYLFWYKKEMGDFPKYMWKSYAGSSENAPGISEDRFNVTINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V105 ighv FKLU01001911.1 19271 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWVATIDVTSIYYSQSVKGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Labrus bergylta V104 ighv FKLU01001911.1 14610 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWFRQAAGKGLEWIATISNDGSSYIYYCTSVKGRFTVSRDNSRQQVYLQMNSLQAEDSAVYYCARE
Labrus bergylta V103 ighv FKLU01001911.1 12473 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIAYISTSSSYISYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V102 ighv FKLU01001911.1 9384 QTLTESEAVVKRPGESHRLTCSASGFTFSSFAMSWVRQAPGKGLEWLAHINSGGQYYSNSVRSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V101 ighv FKLU01001911.1 7992 QTLTESEAVVKRPGESHRLTCSASGFTFSSYDMNWVRQAPRNGLEWIAWVENDNDKKYYSQSVKSRFTISRDNSRQQVYLQMNSLKTEDTAVYYCARD
Labrus bergylta V100 ighv FKLU01001911.1 6739 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V99 ighv FKLU01001911.1 2897 VHCIDLITPGSMVVQPGQTLTLTCQVSGYSLTDNSYATGWIRQRKGKPMDWICHRWGGGSFYQNNALKNKFSYSRDTSARTVTLTGQNMQPEDTAVYYCVRE
Labrus bergylta V98 ighv FKLU01001898.1 10968 VKAQTLTESEAVVKRPGESHRLTCSASGFTLSSYHMSWVRQAPGKGLEWIAWVENDNDEKYYSQSAKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Labrus bergylta V97 ighv FKLU01001875.1 14809 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYRMSWVRQAPGKGLEWIAYISTSSTPISYSSSVRGRFTISRDDSNSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V96 ighv FKLU01001875.1 11279 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAYISTSSSYIYYSSSVRGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARR
Labrus bergylta V95 igkv FKLU01001828.1 9934 SRGQVTVTQPAAVTSALGASVSISCTTSQNVHVYSSYHRLAWYQQKDGGTPKLLIYSASTRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHSINSQYV
Labrus bergylta V94 ighv FKLU01001758.1 21435 TEGQTLTESDAVVKRPGESHTLTCTYSGFSSHPHNAWIRQAAGKGLEWIAYISSGGSIYYSNSVKGRFTISRDNSRQQVFLQMNSLMMEDSAVYYCAREP
Labrus bergylta V93 ighv FKLU01001758.1 20548 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMRYTGGTHYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARKPQ
Labrus bergylta V92 ighv FKLU01001758.1 17864 QTLTESEAVVKRPGESHRLTCSASGFTFSSYDMNWVRQAAGKGLEWIAYISSGSGSIYYSNSVKSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V91 ighv FKLU01001758.1 12182 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYHMNWVRQAAGKGLEWIAWVENDNDRKFYSQSVTGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V90 ighv FKLU01001758.1 10607 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWICHRLGGGNLYQNNALKNKFSSSRDTSVRKVTLTWQNMQPEDTAVYYCVRE
Labrus bergylta V89 ighv FKLU01001758.1 9645 VKCQQLTQPASVTVQPGQSLTITCQVSYSVSSYFTAWIRQPAGKGLEWIGSGAGSTRYYQDSLKNQFSIDLDSSSNRVTLNGLNMQTADTAVYYCARDPQ
Labrus bergylta V88 ighv FKLU01001758.1 4697 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYYMAWFRQAAGKGLEWIVTISNDGSSYIYCSTSVKGRFTVSRDNSRQQLYLQMNSLQAEDSAVYYCARE
Labrus bergylta V87 trav FKLU01001758.1 3625 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYWTAWIRQPAGKGLEWIIVGAVGYSTHTKDSLKNQFSIDLDSSRNTATLNGLNMQPADSAVYYCARD
Labrus bergylta V86 ighv FKLU01001758.1 1352 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGYWTAWIRQPAGKGLEWILSGCSGCTTSYKNSLKNKFSFYSSSNTVTLNGQNMQTADTAVYYCARD
Labrus bergylta V85 ighv FKLU01001684.1 25566 TEGQTLTESDAVVKRPGESHTLTCTYSGFSSHPHNAWIRQAAGKGLEWVAYISSGGSIYYSNSVKGRFTISRDNSRQQVFLQMNSLMMEDSAVYYCARE
Labrus bergylta V84 ighv FKLU01001684.1 24679 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGYWTAWIRQPAGKGLEWIGIRYTGDTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V83 ighv FKLU01001684.1 23456 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYEMSWVRQAPGKGLEWIAYISTSSTPISYSSSVRGRFTISRDDSNSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V82 ighv FKLU01001684.1 22062 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYHTAWIRQPAGKGLEWIGMRSTGYTYYKDSLKNQFSIDLDSSSNRATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V81 ighv FKLU01001684.1 19888 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAYISTSSSYIYYSSSVRGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARR
Labrus bergylta V80 ighv FKLU01001684.1 10357 TEGQTLTESDAVVKRPGESHTLTCTYSGFSSHPHNAWIRQAAGKGLEWVAYISSGGSIYYSNSVKGRFTISRDNSRQQVFLQMNSLTMEDSAVYYCAREP
Labrus bergylta V156 ighv FKLU01002686.1 12653 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGYWTAWIRQPAGKGLEWIGIRYTGDTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V155 ighv FKLU01002686.1 6660 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEFIATIEYDSDRIYYSNSVKSRFTISRDNSRQQVYLQMNSLKTEDTAVYYCARD
Labrus bergylta V154 igkv FKLU01002684.1 6465 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVGAYLHWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSYP
Labrus bergylta V153 igkv FKLU01002651.1 16146 SRGQVTVTQPAAVSSALGASVSISCRTSQMFIIAPTTLAWYQQKDGGTPKLLILHASYRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFMSSTVSGC
Labrus bergylta V152 ighv FKLU01002542.1 20544 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQPAGKGLEWIGIRYTGGTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V151 ighv FKLU01002542.1 17351 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIATITNGGSSQYYSNSVKGRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V150 ighv FKLU01002542.1 16247 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMRFTGAAYYKDSLKNQFSIDLDASRNRATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V148 ighv FKLU01002542.1 12946 VKCEQLTQPASVTVQPGQSLTITCQVSYSVGSYWTAWIRQPAGKGLEWIGYKHGSTAYYKDSLKNQFSIDLDSSRNTATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V147 ighv FKLU01002542.1 9345 TEGQTLTESDAVVKRPGESHTLTCTYSGFSSHPHNAWIRQAAGKGLEWVAYISSGGSIYYSNSVKGRFTISRDNSRQQVFLQMNSLTMEDSAVYYCARE
Labrus bergylta V146 ighv FKLU01002542.1 8457 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGYWTAWIRQPAGKGLEWIGMRYTGAAFYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V145 ighv FKLU01002542.1 7235 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWICNRWGGGDFYQNNALKNKFSYRTDTSARTVTLTGQNMQPEDTAVYYCARD
Labrus bergylta V144 ighv FKLU01002542.1 5967 VKCQQLTQPATVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMVAAGSTTRFKDSLKNQFSIDLDSSRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V143 ighv FKLU01002542.1 3946 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDSSYATGWIRQREGKPMDWISYQWGGSSGSFYQNNALKNKFSYSRDTSAGTVTLTGQSLQPEDTAVYYCARV
Labrus bergylta V142 ighv FKLU01002542.1 2672 VKCEQLTQPASVTVQPGQRLTITCQVSYSVGSYWTAWIRQPAGKGLEWIGSGAGSYRYYKDSLKNQFSIDLDSSRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V141 ighv FKLU01002542.1 219 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIAEISSSGGSSQYYSNSVKSRFTISRDNSRQQVYLQMNSLKTEDTAVYYCARD
Labrus bergylta V140 igkv FKLU01002526.1 4832 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVYSSNHYLAWYQQKDGGTPKLLIYFASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V139 igkv FKLU01002526.1 2242 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVYSSTTLAWYQQKDGGTPKLLIYYASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V138 igkv FKLU01002526.1 636 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVGTNLNWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSSP
Labrus bergylta V137 trav FKLU01002443.1 20062 IQPTEDVFASEGDTVTLDCQFETSTTHYLFWYRQELGDFPKYMWKGYGGFSENAPGISIERYKAAINETSVPLTIQKLQLTDSAVYYCALR
Labrus bergylta V136 trav FKLU01002443.1 18650 IQPTEDVFTSEGDTVTLDCKFETSTTPSLFWYRQEMGEIPRYLWRGNAGFSENAPGISGDRFKAKRNGTSIPMKIQKLQLTDSAVYYCALR
Labrus bergylta V135 trav FKLU01002443.1 3521 IQPTEDVFASEGDTVTLDCTFETTDTAPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLADSAVYYCALR
Labrus bergylta V134 ighv FKLU01002395.1 23688 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYIAWIRQPAGKGLEWIGMRSTGYTFYKDSLKTQFSIDLDSSRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V133 ighv FKLU01002395.1 8076 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSSYPMNWVRQAPGKGLEWIAWVERDNDNKFYSQSVTGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V132 ighv FKLU01002395.1 6839 VKCQQLTQPASVTVQPGQSLTITCQVSYSVSSYHTAWIRQPAGKGLEWIGMRYTGAAYYKDSLKNQFSIDLDSSRNRATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V131 ighv FKLU01002395.1 3563 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGWRYLDTHYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V130 ighv FKLU01002395.1 2373 VDGQTLTESEAVVKRPGESHRLTCSTSGFTFSSSWMAWVRQAPGKGLEWIANIRHDSASSNSVRCRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V129 igkv FKLU01002306.1 14244 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVSNRLAWYQQKDGGTPKLLIYLASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHVINSQNV
Labrus bergylta V128 trav FKLU01002291.1 23107 SSEELVTPFREVMMAVDGENVTLSCNYLGSANNLYWYQQKSGSSPQLLIGGYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V127 ighv FKLU01002258.1 22595 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIAEISSVAEYYSQSVKSRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V126 ighv FKLU01002258.1 20058 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYHMNWVRQAPGEGLEWIAFISSGSGSIYYSNSVKSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V125 ighv FKLU01002258.1 17608 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRAGGKGLEWIGMVSAGSTTRYKDSLKNQFSIDLDSSRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V124 ighv FKLU01002258.1 15575 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISYQWGGSSGSFYQNNALKNKFSYSRDTSAGTVTLTGQSLQPEDTAVYYCVRD
Labrus bergylta V123 ighv FKLU01002258.1 11055 VKCEQLTQPASVTVQPGQSLTITCQVSYSVGSYYTAWIRQPTGKGLEWIGHKYGSTAYYKDSLKNQFSIDLDSSRNRATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V122 ighv FKLU01002258.1 9832 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWICHRWGGGYFYQNNALKNKFSYRTDTSARTVTLTGQNMQPEDTAVYYCVRE
Labrus bergylta V121 ighv FKLU01002258.1 8605 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAIISSGGSIYYSNSVKSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V120 ighv FKLU01002151.1 19282 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIIRGGVGYSTYTKDSLKNQFSINFDSSSNTVTLNGLNMQPADTAVYYCARE
Labrus bergylta V119 ighv FKLU01002151.1 18068 VDGQTLTQSEAVVKSPGESHRLTCSASGFTFSSYDMNWVRQAPGKGLEWISFIHTSSSYIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V195 trav FKLU01002845.1 15855 DRVIQPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V194 trav FKLU01002845.1 10187 NVLQPEGDVTATEGEAVTLGCQYNSSSSNYDLYWYKQDGNNSPEFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V193 trav FKLU01002845.1 9427 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLCWYQQKSALSPQLLIGGYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V192 trav FKLU01002845.1 7231 RVIQPTEDVIAYEGDTVTLGCTFETITQNPSMFWYRQEIVDFPKYMFRCYLKQVYKAPEFQTDRFKPAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V191 trav FKLU01002845.1 3939 RVIQPTEDVFASEADTVTLGCTFETTNPYPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNATINGISVPMKIQKLQLTDSAVYYCALR
Labrus bergylta V190 trav FKLU01002835.1 20270 IQPTEDVFASQGDTVTLDCKFETTDTTPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAARNGTSVPLKIQKLQLTDSAVYYCALQ
Labrus bergylta V189 trav FKLU01002835.1 15791 IQPTEDVFASEGDTVTLDCQFETSTTLYLFWYRQELGDFPNYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLSDSAVYYCALR
Labrus bergylta V188 trav FKLU01002835.1 14379 IQPTEDVFTSEGDTVTLDCKFETSTTLYFFWYRQEMGEVPRYLWRGNAGFSENAPGISGDRFKGTINGTSIPLKIQKLQLTDSAVYYCALR
Labrus bergylta V187 trav FKLU01002835.1 5514 CMAQTDNVLQPEGDMTATEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALRPTVTG
Labrus bergylta V186 trav FKLU01002835.1 4766 IQPTEDVFASEGDTVTLDCKVETTDTTLYLFWYRQEMGDFPKYLWKSYVGISENAPGISGERFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V185 igkv FKLU01002815.1 7371 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVSTYLNWYLQKPGEAPKLLIYSSTNRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSYP
Labrus bergylta V184 igkv FKLU01002764.1 15288 SRGQVTVTQPAAVSSALGASVSISCTTSQNVYYGSSYHYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHSISSQDV
Labrus bergylta V183 igkv FKLU01002764.1 5806 SRGQVTVTQPAAVTSALGASVSISCTTSQDVYGSNRLAWYQQKDGGTPKLLIYYASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHVISSQYV
Labrus bergylta V182 igkv FKLU01002764.1 885 SRGQVTVTQPAAVSSALGASVSISCRTSQNVHGSNHLAWYQQKDGGTPKLLIYLASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHSINSQWV
Labrus bergylta V181 ighv FKLU01002740.1 11399 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGWRYTGGTHYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V180 ighv FKLU01002740.1 9420 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWICHRWGGGDFYQNNALKNKFSYRTDTSARAVTLTGQNMQPEDTAVYYCVRR
Labrus bergylta V179 ighv FKLU01002740.1 8458 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSFAMSWVRQAPGKGLEWIAHINSGGQYYSNSVRSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARQ
Labrus bergylta V178 ighv FKLU01002740.1 7340 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGSEAGSTRFYKDSLKNQFSINFDSSRKIATLNGQNMQPADTAVYYCARE
Labrus bergylta V177 ighv FKLU01002740.1 1303 VDGQTLTESEAVVKSPGGSHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAIISSSGGSSQYYSNSVRSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V176 trav FKLU01002715.1 15345 CMAQTDNVLQPEGDVTAPEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMEEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V175 trav FKLU01002715.1 6347 DRVIQPTEDVFASEGDTVTLGCTFETTDPNPNLFWYRQKMGDFPKYMLRCYSKDVYIAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V173 ighv FKLU01002710.1 14204 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSSYDMNWVRQAPGKGLEWIAYISTSSTPISYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V172 trbv FKLU01002710.1 12711 QSLTSSEPVVSRAGEPATLHCNVNGLALSWLHWIRQKTGKGLEWIGRIDSGTGTIFAQNLQGQFSITKDTSNNVVYLEVKSLKQEDSAVYFCARE
Labrus bergylta V171 ighv FKLU01002710.1 8428 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYATAWIRQPAGKGLEWILSGCSGCTTSYKNSLKNQFSFDSSSNTVTLNRQNMQPADTAVYYCARD
Labrus bergylta V170 ighv FKLU01002710.1 5457 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSSYHMSWVKQAAGKGLEWISWVENDNDRKFYSQSVKSRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V169 ighv FKLU01002710.1 3438 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMNWVRQAPGKGLEWIAEISSSGGSQSYSNSVKSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V168 ighv FKLU01002710.1 2200 TEGQTLTESDAVVKRPGESHTLTCTYSGFSSHPHNAWIRQAAGKGLEWVAYISSGGSIYYSNSVKGRFTISRDNSRQQVFLQMNSLTMEDSAVYYCARE
Labrus bergylta V167 ighv FKLU01002710.1 92 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSSFAMSWVRQAPGKGLEWIAYISTSSTPISYSSSVRGRFTISRDDSNSKLYLQLNSLQTADTAVYYCARD
Labrus bergylta V166 ighv FKLU01002707.1 2825 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSHISAPSGSNKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARA
Labrus bergylta V165 trav FKLU01002702.1 4402 IQPTEDVFASEGDTVTLDCKVETTDTTLYLFWYRQEMGDFPKYLWKSYVGISENAPGISRERFNATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V164 trav FKLU01002702.1 1920 IQPTEDVFASEGDTVTLDCKFETTDTTPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V163 trbv FKLU01002696.1 15108 QSLTSSEPVVSRAGEPATLYCNVSGLALSWLHWIRQKTGKGLEWIGRIDSGTGTIFAQNLQGQFSITKDTSNIVVYLEVKSLKQEDSAVYFCARE
Labrus bergylta V162 ighv FKLU01002696.1 11187 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYYMAWFRQAAGKGLEWIATISNDGSSYIYCSTSVKGRFTVSRDNSRQQLYLQMNSLQAEDSAVYYCA
Labrus bergylta V161 ighv FKLU01002696.1 8847 VDGQTLTESEAVVKRPGESHRLTCSASGLTFSSYYMAWVRQAPGKGLEWIAYISTSSSYIYYSSSVRGRFIISRDDSNSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V160 ighv FKLU01002696.1 7387 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYHMNWVRQAPGKGLEWIAWVENDNDRKYYSQSVTGRFNASRDNSRQQVYLQMNSLKTEDTAVYYCARD
Labrus bergylta V159 trbv FKLU01002696.1 5630 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMSWVRQAPGKGLEWIAWVENDNDEKYYSQSVTGRFTISRDSPVSAVYFCARDPQ
Labrus bergylta V158 trav FKLU01002686.1 14779 VDGQTLTESEAVVKSPGESHRLTCSASGFTFSSFDMNWVRQAAGKGLEWIAWVERDNDRKFYSQSVTGRFTISRDNSRQQVYLQMNSLKTEDSAVHYCAREPQ
Labrus bergylta V234 ighv FKLU01003951.1 9334 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWICNRWGGGDFYQNNALKNKFSYRTDTSARTVTLTGQNMQPEDTAVYYCVRR
Labrus bergylta V233 ighv FKLU01003951.1 6852 QTLTESEAVVKRPGESHRPTCSASGFTFSSYDMAWVRQAAGKGLEWIAFIYTSSSYIYYSSSVQGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V232 ighv FKLU01003951.1 5459 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAEISSSGGSQSYSNSVKSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V231 ighv FKLU01003951.1 3421 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQPAGKGLEWIGIRYTGGTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V230 igkv FKLU01003933.1 12718 SRGQVTVTQPAALTSALGASVSISCRTSQDVYYGSSYHYLAWYQQKDGGTPKLLIYFASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V229 igkv FKLU01003933.1 9810 SRGQVTVTQPAAVTSALGASVSISCRTSQDVYGNNYLAWYQQKDGGTPKLLIYFASTRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V228 ighv FKLU01003890.1 12739 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSYISAPSGSNKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCAR
Labrus bergylta V227 ighv FKLU01003890.1 3976 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMNWVRQAPGKGLEWIATITNGGSIYYSNSVKSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V226 igkv FKLU01003752.1 17761 SRGQVTVTQPAAVSSALGASVSISCRTSQNVHGSNHLAWYQQKDGGTPKLLIYLASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHSINSQWV
Labrus bergylta V225 igkv FKLU01003752.1 15192 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYYSSPYHLLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V224 igkv FKLU01003752.1 13583 SSGDILLTQTPGSQSVVLGQTVSIKCQTSTSVGADLHWYLQKPGEAPKLLIYYSTNRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGNSYP
Labrus bergylta V223 trav FKLU01003688.1 13121 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V222 trav FKLU01003688.1 11582 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALSPQ
Labrus bergylta V221 igkv FKLU01003657.1 12829 SRGQVTVTQPAAVTSALGASVSISCRTSQNVYSSNSLAWYQQKDGGTPKLLIYVASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHSISSQYV
Labrus bergylta V220 igkv FKLU01003657.1 9142 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVSTYLHWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGYSSP
Labrus bergylta V219 trav FKLU01003621.1 1543 CMAQKDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V218 igkv FKLU01003498.1 7740 SRGQVTVTQPAAVSSALGASVSISCRPVRMFVANYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSS
Labrus bergylta V217 igkv FKLU01003398.1 5644 SRGQVTVTQPAAVSSALGASVSISCRPVRMFMVVPLAWYQQKDGGTPKLLITASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V216 ighv FKLU01003378.1 9112 KIYPAVNEVRGTEGESVTLRCNYEATYQNVDLYWYRHHSDLQAPQFILWKGARSSSGSQYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V214 ighv FKLU01003335.1 11690 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSSYEMSWVRQAAGKGLEWIAYITNGGGSSQYYSNSVKSRFTISRDDSRQQLYLQMNSLQTEDTAVYYCARE
Labrus bergylta V213 igkv FKLU01003234.1 3125 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVSTYLNWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQCYSYP
Labrus bergylta V212 ighv FKLU01003223.1 9005 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYYMAWFRQAAGKGLAWIATISYDGSSYIYYCTSVKGRFTISRDNSRQQLYLQMNSLQAEDSAVYYCA
Labrus bergylta V211 ighv FKLU01003223.1 6677 QTLTESEAVVKRPGESHRLTCSASGFTFRGYRMSWVRQAPGKGLEWIAFISTGSSHISYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V210 ighv FKLU01003223.1 3091 QTLTESEAVLKRPGESHRLTCSASGFTLSSYWMSWVRQAPGKGLEWVAYIGTSSSPISYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V209 ighv FKLU01003223.1 758 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIAFIYTSSSHIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V208 trav FKLU01003132.1 15890 SSEELVTPFREVMMAVDGENATLSCNYSGSANYLCWYQQKSGSSPQLLIGEYSEKIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V207 trav FKLU01003132.1 3104 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALR
Labrus bergylta V206 ighv FKLU01003060.1 13034 VKAQTLTESEAVLKRPGESHRLTCSASGFTFSNYHMNWVRQAAGKGLEWIAWVERDNDRKFYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V205 trbv FKLU01003060.1 11544 QSLTSSEPVVSRAGEPATLYCNVNGLALSWLHWIRQKTGKGLEWIGRIDSGTGTIFAQNLQGQFSITKDTSNNVVYLEVKSLKQEDSAVYFCARE
Labrus bergylta V204 igkv FKLU01003021.1 14179 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVGADLHWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSYP
Labrus bergylta V203 igkv FKLU01002964.1 2984 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYSSNRLHWYQQKDGGTPKLLIYYASTRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V202 igkv FKLU01002936.1 9961 QVTVTQPAAVSSALGASVSISCRTSQNVYGSNRLAWYQQKDGGTPKLLIYVASTRVSGIPDRFLGSGSNSAFTLTISGVQTEDAAVYYCQSYHEISRQAV
Labrus bergylta V201 trav FKLU01002908.1 17110 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V200 trav FKLU01002908.1 12686 RVIQPTEDVIAYEGDTVTLDCTFETITQNPSMFWYRQETVDFPKYMFRCYLKQVYKAPEFQTDRFKPAINGTSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V199 trav FKLU01002908.1 8626 IQPTEDVFASEGDTVTLDCKVETTDTTLYLFWYRQEMGDFPKYLWKSYVGISENAPGISGERFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V198 igkv FKLU01002864.1 21126 SRGQVTVTQPAAVSSALGASVSISCRTSQMFIISNTLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYQQSADV
Labrus bergylta V197 igkv FKLU01002864.1 7086 SRGQVTVTQPAAVTSALGASVSISCRTSQNVHGSNYLHWYQQKDGGTPKLLIYYASSRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHSISSQWV
Labrus bergylta V273 ighv FKLU01004489.1 1626 TEGQTLTESDAVVKRPGESHTLTCTYSGFSSHPHNAWIRQAAGKGLEWVAYISSGGSIYYSNSVKGRFTISRDNSRQQVFLQMNSLTMEDSAVYYCARE
Labrus bergylta V272 ighv FKLU01004489.1 739 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGYWTAWIRQPAGKGLEWIGIRYTGDTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V271 ighv FKLU01004423.1 5459 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDARISWIRQAEGKGLEWVSYISAPSGSTKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARA
Labrus bergylta V270 trav FKLU01004414.1 8964 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALR
Labrus bergylta V269 igkv FKLU01004343.1 7504 SRGQVTVTQPAAVSSALGASVSISCTTSQNVYYSTYHYLAWYQQKDGGTPKLLIYSASYRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHVINSQWV
Labrus bergylta V268 igkv FKLU01004340.1 3682 SRGQVTVTQPAAVTSALGASVSISCRTSQNVYNNNCLAWYQQKDGGTPKLLIYYASSRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHVINSQWV
Labrus bergylta V267 igkv FKLU01004321.1 6449 SRGQVTVTQPAALTSALGASVSISCRTSQNVFYSSPYHFLAWYQQKDGGTPKLLIYVASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V266 igkv FKLU01004310.1 2352 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYNNDYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHEISSQYV
Labrus bergylta V265 trav FKLU01004281.1 5170 IQPTQDVFASEGDTVTIDCQFETSMTPSLFWYRQEMGDFPKYMWKSYAGSSENALGISEDRFNVTINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V264 trav FKLU01004239.1 11085 SSEELVTPFREVMMAVDGDDVTLSCNYSGSANYLYWYQQKSGSSPQHLIGEYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V263 trav FKLU01004239.1 7979 DRVIQPTEDVFASEGDTVTLGCTFETTDPYPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V262 trav FKLU01004239.1 2321 DRVIQPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYC
Labrus bergylta V261 ighv FKLU01004231.1 11683 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGYYTAWIRQPAGKGLEWIGADIILQILQRFTEEPVQYRLRLFQQQSDSNGLNMQPADTAVYYCARDPQ
Labrus bergylta V260 ighv FKLU01004231.1 10490 VDAQTLTESEAVVKRPGESHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIANIRHDSASSNSVRCRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V259 trbv FKLU01004227.1 10423 QSLTSSEPVVSRAGEPATLYCNVNGLALSWLHWIRQKTGKGLEWIGRIDSGTGTIFAQNLQGQFSITKDTSNNVVYLEVKSLKQEDSAVYFCARE
Labrus bergylta V258 igkv FKLU01004209.1 6693 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVGAYLHWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSYP
Labrus bergylta V257 ighv FKLU01004197.1 16073 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAYISTSSSYISYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V256 ighv FKLU01004197.1 4461 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLRQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V255 ighv FKLU01004197.1 809 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGMRYTGGTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V253 ighv FKLU01004169.1 14151 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQPAGKGLEWIGIRYTGGTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V252 ighv FKLU01004169.1 11012 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIARISNGGGSSQYYSNSVKGRFTISRDNSRQQLYLQMNSLKTADTAVYYCARD
Labrus bergylta V251 ighv FKLU01004169.1 4282 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGQRVGCTIYYKDSLKNQFSIDIDASRNTATLNGQNMQPADTAVYYCARD
Labrus bergylta V250 trav FKLU01004143.1 9461 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSLSNEYLYWYKQDGNNSPKFILTRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V249 trav FKLU01004143.1 7460 IQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWKSYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V248 trav FKLU01004143.1 5427 DRVIQPTEDVFASEGDTVTLGCTFETITQNPSMFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V247 igkv FKLU01004119.1 7392 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVSTNLHWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGYSFP
Labrus bergylta V246 igkv FKLU01004076.1 9465 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYYSSSYQYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V245 igkv FKLU01004076.1 6854 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVYSSSHCLAWYQQKDGGTPKLLIYYASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHVISSQDV
Labrus bergylta V244 igkv FKLU01004076.1 5248 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVGTNLNWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSSR
Labrus bergylta V243 ighv FKLU01004020.1 14816 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIIEVLWDIAHIQRFTEEPVQYRLRLFQKTATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V242 ighv FKLU01004020.1 9768 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSSYEMSWVRQAAGKGLEWIAYITNGGGSSQYYSNSVKSRFTISRDDSRQQLYLQMNSLQTEDTAVYYCARE
Labrus bergylta V241 ighv FKLU01004020.1 7898 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIAYISSGSGSIYYSNSVKSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V240 trav FKLU01003990.1 11597 NVLQPEEDVTATEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQ
Labrus bergylta V239 trav FKLU01003990.1 3666 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSLSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V238 trav FKLU01003990.1 1949 IQPTQDVFASEGDTVTIDCQFETSTTPSLFWYRQEMGEIPRYLWRGNAGFSENAPGISGDRFKATINRTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V237 igkv FKLU01003980.1 10754 SRGQVTVTQPAAVTSALGASVSISCTTSQDVYVYSSNHLLAWYQQKDGGTPKLLIYYASTRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHVINSQWV
Labrus bergylta V236 ighv FKLU01003951.1 13216 VKAQTLTESEAVVKSPGESHRLTCSASGFTFSSHHMSWVRQAAGKGLEWIAWIQNNNDNKYYSQSVTGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Labrus bergylta V312 ighv FKLU01005524.1 4690 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIANIRHDSASSNSVRCRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V311 trav FKLU01005517.1 14417 IQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWKSYAGFRKCSWISDRFKCTINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V310 igkv FKLU01005500.1 9514 QVTVTQPAAVSSAVGASVSISCRTSQDVYGSNLLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHEISSQYV
Labrus bergylta V309 trav FKLU01005431.1 12887 IQPTEDVFASAGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYQWKSYGSFSENAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALK
Labrus bergylta V308 igkv FKLU01005425.1 3045 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYYSSPYHLLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V307 trav FKLU01005365.1 13249 IQPTEDVFTSEGDTVTLDCKFETSTTLYLFWYRQEMGEIPKYLWRGNAGFSENAPGISGDRFKATRNGTSIPMKIQKLQLTDSAVYYCALR
Labrus bergylta V306 trav FKLU01005365.1 11143 IQPTEDVFASEGDTVTIDCQFETSMTPSLFWYRQEMGDFPKYMWKSYAGSSENALGISEDRFNVTINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V305 igkv FKLU01005363.1 2321 SSGDILLTQTPGSQSVVLGQTVSIRCKPAQVCTSNWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQCTAP
Labrus bergylta V304 igkv FKLU01005256.1 7037 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYYSSYHFLAWYQQKDGGTPKLLIYVASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHTSTVSV
Labrus bergylta V303 trav FKLU01005248.1 8857 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYLWKSYGSFSENAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V302 trav FKLU01005182.1 3866 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYVYSSSYHRLAWYQQKDGGTPKLLIYSASTPASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYFCKGEFDASKYDL
Labrus bergylta V301 igkv FKLU01005182.1 1780 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVGAYLHWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSSP
Labrus bergylta V300 trav FKLU01005164.1 13885 IQPTEDVFASEGDTVTLDCQFETSTAPYLFWYRQEMGDFPKYMWKGYGGVSENAPGISIERYKAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V299 trav FKLU01005164.1 10034 SSEELVTPFREVMMAVDGDDATLSCNYSGSANYLYWYQQKSGSSPQLLIGGYSEKIEKLSTRHDKQSNEFHLESSSAALTDSAVYYCALK
Labrus bergylta V298 trav FKLU01005164.1 4543 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSLSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V297 trav FKLU01005164.1 2823 IQPTQDVFASEGDTVTIDCQFETSTTPSLFWYRQEMGEIPRYLWRGNAGFSENAPGISGDRFKATINRTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V296 trav FKLU01005098.1 5374 DRVIQPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V295 ighv FKLU01005084.1 10181 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSSWMAWVRQVPGKGLEWIVTIEYDSDRIYYSNSVKSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V294 ighv FKLU01005084.1 6093 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYHMSWVRQAPGEGLEWIAFISSGSGSIYYSNSVRSRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V293 ighv FKLU01005084.1 4647 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMRSTGYTFYKDSLKTQFSIDLDSSRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V292 igkv FKLU01005033.1 4843 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVSNRLAWYQQKDGGTPKLLIYLASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHVINSQNV
Labrus bergylta V291 trbv FKLU01004970.1 1996 QSLTSSEPVVSRAGEPATLYCNVNGLALSWLHWIRQKTGKGLEWIGRIDSGTGTIFAQNLQGQFSITKDTSNNVVYLEVKSLKQEDSAVYFCARE
Labrus bergylta V290 trav FKLU01004947.1 14126 IQPTENVFASEGDTVTLDCKVETTDPTLYLFWYRQEMGDFPKYLWKSYVGISENAPGISEERFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V289 trav FKLU01004908.1 12934 IQPTEDVFASQGDTVTLDCKFETTDTTPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGSQMTDLKLQKWTSVPLKIQKLQLTDSVVYYCAVKPTVTG
Labrus bergylta V288 trav FKLU01004908.1 11695 IQPTQDVFASEGDTVTIDCQFETSTTPSLFWYRQKMGEIPRYLWRGNAGFSENAPGISGDRFKATINGTSVPLKIQKFQLSDSAVYYCAHRQET
Labrus bergylta V287 trav FKLU01004908.1 2609 DRVIQPTEDVFASEGDTVTLDCKFETIDTTPSLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCAVK
Labrus bergylta V286 trav FKLU01004901.1 12191 NVLQPERDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSLKFILSRFKFGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQ
Labrus bergylta V285 trav FKLU01004868.1 6704 DRVIQPTEDVFASEGDTVTLGCTFETTDQIQMFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V284 igkv FKLU01004808.1 13736 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVGTYLNWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSYP
Labrus bergylta V283 igkv FKLU01004807.1 14494 SRGQVTVTQPAAVSSALGASVSISCRTSQMFIVPLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYI
Labrus bergylta V282 igkv FKLU01004807.1 4345 SRGQVTVTQPAALTSALGASVSISCRTSQNVHVYNSNHRLAWYQQKDGGTPKLLIYSASYRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHVISSQAV
Labrus bergylta V281 trav FKLU01004648.1 8236 NMLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V280 trav FKLU01004582.1 10197 IQPTEDVFASEGDTVTLDCKFETTDTAPSLLWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V279 trav FKLU01004582.1 6367 NVLQPEGDVTATEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPEFILSRFKNGEGKTTKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V278 trav FKLU01004582.1 2521 DRVIQPTEDVFASEGDTVTLDCQFETSMTPYLFWYRQEMGDFSKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKFQLSDSAVYYCAVKPTVTG
Labrus bergylta V277 trav FKLU01004553.1 14194 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCAVR
Labrus bergylta V276 trav FKLU01004553.1 6447 EDRVIQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V275 igkv FKLU01004500.1 3230 QVTVTQPAAVRSALGASVTLSCTTSEDVDYSRRTRLAWYQQKDGGTPKLLIYSGSTRESGTSDRFTGSGSNSDFTLTISGVQTEDAAVYYCQSYIYQQSVV
Labrus bergylta V351 igkv FKLU01006402.1 629 QVTVTQPAAVRSALGASVTVSCTTSEDVATTGGKPYLAWYQQTDGGTPKLLIYYGSTRVSGTSSRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Labrus bergylta V350 trav FKLU01006380.1 5548 EDRVIQPTEDVFASEGDTVTLGCTFETTEPYPNLFWYRQKLGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V349 ighv FKLU01006376.1 8142 VDGQTLTESEAVVKSPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAIISSSGGSSQYYSNSVRSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V348 ighv FKLU01006376.1 2130 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V347 trav FKLU01006341.1 3796 EDRVIQPTQDVFASEGDTVTLDCKVETSTTPYFSWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V346 igkv FKLU01006336.1 7915 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYYSSYHYLAWYQQKDGGTPKLLIYVASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHSINSQWV
Labrus bergylta V345 ighv FKLU01006275.1 8948 VKAQTLTESEAVLKRPGESHRLTCSASGFTFSNYHMNWVRQAAGKGLEWIAWVERDNDRKFYSQSVKSRFTISRDNSRQQMYLQMNSLKTEDSAVYYCARD
Labrus bergylta V344 igkv FKLU01006219.1 10072 SSGDILLTQTPGSLSVVLGQTVSIRCQTSTSVSAYLNWYLQKPGEAPKLLIYYSTNRQSGVSTHFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSFP
Labrus bergylta V343 ighv FKLU01006196.1 9990 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYFTAWIRQPAGKGLEWIGMRYTGGTYYKDSLKNQFSIDIDSSRKIATLNGLNMQTADTAVYYCARDPQ
Labrus bergylta V341 ighv FKLU01006072.1 9013 VKAQTLIESEAVVKRPGESHRLTCSASGFTFSSYHMSWVRQAPGKGLEWISWVENDNDRKFYSQSVKSRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V340 ighv FKLU01006072.1 7576 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGIRYTGGTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V339 ighv FKLU01006072.1 6357 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWVAYIGTSSSPISYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V338 ighv FKLU01006072.1 5118 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGSYTAWIRQPAGKGLEWIGMRYTGAAYYKDSLKNQFSIDLDASRNRATLNGLNMQPADTAVYYCVREPQ
Labrus bergylta V337 ighv FKLU01006072.1 195 VDGQTLTESEAVVKSPGESHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIAMISNGGGSSQYYSNSVKSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V336 ighv FKLU01006039.1 9131 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYIAWIRQPAGKGLEWIGMRSTGYTFYKDSLKTQFSIDLDSSRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V335 ighv FKLU01006039.1 7899 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIAYISNGGGSQYYSNSVKSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V334 trav FKLU01006026.1 6380 RVIQPTEDVFASEGDTVTLGCTFKTTDPNPNLFWYRQKMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLSDSAVYYCALR
Labrus bergylta V333 trav FKLU01006026.1 1142 SSEELVTPFREVMMAVDGENATLSCNYSGSANYLCWYQQKSGSSPQLLIGEYSEKIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V332 trav FKLU01005978.1 5015 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLYWHQQKSGSSPQLLIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALR
Labrus bergylta V331 igkv FKLU01005977.1 12381 QRGQVTVTQPAAVSSAVGASISISCRTSQNVYVYNSNHCLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V330 igkv FKLU01005977.1 10262 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVGAYLHWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSYP
Labrus bergylta V329 trav FKLU01005952.1 9758 CMAQTDNVLQPEGDVTAPEGEAVTLGCQYNSSSSNYYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCAVKPTVTG
Labrus bergylta V328 trav FKLU01005904.1 3438 DRVIQPTEDVFASEGDTVTLDCKFETSTTLYLFWYRQEMSDFPKYMWKGYGGFSENAPGISVERYKAAINGTSVPLTIQKLQLTDSAVYYCAVK
Labrus bergylta V327 trav FKLU01005865.1 3899 DRVIQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCAVK
Labrus bergylta V326 igkv FKLU01005763.1 2634 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYSSNHLAWYQQEDGGTPKLLIYYASSRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V325 igkv FKLU01005719.1 1409 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVGADLHWYLQKPGEAPKLLIYYSTNRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSYP
Labrus bergylta V324 trav FKLU01005601.1 11274 SSEELVTPFREVMMAVDGDDVTLSCNYSGSAKYLYWYQQKSGSSPQLLIGGYSEKTEKLSTRHNKQSKEFHLQISSAALTDSAVYYCALQ
Labrus bergylta V323 trav FKLU01005601.1 10167 EDRVIQPTQDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V322 trav FKLU01005601.1 6692 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCAVR
Labrus bergylta V321 trav FKLU01005601.1 4961 EDRVIQPTEDVFASEGDTVTLDCQFETSTAPYLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V320 trav FKLU01005601.1 3613 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPKFILSRFKIGEGKTIKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V319 trav FKLU01005601.1 1878 NVLQPEEDVTATEGEAVTLGCQYNSSSSNYDLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQ
Labrus bergylta V318 igkv FKLU01005595.1 2502 SRGQVTVTQPAAVTSALGASVSISCRTSQDVYSNNYLAWYQQKDGGTPKLLIYFASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHEISSQYV
Labrus bergylta V317 trav FKLU01005578.1 9716 QVTVTQPAAVSSAVGASVSISCRTSQNVDGSDRLAWYQQKDGGTPKLLIYRASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYFCKGEFDASKYDL
Labrus bergylta V316 trav FKLU01005564.1 1282 NVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V315 ighv FKLU01005524.1 10987 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V314 ighv FKLU01005524.1 9172 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIIVGRVGYSTYTKDSLKNQFSINFDSSSNTATLNGLNMQPADTAVYYCARE
Labrus bergylta V390 igkv FKLU01007393.1 327 SRGQVTVTQPAAVTSALGASVSISCTTSQDVYYGSSYHFLAWYQQKDGGTPKLLIYLASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V389 igkv FKLU01007379.1 295 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYGSDRLAWYQQKDGGTPKLLIYYVSTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFMNQSVC
Labrus bergylta V388 igkv FKLU01007370.1 10079 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVSTYLNWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSYP
Labrus bergylta V387 igkv FKLU01007231.1 9802 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSAGTCLNWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQCNSFP
Labrus bergylta V386 ighv FKLU01007228.1 8481 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYSTAWIRQPAGKGLEWIGMRSTGYTYYKDSLKNQFSIDLDSSRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V385 ighv FKLU01007228.1 6465 VHCIDLITPGSMVVQPGQTLTLTCQVSGYSLTDSSYATGWIRQREGKPMDWISYQWGGSSGSFYQNNALKNKFSYSRDTSARTMTLTGQSLQPEDTAVYYCARV
Labrus bergylta V384 ighv FKLU01007228.1 5181 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYFTAWIRQPAGKGLEWIGSGAGSTRYYQDSLKNQFSIDLDSSSNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V383 ighv FKLU01007228.1 4012 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAAVKGLEWIAYIGTSSTPIYYSSSVRGRFTISRDDSNSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V382 ighv FKLU01007194.1 10688 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYYMAWFRQAAGKGLAWIATISYDGSSYIYYCTSVKGRFTISRDNSRQQLYLQMNSLQAEDSAVYYCA
Labrus bergylta V381 ighv FKLU01007194.1 2461 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIAFIYTSSSHIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V380 ighv FKLU01007077.1 10193 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGQRVGSTIYYKDSLKNQFSIDIDASRNTATLNGQNMQPADTAVYYCARD
Labrus bergylta V379 igkv FKLU01007062.1 6586 SRGQVTVTQPAAVTSALGASVSISCRTSQNVYSSSYHCLAWYQQKDGGTPKLLIYFASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V378 igkv FKLU01007062.1 3727 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVYSSYHLLAWYQQKDGGTPKLLIYSASSRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCKSFS
Labrus bergylta V377 igkv FKLU01007062.1 2032 DILLTQTPGSQSVVLGQTVSIRCQTSTSVSTYLNWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQSNSSP
Labrus bergylta V376 ighv FKLU01007035.1 10957 VDGQTLTESEAVVKRPGESHRLTCSASGFTFWSYWMAWVRQAPGKGLEWIARISNGGGSIYYSNSVRSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V375 ighv FKLU01007035.1 9571 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGHKYGSTAYYKDSLKNQFSIDLDSSRNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V374 ighv FKLU01007035.1 8354 QTLTQSEAVVKRPGESHRLTCSASGFTFRSYEMSWVRQAPGKGLEWLSFISTASTPIYYSSSVRGRFTISRDDSNSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V373 igkv FKLU01006993.1 4541 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYYGSSYHFLAWYQQKDGGTPKLLIYLASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V372 igkv FKLU01006993.1 755 DILLTQTPGSQSVVLGQTVSIRCQTSTSVSTYLNWYLQKPGEAPKLLIYYSTNRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQCYSSP
Labrus bergylta V371 ighv FKLU01006953.1 4268 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSYISAPSGSNKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCAR
Labrus bergylta V370 igkv FKLU01006932.1 2443 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYGNDRLAWYQQKDGGTPKLLIYYVSTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHEISSQYV
Labrus bergylta V369 ighv FKLU01006929.1 11216 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIAYISSGSGSIYYSNSVKSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V368 trav FKLU01006881.1 10444 RVIQPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCAVR
Labrus bergylta V367 trav FKLU01006881.1 7633 SSEELVTPFREVMMAVDGENVTLSCNYSGSVTNLYWYQQKSGSSPQLLIGGYSEKKEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V366 trav FKLU01006881.1 6508 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSLSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V365 trav FKLU01006881.1 5766 SSKELVTPFREVMMAVDGDDVTISCNYSGSVTNLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALK
Labrus bergylta V364 trav FKLU01006881.1 4662 DRVIQPTEDVFASEGDTITLGCTFETTNPYPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNATINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V362 igkv FKLU01006671.1 5463 SRGQVTVTQPAAVSSALGASVSISCTTSQDVYYSSPYHLLAWYQQKDGGTPKLLIYYASSRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V361 igkv FKLU01006671.1 1190 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVYLPHWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGTAP
Labrus bergylta V360 igkv FKLU01006624.1 4595 SRGQVTVTQPAAVSSALGASVAISCTTSQDVYVYSSNHFLAWYQQKDGGTPKLLIYLASSRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHSINSQWV
Labrus bergylta V359 trav FKLU01006602.1 11902 SSEELVTPFREVMMAVDGDDVTISCNYSGSAKYLYWYQQKSGSSPQLFIGGYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALR
Labrus bergylta V358 trav FKLU01006602.1 7710 SSEELVTPFREVMMAVDGDDVTLSCNYSGSAKYLYWYQQKSGSSPQLLIGEYSETIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALE
Labrus bergylta V357 trav FKLU01006602.1 3579 IQPTEDVFASEGDTVTLDCKFETTDTTPSLFWYRQEMDDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSVVYYCAVK
Labrus bergylta V356 igkv FKLU01006594.1 5037 SRGQVTVTQPAALTSALGASVSISCRTSQDVYYGSSYHYLAWYQQKDGGTPKLLIYFASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V355 igkv FKLU01006594.1 2104 SRGQVTVTQPAAVSSALGASVAISCRTSQDVYGNSYLHWYQQKDGGTPKLLIYVASSRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V354 igkv FKLU01006558.1 818 SRGQVTVTQPAAVSSALGASVSISCRTSQDVFYSSYHRLAWYQQKMEELLNSSFTMLASRIRIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHSINSQDV
Labrus bergylta V353 igkv FKLU01006521.1 4593 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYVYSSYHRLAWYQQKDGGTPKLLIYYASTRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHSINSQDV
Labrus bergylta V429 igkv FKLU01008650.1 4566 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYYSSYHYLAWYQQKDGGTPKLLIYRASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V428 ighv FKLU01008562.1 7067 QTLTESEAVLKRPGESHRLTCSASGFTLSSYGMSWVRQAPGKGLEWVAYIGTSSSPISYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V427 ighv FKLU01008562.1 4743 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIAFIYTSSSHIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V426 ighv FKLU01008542.1 4582 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDARISWIRQAEGKGLEWVSFISAPSGSTKSYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARD
Labrus bergylta V425 trav FKLU01008469.1 9494 DRVIQPTEDVFASEGDTVTLDCQFETSMTPYLFWYRQEMGDFSKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKFQLSDSAVYYCAVKPTVTG
Labrus bergylta V424 trav FKLU01008469.1 8092 IQPTEDVFTSEGDTVTLDCQFETSTTLYLLWYRQEMGEIPRYLWRGNAGFSENAPGISGDRFKATINRTSIPLKIQKLQLTDSAVYYCALG
Labrus bergylta V423 trav FKLU01008469.1 4215 CMAQKDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V422 igkv FKLU01008461.1 5652 SRGQVTVTQPAAVTSALGASVSISCTTSQDVYVYSSYHRLAWYQQKDGGTPKLLIYYASTRESGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V421 ighv FKLU01008392.1 9324 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYFTAWIRQPAGKGLEWIGMRYTGGTYYKDSLKNQFSIDLDASRNRATLNGQNMQPADTAVYYCARE
Labrus bergylta V420 ighv FKLU01008392.1 8036 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEFIANIRHDSASSNSVRSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCAKD
Labrus bergylta V419 igkv FKLU01008330.1 3174 SRGQVTVTQPAAVSSALGASVSISCRTSQNVHVYNGYHRLAWYQQKDGGTPKLLIYSASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHSINSQWV
Labrus bergylta V418 ighv FKLU01008309.1 8640 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGQRVGSTIYYKDSLKNQFSIDIDASRNTATLNGQNMQPADTAVYYCARD
Labrus bergylta V417 ighv FKLU01008309.1 7421 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYDMNWVRQAAGKGLEWIAYISTSSSPIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V416 trav FKLU01008277.1 8435 RVIQPTEDVFASEGDTVTLDCTFETSDTNPFLFWYRQEAGDFPKYMLRCYSNKAENAPGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALQPTVTGN
Labrus bergylta V415 igkv FKLU01008227.1 6018 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVGTYLNWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSYP
Labrus bergylta V414 trav FKLU01008180.1 2365 IQPTEDVFASEGDTVTLDCKFETTDRAPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALK
Labrus bergylta V413 igkv FKLU01008123.1 1585 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVSTYLHWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYCQQGYSYP
Labrus bergylta V412 trav FKLU01008113.1 5471 IQPTQDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYLWKSYVGISENAPGISGDRFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V411 igkv FKLU01008037.1 3266 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVSTYLNWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQCYSSP
Labrus bergylta V410 ighv FKLU01008031.1 4310 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSHISAPSGSNKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARA
Labrus bergylta V409 ighv FKLU01007960.1 2530 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSYISAPSGSNKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARA
Labrus bergylta V408 ighv FKLU01007946.1 5167 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGHKYGSTAYYKDSLKNQFSIDLDSSRNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V407 igkv FKLU01007915.1 7873 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYIYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V406 trav FKLU01007855.1 5386 DRVIQPTEDVFASEGDTVTLDCQFETSTTPYLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINRTSVPLKIQKLQLTDSAVYYCAE
Labrus bergylta V405 trdv FKLU01007851.1 4691 IQPTEDVFTSEGDTVTLDCKFETSTTLYFFWYRQEMGEVPRYLWRGNAGFSENAPGISGDRFKATINGTSIPLKIQKLQLTDSVVYYCALR
Labrus bergylta V404 igkv FKLU01007820.1 2535 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYNDYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V403 igkv FKLU01007787.1 2718 QVTVTQSAAVRSALGASVTLSCTTSKDVTTTGGKPYLAWYQQKDGGTPKLLIYYGSTRVSGTSSRFTGSGSNSDFTLTISGVQTEDAAVYYCQSYHSGVV
Labrus bergylta V402 trav FKLU01007780.1 5164 IQPTQDVFASEGDTVTIDCQFETSMNPSLFWYRQEMGDFPKYMWKSYAGSSENALGISEFNVTINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V401 igkv FKLU01007710.1 4343 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYNNNHLAWYQQKDGGTPKLLIYAASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V399 ighv FKLU01007700.1 8317 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIIVGRVGYSTYTKDSLKNQFSINFDSSSNTATLNGLNMQPADTAVYYCARE
Labrus bergylta V398 ighv FKLU01007700.1 6303 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDSSYATGWIRQREGKPMDWISHQWGGSSGSFYQNNALKNKFSYSRDTSAGTVTLTGQSLQPEDTAVYYCVRD
Labrus bergylta V397 ighv FKLU01007700.1 5029 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYWTAWIRQPAGKGLEWIIVGQVGYSTHTKDSLKNQFSINFDSSSNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V396 ighv FKLU01007700.1 3808 VDAQTLTESEAVVKRPGESHRLTCSASGFTFSNYEMNWVRQAPGKGLEWISFIHTGSTPIYYSSSVQGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V395 trav FKLU01007609.1 2973 NVLQPEGDVTATEGEAVTLGCQYNSSSSNYYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALSPQ
Labrus bergylta V394 igkv FKLU01007559.1 5918 QVTVTQPAAVSSALGASVSISCRTSQDVYYGSSYHYLAWYQQKDGGTPKLLIYFASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHSINSQRV
Labrus bergylta V393 igkv FKLU01007507.1 11035 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYVYSTYHLLAWYQQKDGGTPKLLIYYASSRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V392 trav FKLU01007497.1 1747 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEVGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V468 trav FKLU01010232.1 7824 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMDDFPKYLWKSYGSFSGNAPGISDDRFNVTINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V467 trav FKLU01010232.1 5006 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V466 trav FKLU01010198.1 5067 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V465 igkv FKLU01010187.1 5024 QVTVTQSAAVRSALGASVTLSCTTSEDVTTTGRKPYLAWYQQKDGGTPKLLIYYGSTRVSGTSSRFTGSGSNSDFTLTISGVQTEDAAVYYCQSYHSGVV
Labrus bergylta V464 trav FKLU01010091.1 1083 IQPTEDVFASEGDTVTLDCKFETTDRAPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALK
Labrus bergylta V463 igkv FKLU01010074.1 6452 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVSNRLAWYQQKDGGTPKLLIYLASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHVINSQNV
Labrus bergylta V462 trgv FKLU01010053.1 3103 LKQDSLSLTRRVGESVSFSCERLDLCDLGYDYVHWFQKKDNETFTGILRIDRSSMNKALYNHPQKDDFSAVIKQNSVELQIQKVNSSHSATYYCSCFLT
Labrus bergylta V461 trav FKLU01009998.1 3191 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEVGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V460 trav FKLU01009989.1 3903 IQPTEDVFASEGDTVTLDCKFETTDTTPSLFWFRQEMDDFPKYLWKSYGSFSGNAPGISGDRFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V459 trav FKLU01009846.1 3174 NVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V458 igkv FKLU01009760.1 1936 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVYSSYHCLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V457 igkv FKLU01009745.1 8346 SRGQVTVTQPAAVSSALGASVSISCTTSQNVYYGSSYHYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHSISSQDV
Labrus bergylta V456 igkv FKLU01009723.1 2122 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYGNDPLAWYQQKDGGTPKLLIYYASTRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFNQQSVC
Labrus bergylta V455 igkv FKLU01009706.1 120 SRGQVTVTQPAAVTSALGASVSISCRPVRMFIMTLAWYQQKDGGTPKLLIIRASTRIRIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHASSHD
Labrus bergylta V454 igkv FKLU01009641.1 2005 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYYSSYHFLAWYQQKDGGTPKLLIYLASSRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V453 igkv FKLU01009624.1 6041 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYGNSYLHWYQQKDGGTPKLLISYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHTAVSV
Labrus bergylta V452 igkv FKLU01009624.1 2247 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVGTYLNWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQVTAP
Labrus bergylta V451 igkv FKLU01009588.1 2207 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVGAYLHWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSSR
Labrus bergylta V450 trav FKLU01009525.1 3546 SSEELVTPFREVMMAVDGENVTLSCNYSGSANNLYWYQQKSGSSPQLLIGGYSEKIEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V449 ighv FKLU01009515.1 7949 VKCQQLTQPASVTVQPGQRLTITCQVSYSVSGGYYTAWIRQPAGKGLEWIGVRSTGYTFYKDSLKNQFSIDLDSSRKTATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V448 ighv FKLU01009515.1 6729 VDAQTLTESEAVVKRPGESHRLTCSASGFTFSSYEMRWVRQAPGKGLEWLSFISTASTPIYYSLSVRGRFIISRDDSNSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V447 igkv FKLU01009469.1 6207 QVTVTQPAAVSSALGASVSISCRPVRCLCNNYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHTSAVRC
Labrus bergylta V446 trav FKLU01009443.1 8039 SSEELVTPFREVMMAVDGENATLSCNYSGSANYLCWYQQKSGSSPQLLIGEYSEKIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V445 trav FKLU01009443.1 4629 IQPTEDVFASEGDTVTLVCKFETTDTAPSLLWYRQEMGDFPKYLWKSYGSFSGNAPGISADRFKAAKNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V444 igkv FKLU01009367.1 2533 SRGQVTVTQPAAVTSALGASVSISCRTSQNVYSSNRLHWYQQKDGGTPKLLIYVAITRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V443 trav FKLU01009296.1 4425 NVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILTRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIKKLQLTDSAVYYCALQPTVTG
Labrus bergylta V442 igkv FKLU01009196.1 909 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYNNNFLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHEISSQAV
Labrus bergylta V441 trbv FKLU01009144.1 1538 QSLTSSEPVVSRAGEPATLYCNVNGLALSWLHWIRQKTGKGLEWIGRIDSGTGTIFAQNLQGQFSITKDTSNNVVYLEVKSLKQEDSAVYFCARE
Labrus bergylta V440 trav FKLU01009079.1 2177 SSEELVTPFREVMMAVDGENVTLSCNYSGSVTNLYWYQQKSGSSPQHSHGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALS
Labrus bergylta V438 trav FKLU01008984.1 2150 IQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V437 trbv FKLU01008898.1 3140 QSLTSSEPVVSRAGEPATLYCNVNGLALSWLHWIRQKTGKGLEWIGRIDSGTGTIFAQNLQGQFSITKDTSNNVVYLEVKSLKQEDSAVYFCARE
Labrus bergylta V436 igkv FKLU01008892.1 7895 SRGQVTVTQPAAVSSALGASVSISCTTSQDVYYGSSYHYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V435 ighv FKLU01008873.1 6853 VDGQTLTKSEEVVKRPGESHRLTCSASGFTFSSYDMNWVRQAPGKGLEWIAWVERDNDRKYYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V434 ighv FKLU01008873.1 5612 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLRQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V433 ighv FKLU01008873.1 4191 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIIVGGVGYSTYTKDSLKNQFSINFDSSSNTATLNGLNMQPADTAVYYCARD
Labrus bergylta V432 ighv FKLU01008873.1 1935 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGMRYTGGTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V431 igkv FKLU01008707.1 4046 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYYSSYHFLAWYQQKDGGTPKLLIYLASSRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V507 igkv FKLU01000626.1 142230 SRGQVTVTQPAAVSFALGASVSISCTTSQNVYNNNHLAWYQQKDGGTPKLLIYAASTRASGIPDHFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V506 trav FKLU01000242.1 224675 QVSAATSDVKQGSGVITATLGQNVTLPCSCENDAVTFFTWYQQHLGDKPVIISTLMKHKKEASISPAYKERFKVAGQGGVNNLVIRDVLLSDSAIYYCGILEY
Labrus bergylta V505 trav FKLU01000010.1 384170 VSAVTLVTQKPPVVNLRRGETATMDCNLGTVTNIAARWYKQIPGGVPQYILSNYHSWSSPEYGSGFSSPKFTSTHQSQSDYRLIISTVEERDSAVYYCQTYDSSVS
Labrus bergylta V504 trav FKLU01000010.1 384170 VSAVTLVTQKPPVVNLRRGETATMDCNLGTVTNIAARWYKQIPGGVPQYILSNYHSWSSPEYGSGFSSPKFTSTHQSQSDYRLIISTVEERDSAVYYCQTYDSSVS
Labrus bergylta V503 trbv FKLU01000010.1 385837 IVLTQTPAVHTVSTGQQVDLQCNIQRADGYYVSWYKQVPGEAPQYVLRFYHSDSSPGFGSGFSSDRFNSKSSSNIDYQFIIKRAETGDSAVYFC
Labrus bergylta V502 trbv FKLU01000010.1 385837 IVLTQTPAVHTVSTGQQVDLQCNIQRADGYYVSWYKQVPGEAPQYVLRFYHSDSSPGFGSGFSSDRFNSKSSSNIDYQFIIKRAETGDSAVYFC
Labrus bergylta V501 trav FKLU01000010.1 387211 VSAVTLVTQKPPVVTLRRGETATMDCNLGTVTNSEACWYKQIPGGVPQFILYNHHSYSSPSYGSGFSSPKFTSTHQSQTDYRLIISTVEERDSAVYYCQTWDSSVS
Labrus bergylta V500 trav FKLU01000010.1 387211 VSAVTLVTQKPPVVTLRRGETATMDCNLGTVTNSEACWYKQIPGGVPQFILYNHHSYSSPSYGSGFSSPKFTSTHQSQTDYRLIISTVEERDSAVYYCQTWDSSVS
Labrus bergylta V499 trav FKLU01000010.1 429908 VSAVTLVTQKPPVVTLRRGETATMDCNLGTVTGQRACWYKQIPGGVPQFILSNYHGWSSPEYGSGFSSPKFTSTHQSQTDYRLIISTVEERDSAVYYC
Labrus bergylta V498 trav FKLU01000010.1 429908 VSAVTLVTQKPPVVTLRRGETATMDCNLGTVTGQRACWYKQIPGGVPQFILSNYHGWSSPEYGSGFSSPKFTSTHQSQTDYRLIISTVEERDSAVYYC
Labrus bergylta V497 ighv FKLU01013247.1 1373 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIIRGGGGYSTYTKDSLKNQFSINLDSSRNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V496 trav FKLU01012578.1 3880 IQPTQDVFASEGDTVTIDCQFETSMTPSLFWYKQEMGDFPKYMWKSYAGSSENALGISEDRFNVTINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V495 igkv FKLU01012382.1 2055 SRGQVTVTQPAAVSSALGASVSISCTTSQDVYYSSYHFLAWYQQKDGGTPKLLIYVASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V494 igkv FKLU01012086.1 2692 SRGQVTVTQPAAVSSALGASVSISCRPVRMFYSSIHLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSINSHV
Labrus bergylta V493 ighv FKLU01012023.1 3824 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGQRVGSTIYYKDSLKNQFSIDIDASRNTATLNGQNMQPADTAVYYCAR
Labrus bergylta V492 ighv FKLU01012023.1 2615 QTLTESEAVVKRPGESHRLTCSASGFTFSSYDMNWVRQAAGKGLEWIAYISTSSSPIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V491 igkv FKLU01011778.1 5166 SRGQVAVTQPAAVSSALGASVSISCRTSQNVYVYSSNHLLAWYQQKDGGTPKLLIYYASTRESGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V490 ighv FKLU01011565.1 4684 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQPAGKGLEWIGIRYTGGTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V489 trav FKLU01011525.1 4811 IQPTEDVFASEGDTVTLDCKFETTDRAPYLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALR
Labrus bergylta V488 igkv FKLU01011459.1 2714 SRGQVTVTQPAAVSSALGASVSISCTTSQDVYYSSPYHLLAWYQQKDGGTPKLLIYYASSRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V487 igkv FKLU01011383.1 5192 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVSTYLNWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQCYSSR
Labrus bergylta V486 igkv FKLU01011361.1 3030 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVSTYLHWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQNNSYP
Labrus bergylta V485 trbv FKLU01011201.1 3492 QSLTSSEPVVSRAGEPATLYCNVNGLALSWLHWIRQKTGKGLEWIGRIDSGTGTIFAQNLQGQFSITKDTSNNVVYLEVKSLKQEDSAVYFCARE
Labrus bergylta V484 trav FKLU01011101.1 1572 CMAQKDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILTRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIKKLQLTDSAVYYCALQPTVTG
Labrus bergylta V483 trav FKLU01011049.1 3739 DRVIQPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V482 igkv FKLU01010952.1 1677 SRGQVTVTQPAAVSSALGASISISCRTSQDVYYSSPYHYLAWYQQKDGGTPKLLIYRASSRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V480 igkv FKLU01010836.1 5292 QVTVTQPAAVRSALGASVTLSCTTSEDVDTTGDDEPLLAWYQQKDGGTPKLLIYDGSTRVSGTSDRFTGSGSNSDFTLTISGVQTEDVAVYYCQSIHDINSEWV
Labrus bergylta V479 trav FKLU01010812.1 2438 IQPTKDVFASEGDTVTIDCQFETSTTPLCSGTRQKMGEIPRYLWRGNAGFSENAPGISGDRFKATINGISSLKIQKFQLSDSAVYYCALKPTVTG
Labrus bergylta V478 trav FKLU01010780.1 6383 IQPTEDVFASEGDTVTLDCKFETTDRAPYLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALR
Labrus bergylta V477 ighv FKLU01010654.1 6384 VKAQTLTESEAVVKRPGGSHRLTCSASGFTFSSYDMNWVRQAPGKGLEWIAYISTASTPIYYSSSVRGRFTISRDDSSSKPYLQMNSLQTADTAVYYCARD
Labrus bergylta V476 ighv FKLU01010654.1 3419 VDGQTLTESEAVVKRPGESHRLTCSASGFTFWLLMAWVRQAPGKGLEWIARISNGGGSIYYSNSVRSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V475 ighv FKLU01010654.1 2040 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGIWIHAYYKDSLKNQFSIDLDSSRNTATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V474 ighv FKLU01010654.1 827 QTLTQSEAVVKRPGESHRLTCSASGFTFRSYEMSWVRQAPGKGLEWLSFISTASTPIYYSSSVRGRFTISRDDSNSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V473 igkv FKLU01010611.1 796 SRGQVTVTQPAAVTSALGASVSISCRTSQDVYNNNYLAWYQQKDGGTPKLLIYYASTRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHNQQSG
Labrus bergylta V472 igkv FKLU01010490.1 744 SRGQVTVTQPAAVSSALGASVSISCRPVRMFMYRLPLLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V471 igkv FKLU01010413.1 5225 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVSNRLAWYQQKDGGTPKLLIYLASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHVINSQYV
Labrus bergylta V470 igkv FKLU01010278.1 3844 SRGQVTVTQPAAVSSALGASVSISCRPVRMFIYDYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V546 ighv FKLU01001320.1 28641 VKCEQLTQPASVTVQPGQSLTITCQVSYSVGSYYTAWIRQPAGKGLEWIIRGAVGYSTDTKDSLKNQFSIDLDSSRNTATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V545 ighv FKLU01001320.1 31665 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYHMSWVRQAPGKGLEWIAWIENDNDRKYYSQSVTGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V544 ighv FKLU01001320.1 33052 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSGYWTAWIRQPAGKGLEWIGMKYTGGTHYKDSLKNQFSIDLDSSRKIATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V543 ighv FKLU01001320.1 43563 VDSQTLTESEAVVKSPGESHRLTCSASGFTFSSYYMAWFRQAAGKGLEWIATIRYDSANIYYSNSVKSRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V542 ighv FKLU01001320.1 45908 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIAFIYTSSSYIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARR
Labrus bergylta V541 ighv FKLU01001320.1 47310 QTLTESEAVVKRPGESHRLTCSASGFTFSSYYMSWVRQAPGKGLEWIAWVENDNDEKYYSQSVTGRFTISRDDSRQQVYLQMNSLKTADTAVYYCARD
Labrus bergylta V540 trav FKLU01001283.1 254 CMAQKDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V539 ighv FKLU01001283.1 8848 KIYPAVDEVRGTEGESVTLRCNYETTSEYVVLYWYRHHSDLQAPQFILLKGARSWSDSKYTYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V537 trav FKLU01001283.1 20119 LGSMNSINPERTEEKVEEGGNINLTCTYDGVINNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V536 trav FKLU01001283.1 22206 EDRVIQPTQDVFASEGDTVTIDCQFETSTTPYLFWYRQEMGEVPRYLWRGNAGFSENAPGISEDRFKATINGTSIPLKIQKLQLTDSAVYYCALEPTVTG
Labrus bergylta V535 ighv FKLU01001175.1 19122 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIIRGGVGYSTYTKDSLKNQFSINFDSSSNTVTLNGLNMQPADTAVYYCARE
Labrus bergylta V534 ighv FKLU01001175.1 20331 VDGQTLTQSEAVVKSPGESHRLTCSASGFTFSSYDMNWVRQAPGKGLEWISFIHTSSSYIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V533 trav FKLU01001175.1 21829 AQGQSLTSSEPVVSRAGEPATLYCNVNGLALSWLHWIRQKTGKGLEWIGRIDRGTGTIFAQNLQGQFSITKDTSNNVVYLEVKSLKQEDSAVYFCAREPQ
Labrus bergylta V532 ighv FKLU01001175.1 25395 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYYMAWFRQAAGKGLEWIVTISNDGSSYIYCSTSVKGRFTVSRDNSRQQLYLQMNSLQAEDSAVYYCARE
Labrus bergylta V531 trav FKLU01001175.1 26469 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYWTAWIRQPAGKGLEWIIVGAVGYSTHTKDSLKNQFSIDLDSSRNTATLNGLNMQPADSAVYYCARDQE
Labrus bergylta V530 ighv FKLU01001175.1 28753 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYATAWIRQPAGKGLEWILSGCSGCTTSYKNSLKNKFSFYSSSNTVTLNGQNMQTADTAVYYCARD
Labrus bergylta V529 ighv FKLU01001175.1 30947 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAIISSGGSIYYSNSVKSRFTISRDNSRQQVYLQMNSLKTEDTAVYYCARD
Labrus bergylta V528 ighv FKLU01001175.1 33296 VKCEQLTQPASVTVQPGQSLTITCQVSYSVGSYWTAWIRQPAGKGLEWIGMSYTGYTYYKDSLKNQFSIDLDASRNTATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V527 ighv FKLU01001175.1 35576 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIAYISSSGGSQYYSNSVKSRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V526 igkv FKLU01001170.1 20610 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYNNNYLAWYQQKDGGTPKLLIYTASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V525 igkv FKLU01001170.1 30769 SRGQVTVTQPAAVTSALGASISISCRTSQDVYYSSPYHYLAWYQQKDGGTPKRLIYAASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V524 igkv FKLU01001170.1 37075 SRGQVTVTQPAAVTSALGASVSISCTTSQNVFNNIYLHWYQQKDGGTPKLLIYTASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHEINSQPV
Labrus bergylta V523 igkv FKLU01001170.1 46225 SRGQVTVTQPAAVTSALGASVSISCRTSQNVFNNNNLAWYQQKDGGTPKLLIYAASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V522 trgv FKLU01001161.1 44793 LKQDSLSLTRRVGESVSFSCERLDLCSSSYDYVHWYQKKDNETFTRILRINKSNGKVNKALYNHPQKDDFSAVIKQNGVELQIQKVNSSHSATYYCSCWL
Labrus bergylta V521 trbv FKLU01001141.1 5395 VSQSVLITQWPQIISRHPNGSAEMHCYQNETDYPYLYWYRQLRGQSFQLMVMVSAGSATFEEDFKSGYQAVRQKKEEKQWSLSIESVQRKDEAVYLCAAS
Labrus bergylta V520 ighv FKLU01001141.1 7985 GLALEVLQSPSDVLTQPGDKVQIFCSHKKTDYRVMLWYQRSPGDTAMKLIGYLNVKAVTMEATYEADFTMTGDLGGNTEKNGSLVFKRVKAEHSAVYYCAARE
Labrus bergylta V519 trbv FKLU01001141.1 27027 SSLSQIVEQKPTHMFSKPGEKPQINCKHEIKDYNRMLWYKQLKNRQMQFLGYMNVKDGYPEDGVHVKIEGSALERQNCTLTIEAVELSSSAVYFCAAS
Labrus bergylta V518 trbv FKLU01001141.1 31707 SSSSDQVHQTPRDIYSKPGEPARIQCSHQIQSYDQILWYKKSNDNRLQLLGYVYYKAVTLEDGVNVKLEGGANKGDNCTLIIERVNQSSSAVYFCAAS
Labrus bergylta V517 trbv FKLU01001141.1 36189 SSSSDQVHQTPRDIYSKPGEPARIQCSHQIQSYDQILWYKKSNDNRLQLLGYVYFKKGTLEDGANVKLEGGANKGENCTLIIERVNQSSSAVYFCAAS
Labrus bergylta V516 trbv FKLU01001141.1 36941 SSSSDQVHQTPRDIYSKPGEPARIQCSHQIQSYNVILWYKKLNKQMQLLGYMFTTTSNPEKDVKVKMEGDASKGKNCTLIIERVNQNSSAVYFCAAS
Labrus bergylta V515 trbv FKLU01001141.1 38715 LSKSHVDQKPAALVIHPGEKVQLTCNHSNSNFDMIQWYKQSKGKHDMALLGYVRYSSATVEDQFKGLYNVSGDGKNQSSLILLKLSGSESAVYFCAASE
Labrus bergylta V514 trbv FKLU01001084.1 22878 TSVAFQPSHPKVVVEKARVEFNCSHNDENLDVMLWYQQTQSGMMDLIGYGYTSSEPDYEEKFKDRFKMTRKDVTTGALIIPSVTPSDSAVYFCAAR
Labrus bergylta V513 trbv FKLU01001084.1 23434 QACAVTFVKFDPQIVQKDIAVEIKCSHNDTSLVIMLWYQQRKGSTSLTLIGYGSESSPTYEGQFEEQFKLTRDGTEKGALIISKAQPSHSAVYFCAAS
Labrus bergylta V512 trbv FKLU01001084.1 25991 VSQSVLITQWPQIISRHPNGSAEMHCYQNETDYSYLYWYRQLRGQSFQLMVMVSAGSATFEEDFKSGYQAVRQKKEEKQWSLSIESVQRKDEAVYLCAAS
Labrus bergylta V511 trbv FKLU01001084.1 33391 LIDGYKVTQTDSLIKVQGDSATMSCRQHEGDQMLIMFWYKQLPGQRLQFLAFTSHVNKLDFGDFSKEKYSATKPDAENGTFTVKNVERGDAGWYFCAVTHSDT
Labrus bergylta V510 trav FKLU01001031.1 50819 VSAVTLVTQKPPVVTLRRGETATMDCNLGTVTSYSASWYKQIPGGVPQFILSNYHSIAIYGSGFSSPKFTSTHQSQSDYRLIISTVEERDSAVYYC
Labrus bergylta V509 trav FKLU01001031.1 50819 VSAVTLVTQKPPVVTLRRGETATMDCNLGTVTSYSASWYKQIPGGVPQFILSNYHSIAIYGSGFSSPKFTSTHQSQSDYRLIISTVEERDSAVYYC
Labrus bergylta V585 trav FKLU01001470.1 12420 RVIQPAEDVFASEGDTVTLGCTFETTNPYPNLFWYRQKMGDFPKYMLRCDSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALQ
Labrus bergylta V584 trav FKLU01001470.1 21112 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQLLIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V583 trav FKLU01001470.1 22566 LGSMNSINPETTEEKVEEGGNINLTCRYDSFITNIQWYRQNRRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALKPTVTG
Labrus bergylta V582 trav FKLU01001470.1 23555 IQPTQDVFASEGDTVTIDCQFETSTTPSLFWYKQEIGDFPKYMWKSYAGSSENAPGISEDRFNVSINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V581 ighv FKLU01001470.1 24599 KIYPAVDEVSGTEGESVTLTCNYETTDDDVFLYWYRHHSDLQAPQFILRKGARDLNSYEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V580 trav FKLU01001470.1 26718 EDRVIQPTEDVFASEGDTVTLGCTFETTDPNPNLFWYRQEMGDFPKYMLRCYSKDVYKAPELQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V579 trav FKLU01001470.1 32293 DRVIQPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYC
Labrus bergylta V578 trav FKLU01001462.1 4786 DRVIQPKEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWNSYVGISENAPGISGDRFKATRNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V577 ighv FKLU01001462.1 7271 KIYPAVDEVRGTEGESVTLRCNYETTTENVVLYWYRHHSDLQAPQFILWKGARSNSYEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V576 trav FKLU01001462.1 8303 LGSMNSINPERTEETIEEGGNINLTCTYDGFINNIQWYRENQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V575 trav FKLU01001462.1 9266 IQPTEDVFASEGDTVTLDCKVETTDTTLYLFWYRQEMGDFPKYLWKSYVGISENAPGISGERFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V574 trav FKLU01001462.1 14024 EDRVIQPTEDVFASEGDTVTLDCKFETIDTTPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V573 trav FKLU01001462.1 16429 IQPTEDVFASEGDTVTLDCKFETTDTTPSLFWYRQEMDDFPKYLWKSYGSFSENAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V571 trav FKLU01001462.1 21640 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKNGEGKTTKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V570 trav FKLU01001462.1 23206 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V569 trav FKLU01001462.1 24276 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAVLTDSAVYYCAVRPTVTGN
Labrus bergylta V568 trav FKLU01001462.1 25979 LGSMNSINPERTEEKVEEGGNINLTCTYDGVINNIQWYRQNQRSRPEFLLYITEGGTIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V567 trav FKLU01001462.1 27246 RVIQPTEDVFASERDTVTLDCTFETTDTNPFLFWYRQEAGDFPKYMLRCYSNKAENAPGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCAVR
Labrus bergylta V566 ighv FKLU01001462.1 31754 KIYPAVDEVRGTEGESVTLRCNYETTSEYVVLYWYRHHSDLQAPQFILLKGAKRRSDEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V565 trav FKLU01001462.1 33871 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAALTDSAVYYCALQPTVTGN
Labrus bergylta V564 trav FKLU01001408.1 7998 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNYYLYWYKQDGNNSPKFILSRFKIGEGKTTKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V563 trav FKLU01001408.1 9597 EDRVIQPTQDVFASEGDTVTLDCKVETISTTPSLLWYRQEMGDFPKYLWKSYAGSSENAPGFSEDRFNVTINGKSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V562 ighv FKLU01001408.1 10662 KIYPAVDEVRGTEGESVTLRCNYETTSEYVYLYWYRHHSDLQAPQFILWKGARGYSNDKYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V561 trav FKLU01001408.1 23863 EDRVIQPTEDVFASERDTVTLDCTFETTDTNPFLFWYRQEAGDFPKYMLRCNSNKAENAPGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V560 trav FKLU01001408.1 26715 EDRVIQPTQDVFASEGDTVTIDCQFETSTTPSLFWYKQEIGDFPKYMWKSYAGSSENAPGISEDRFNVTINGKSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V559 ighv FKLU01001408.1 27778 KIYPAVDEVRGTEGESVTLRCYYETTYDGVFLYWYRHHSDLQAPQFILWKGARSRSDSKYKYIPDKRYESQTSPISTELTIRKLTPEDTALYYCALE
Labrus bergylta V558 ighv FKLU01001320.1 3804 VRSQTLTESEPVVKSPGQSHKLTCTYTGISDSSADISWIRQAEGKGLEWVSFISAPSGSTKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARA
Labrus bergylta V557 ighv FKLU01001320.1 7543 VKAQTLTESEAVVKSPGESHRLTCSASGFTFSSHHMSWVRQAAGKGLEWIAWIQNNNDNKYYSQSVTGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Labrus bergylta V556 ighv FKLU01001320.1 8781 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISYQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V555 ighv FKLU01001320.1 10211 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYATAWIRQPAGKGLEWIILGAVGYSTYTKDSLKNQFSINFDSSSNTVTLNGLNMQPADTAVYYCARE
Labrus bergylta V554 ighv FKLU01001320.1 12469 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYAMNWVRQAPGKGLEWIAYISSSGGSQYYSNSVKSRFTISRDNSRQQVYLQMNSLKTEDSAVYYCAR
Labrus bergylta V553 ighv FKLU01001320.1 13424 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYFTAWIRQPAGKGLEWIGSGYQSYRFYKDSLKNQFSIDLDSSSNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V552 ighv FKLU01001320.1 18413 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWICNRWGGGDFYQNNALKNKFSYRTDTSARTVTLTGQNMQPEDTAVYYCVRR
Labrus bergylta V551 ighv FKLU01001320.1 19688 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGMVSAGSTTRYKDSLKNQFSIDLDSSRKIATLNGLNMQPADSAVYYCAREPQ
Labrus bergylta V550 ighv FKLU01001320.1 20909 QTLTESEAVVKRPGESHRPTCSASGFTFSSYDMAWVRQAAGKGLEWIAFIYTSSSYIYYSSSVQGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V549 ighv FKLU01001320.1 22291 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAEISSSGGSQSYSNSVKSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V548 ighv FKLU01001320.1 23447 TEGQTLTESDAVVKRPGEPHTLTCTYSGFSIHPHNAWIRQAAGKGLEWVAYISSGGSIYYSNSVKGRFTISRDNSRQQVFLQMNSLTMEDSAVYYCARE
Labrus bergylta V624 trav FKLU01001903.1 11501 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLITDTSDPTVVTAKPPHPRLTVKLNKERNLVDLQISSAALTDSAVYYCALKPTVTGN
Labrus bergylta V623 trav FKLU01001903.1 13662 DRVIQPTEDVFASEGDTVTLGCTFETTDPYPNLFWYRQEMGDFPKYMLRCYSKDINKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V622 trav FKLU01001903.1 19339 RVILPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V621 ighv FKLU01001853.1 7110 VDGQTLTESEAVVKSPGGSHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIAIISSSGGSSQYYSNSVRSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V620 ighv FKLU01001853.1 8212 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMRYTGAAYYKDSLKNQFSIDLDSSRKTATLNGLNMQPADSAVYYCARRDTV
Labrus bergylta V619 ighv FKLU01001853.1 13130 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYPMNWVRQVPGKGLEWIAYISSSGGSQYYSNSVKSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V618 ighv FKLU01001853.1 14233 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSRQPAGKGLEWIGMRVGSTTHYKDSLRNQFSIDLDASGNTTTLNGQNMQPADTAVYYCARDQE
Labrus bergylta V617 ighv FKLU01001853.1 19862 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEFIGTIEYDSDSIYYSNSVKSRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V616 ighv FKLU01001853.1 22373 VDAQTLTESEAVVKSPGGSHRLTCSASGFTFSSFAMSWVRQVPGKGLEWIAFISSGSGSIDYSNSVKSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V615 ighv FKLU01001853.1 23478 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSFATAWIRQPAGKGLEWIILGGGGYSTYTKDSLKNQFSIDFDSSSNTVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V614 ighv FKLU01001853.1 24702 QTLTQSEAVVKRPGESHRLTCSASGFTFSNYHMNWVRQAPGKGLEWLSFISTASTPISYSSSVRGRFTISRNDSSSKLYLQMNTLQTADTAVYYCARE
Labrus bergylta V613 igkv FKLU01001809.1 15943 SRGQVTVTQPAAVSSALGASVSISCTTSQNVYLYGSNLLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHSISSQYV
Labrus bergylta V612 igkv FKLU01001809.1 28787 SRGQVTVTQPAAVSSALGASVAISCRTSQDVYGNSYLHWYQQKDGGTPKLLIYVASSRASGIPYRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V611 igkv FKLU01001776.1 10072 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVYSSNHLLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V610 igkv FKLU01001776.1 12645 SRGQVTVTQPAAVSSALGASVSISCRTSQDVHVYNSNHLLAWYQQKDGGTPKLLIYYASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V609 igkv FKLU01001776.1 15479 QVTVTQPAAVSSALGASVSISCRTSQNVYVYSSYHCLAWYQQKDGGTPKLLIYYASTRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHTSTVRMC
Labrus bergylta V608 igkv FKLU01001776.1 18114 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVYSSSHCLAWYQQKDGGTPKLLIYYASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V607 igkv FKLU01001776.1 19721 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVGTNLNWYLQKPGEAPKLLIYYSTNRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSYP
Labrus bergylta V606 ighv FKLU01001661.1 1531 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYMTAWIRQPAGKGLEWIGMRSTGYTYYKDSLKNQFSIDLDSSSNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V605 ighv FKLU01001661.1 2750 QTLTESEAVVKRPGESHRLTCSASGFTFSSYEMSWVRQAAGKGLEWIAYISTSSSYIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V604 ighv FKLU01001661.1 6303 TEGQTLTESDAVVKRPGESHTLTCTYSGFSSHPHNAWIRQAAGKGLEWVAYISSGGSIYYSNSVKGRFTISRDNSRQQVFLQMNSLTMEDSAVYYCARGP
Labrus bergylta V602 ighv FKLU01001661.1 9183 VDGQTLTQSEAVVKRPGESHRLTCSTSGFTFRSYWMAWVRQAPGKGLEWIAIIKYDSGEIYYSNSVKSRFTISRDNSRQQMYLQMNSLKTEDTAVYYCARE
Labrus bergylta V601 trbv FKLU01001642.1 10394 TGVTFQQSHPRIVINTARIEIGCSHNDANLYVMLWYQQTQSGLMNLIGDSYLIGEPDYEKKFKDRFEITRKDLTTAALIIPSVTPSDSAVYFCAAS
Labrus bergylta V600 trbv FKLU01001642.1 16429 SSSSDQVHQTPRDIYIKPGEPARIQCSHQIQSYNQILWYKKSNKQMQLLGYMSSTSSNPEKDVKVKMEGDASKGENCTLIIERVNQSSSAVYFCAAS
Labrus bergylta V599 trbv FKLU01001642.1 17178 SSSSDQVHQTPRDIYSKPGEPARIQCSHQIQSYNVILWYKKSKKQMQLLGYMLTTTSNPEKDVKVKIEGDASKGKNCTLIIERVNQNSSAVYFCAAS
Labrus bergylta V598 trbv FKLU01001642.1 17928 SSNSDKVDQTPRDIFIKPGKDAKINCKHKIDNYDRILWYKQSNKQMQLLGYMYSTISNPEKDVKVKMEGGANKGENCTLIIEQVNQNSSAVYFCAAS
Labrus bergylta V597 trbv FKLU01001642.1 18711 SSSSDQVHQTPRDIYSKPGEPARIQCSHQIQSYDQILWYKKSNKQMQLLGYMYSTTSNPEKDVKVKMEGGANKGENCTLIIERVNQSSSAVYFCAAS
Labrus bergylta V596 trbv FKLU01001642.1 19460 SSNSDKVDQTPRDIFIKPGKDAKINCKHKIDNYDRILWYKQSNKQMQLLGYMFTTTSNTEKDVKVKMEGDASKGENCTLIIERVNQSSSAVYFCAAS
Labrus bergylta V595 trbv FKLU01001642.1 20243 SSSSDQVHQTPRDIYSKPEEPARIQCSHQIQSYNVILWYKKLNKQMQLLGYMLTTNSYPETDIKVKMEGDASKGKNCTLIIERVNQNSSAVYFCAAS
Labrus bergylta V594 trbv FKLU01001642.1 22018 LSKSHVDQKPAALVIHPGEKVQLTCNHSNSNFDMIQWYKQSKGKHDMALLGYVRYSSATVEDQFKGLYNVSGDGKNQSSLILLKLSGSESAVYFCAASE
Labrus bergylta V593 trbv FKLU01001642.1 29671 SSLSQIVEQTPTHMFSKPGEKPQINCKHEIKDYNRMLWYKQLKNRQMQFLGYMNVKDGYPEDGVHVKIEGSALERQNCTLTIEAVELSSSAVYFCAAS
Labrus bergylta V592 ighv FKLU01001538.1 8734 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGYYTAWIRQPAGKGLEWIIRGQVGYSTYTKDSLKNQFSINFDSSSKTVTLNGLNMQPADTAVYYCARE
Labrus bergylta V591 ighv FKLU01001538.1 10282 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSGYYTAWIRQPAGKGLEWIGSGAGSTRYYKDSLKNQFSIDLDSSSNRVTLNGLNMQTADTAVYYCARDPQ
Labrus bergylta V590 ighv FKLU01001538.1 11503 VDAQTLTESEAVVKSPGGSHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIAFISTASTPISYSSSVRGRFTISKNDSSSKLYLQMNSLQTEDTAVYYCARD
Labrus bergylta V589 ighv FKLU01001538.1 17480 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAYISTSSSYISYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCTRE
Labrus bergylta V588 ighv FKLU01001470.1 3436 KIYPAVDEVSGTEGESVTLRCNYETTSEYVFLYWYRHHSDLQAPQFILLKGARSWSDSKYTYIPDKRYESQTSSSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V587 trav FKLU01001470.1 9280 SSEELVTPFREIMMAVDGENVTLSCNYSGSANNLYWYQQKSGSSPQLLIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALR
Labrus bergylta V663 trav FKLU01002071.1 4265 LGSMNSINPETTEEKVEEGGNINLTCTYDGVITNIQWYRENQRSRPEFLLSITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V662 trav FKLU01002071.1 5254 RVIQPTEDVFASEGDTVTLGCTFETTNPYPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNATINGTSVPLTIQKLQLADSAVYYCALR
Labrus bergylta V661 trav FKLU01002071.1 10914 RVILPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V660 trav FKLU01002071.1 12950 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQHLIGEYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALR
Labrus bergylta V658 trav FKLU01002071.1 16024 LGSMNSINPETTEEKVEEGGNINLTCTYDGFINKIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKIVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V657 trav FKLU01002071.1 23576 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQHLMEYSENREVVTRHDKQSNEFHLEISSAALTDSAVYYCALSPQ
Labrus bergylta V656 trav FKLU01002046.1 1356 VWSEIRLEQSPSEVKRPGETVKMSCIISGFDMTSFYIHWIRQKPGRALEWIGWMSTGSNSASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCARD
Labrus bergylta V655 ighv FKLU01002046.1 3127 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSSHHMSWVRQAPGKGLEWIAWIQNNNDNKYYSQSVTGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Labrus bergylta V654 ighv FKLU01002046.1 4371 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V653 ighv FKLU01002046.1 8732 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSSYDMNWVRQAPGKGLEWIAWVENDNDRKYYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V652 trav FKLU01002022.1 1625 IQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYMWKSYEGLSQIALGISEDRFNTTINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V651 trav FKLU01002022.1 7561 CMAKRQRAATRRDVTATEGEAVTLGCQYNSSSSNDYLFWYKQDGNNSPKFILSRFKIGEGKTMKESVERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V650 ighv FKLU01002022.1 10441 KIYPAVDEVRGTEGESVTLRCNYETTTDYVDLYWYRHNSDLQAPQFILWKGARSSGSQYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V649 trav FKLU01002022.1 12056 LGSMNSINPERTEEKVEEGGNINLTCTYDGVINNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V648 trav FKLU01002022.1 15352 EDRVIQPTEDVFASEGDTVTLDCKVETTDTTPSLFWYRQEMGDFPKYLWKSYVGISENAPGISGDRFKAATNGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V647 trav FKLU01002022.1 18403 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFFLLITDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAVLTDSAVYYCALR
Labrus bergylta V646 trav FKLU01002022.1 19290 LGSMNSINPETTEENVEEGGNINLTCTYDGLIHNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALS
Labrus bergylta V645 trav FKLU01002022.1 22997 IQPTEDVFASEGDTVTLDCTFETTDTAPSLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V644 ighv FKLU01002022.1 24050 KIYPAVDEVRGTEGESVTLRCNYETTSDYVYLYWYRHHSDLQAPQFILRKGARSKSLEYIPDERYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V643 ighv FKLU01002010.1 848 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMRSTGYTYYKDSLKTQFSIDLDSSRKIATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V642 ighv FKLU01002010.1 3754 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAIISSSGGSSQYYSNSVRSRFTISRDNNRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V641 ighv FKLU01002010.1 4859 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMRFTGAAYYKDSLKNQFSIDLDASRNRATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V640 ighv FKLU01002010.1 6079 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWLRQCEGKPMNWICHRLGGGDFYQNNALKNKFSYRTDTSARTVTLTGQNMQPEDTAVYYCARE
Labrus bergylta V639 ighv FKLU01002010.1 6734 VDGQTLAQSQPVVKRPGESHRLTCYAYGFTMSSYRMAWVRQAPGKGLEWIAIIKYDSGEIYYSNSVKSRFTISRDNSRQQVYLQMNSLKTEDTAVYYCARE
Labrus bergylta V638 ighv FKLU01002010.1 7849 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGSEAGSTRFYKDSLKNQFSINFDSSRKTATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V637 ighv FKLU01002010.1 13383 VDGQTLTESEAVVKSPGGSHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAIISSGSGSIYYSNSVRSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V636 ighv FKLU01002010.1 14489 VKCEQLTQPASVTVQPGQSLTITCQVSYSFSSYWTAWIRQPAGKGLEWIIVGAVGYSTHTKDSLKNQFSIDLDSSRNTATLNGLNMQPADTAVYYCARDQE
Labrus bergylta V635 ighv FKLU01002010.1 16771 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYHMNWVRQAPGKGLEWIAWVENDNDRKFYSQSVTGRFTASRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V634 ighv FKLU01002010.1 18908 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIAYISTSSSYISYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V633 ighv FKLU01002010.1 20310 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSSWMAWVRQAPGKGLEWIAYISNGGGSSQYYSNSVKSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V632 ighv FKLU01001953.1 6805 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYNMNWVRQAPGKGLEWIAWVEFDNDNKYYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V631 ighv FKLU01001953.1 8198 QTLTESEAVVKRPGESHRLTCSASGFTFRSYEMSWVRQAPGKGLEWIAYISTASTPISYSSSVRGRFIISRDDSNSKLYLQMNSLQPADTAVYYCARD
Labrus bergylta V630 ighv FKLU01001953.1 10547 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSNYHMNWVRQAPGKGLEWISFIHTSSSYIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTEDTAVYYCARE
Labrus bergylta V629 ighv FKLU01001953.1 21229 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSYISAPSGSTKSYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARD
Labrus bergylta V628 trav FKLU01001953.1 23570 VWSEIRLEQSPSEVKRPGETVKMSCIISGFDMTSDYIHWIRQKPGRALEWIGWMSTGSNSASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCARE
Labrus bergylta V627 igkv FKLU01001940.1 21148 SRGQVTVTQPAAVSSALGASVSISCRTSQDVFYSSPYHLLAWYQQKDGGTPKLLIYVASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHSINSQA
Labrus bergylta V626 trav FKLU01001903.1 2160 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYLWKGSGGFSENAPGISIERYKATINGTSVPLTIQKLQLTDSAVYYCALR
Labrus bergylta V702 trav FKLU01002283.1 10984 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAALTDSAVYYCALKPTVTGN
Labrus bergylta V701 trav FKLU01002283.1 11950 SSEELVTPFREVMMAVDGDDVTLSCNYSGSVTNLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALR
Labrus bergylta V700 trav FKLU01002283.1 13039 SSEELVTPFREIMMAVDGDDVTFSCNYSGSVNNLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCAVR
Labrus bergylta V699 trav FKLU01002283.1 14120 IQPTEDVFVSEGDTVTLDCKLETSTTPYLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLSDSAVYYCALQ
Labrus bergylta V698 trav FKLU01002283.1 15317 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAALTDSAVYYCALRPTVTG
Labrus bergylta V697 trav FKLU01002283.1 16221 DRVIQPTEDVFASEGDTVTLGCTFKTTDPNPNLFWYRQKMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V696 ighv FKLU01002277.1 8954 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYLMAWVRQAPGKGLEWVATIDVTSIYYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Labrus bergylta V695 trav FKLU01002277.1 10456 AQGQSLTSSEPVVSRAGEPATLYCNVNGLALSWLHWIRQKTGKGLEWIGRIDSGTGTIFAQNLQGQFSITKDTSNNVVYLEVKSLKQEDSAVYFCAREPQ
Labrus bergylta V694 ighv FKLU01002277.1 11690 VDGQTLTESEAVVKSPGESHRLTCSASGFTFSSYAMNWVRQAPGKGLEWIATISSGSGSSQYYSNSVKSRFTISRDNSRQQLYLQMNSLQAEDSAVYYCARE
Labrus bergylta V693 ighv FKLU01002277.1 12944 VHCIDLITPGSMVVQSGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLSQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V692 ighv FKLU01002277.1 14374 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYATAWIRQPAGKGLEWIIIGRVGYNTYTKDSLKNQFSINFDSSSNTVTLNGLNMQPADTAVYYCAR
Labrus bergylta V691 ighv FKLU01002277.1 17364 VDAQTLTQSEAVVKRPGESHRLTCSASGFTFSSYHMNWVRQAAGKGLEWIAWVENDNDRKFYSQSVTGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V690 ighv FKLU01002277.1 18750 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGYYTAWIRQPAGKGLELIGMRSTGGTYYKDSLKNQFSIDLDASRNRATLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V689 ighv FKLU01002277.1 20930 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWICHRWGGGDFYQNNALKNKFSYSRDTSARTVTLTGQNMQPEDTAVYYCVRE
Labrus bergylta V688 trbv FKLU01002239.1 4257 SSLSQIVEQTPTHMFSKPGEKPQINCKHEIKDYNRMLWYKQLKNRQMQFLGYMNVKDGYPEDGVHVKIEGSALERQNCTLTIEAVELSSSAVYFCAAS
Labrus bergylta V687 trbv FKLU01002239.1 12470 SSNSDKVDQTPRDIFIKPGKDAKINCKHKIDNYDRILWYKQSNKQMQLLGYMYSTTSNTEKDVKVKMEGDASKGENCTLIIERVNQSSSAVYFCAAS
Labrus bergylta V686 trbv FKLU01002239.1 13253 SSSSDQVHQTPRDIYSKPGEPARIQCSHQIQSYDQILWYKKLNKQMQLLGYMLTTNSYPETDIKVKMEGDASKGKNCTLIIERVNQSSSAVYFCAAS
Labrus bergylta V685 trbv FKLU01002239.1 15021 LSKSHVDQKPAALVIHPGEKVQLTCNHSNSNFEMIQWYKQSKGKHDMALLGYVRYSSATVEDQFKGLYNVSGDGKNQSSLILLKLSGSESAVYFCAASE
Labrus bergylta V684 trbv FKLU01002239.1 17996 VIDGSDVKQAAVLWGDEGQSATMTCEHTKGATYFQMYWYRQLPGETMQQIVLTRPSVPPQYWSDFSEDKFPAKKDNFSTGSLTVEKLLPADSGVYFCAVS
Labrus bergylta V683 trav FKLU01002225.1 5462 EDRVIQPTEDVFASEGDTVTLGCTFETTDPYPNLFWYRQKMGDFPKYMLRCYSKDINKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V682 trav FKLU01002225.1 11200 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQHLIGEYSEKIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V681 trav FKLU01002225.1 12246 IQPTEDVFASQGDTVTLDCKFETTDTTPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V680 trav FKLU01002225.1 18840 IQPTQDVFASEGDTVTLDCKVETSTTPYFSWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V679 trav FKLU01002225.1 20872 DRVIQPTEDVFASEGDTVTLDCTFETTRTSPTLFWYRQKCNDFPRYMLKSYSDNAEKAPEFQTDRFNAAINGTSVPLKIQKLQLTDSAVYYCALK
Labrus bergylta V678 trav FKLU01002225.1 22978 IQPTEDVFASEGDTVTLDCKVETISTTPSLFWYRQEMGDFPTYLWKSYAGSSENAPGISEDRFNVTINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V677 trav FKLU01002182.1 2938 VSAVTLVTQKPPVVTLRRGETATMDCNLGTVTNSYALWYKQIPGGVPQFILSNYHSWSSPSYGSGFSSPKFTSTHQSQTDYRLIISTVEERDSAVYYCQ
Labrus bergylta V676 trav FKLU01002182.1 2938 VSAVTLVTQKPPVVTLRRGETATMDCNLGTVTNSYALWYKQIPGGVPQFILSNYHSWSSPSYGSGFSSPKFTSTHQSQTDYRLIISTVEERDSAVYYCQ
Labrus bergylta V675 igkv FKLU01002101.1 10924 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVYSSNHYLAWYQQKDGGTPKLLIYFASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V674 igkv FKLU01002101.1 13514 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYYSSYHYLAWYQQKDGGTPKLLIYVASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V672 igkv FKLU01002101.1 22174 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVGAYLNWYLQKPGEAPKLLIYYSTNRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSSP
Labrus bergylta V671 igkv FKLU01002089.1 6190 SRGQVTVTQPAAVTSALGASVSISCTTSQDVYDSDRLAWYQQKDGGTPKLLIYLASTPASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHSINSQNV
Labrus bergylta V670 ighv FKLU01002079.1 1540 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISHQWGTSGLRQNNALKIKFSYSRDTSAGTVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V669 ighv FKLU01002079.1 2970 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYWTAWIRQPAGKGLEWIIVGRVGYSTYTKDSLKNQFSINFDSSSNTATLNGLNMQPADTAVYYCARE
Labrus bergylta V668 ighv FKLU01002079.1 5943 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQRKGKPMDWICNRWGGSFYQNNALKNKFSYSRDTSARTVTLTGQNMQPEDTAVYYCVRR
Labrus bergylta V667 ighv FKLU01002079.1 9007 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIATIRYDSANIYYSNSVKSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V666 ighv FKLU01002079.1 20373 VRSQTLTESEPVVKSPGESHKLTCTYTGISDSSADISWIRQAEGKGLEWVSFISAPSGSNKYYSTSVKNRFTISRDNDVDQVYLHLNSLTAEDSAVYYCARD
Labrus bergylta V665 ighv FKLU01002079.1 23930 VKAQTLIESEAVVKRPGESHRLTCSASGFTFSSHHMSWVRQAPGKGLEWIAWIQNNNDNKYYSQSVTGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Labrus bergylta V741 ighv FKLU01002981.1 15631 KIYPAVDEVRGTEGESVTLRCNYETTSEYVYLYWYRHHSDLQAPQFILWKGARYYSDEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V740 trav FKLU01002950.1 3974 SSEELVTPFREVMMDVDGENVTLSCNYSGSANYLYWYQQKSGSSPQLLIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V739 trav FKLU01002950.1 5035 LGSMNSINPERTEETVEEGVNINLTCTYDGQIYNIQWYRQNQRSRPEFLLSITEGGTIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALKPTVTG
Labrus bergylta V738 trav FKLU01002950.1 6014 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMEEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALS
Labrus bergylta V737 ighv FKLU01002950.1 10062 KIYPAVDEVSGTEGESVTLRCNYETTTDYVVLYWYRHHSDLQAPQFILLKGARLTSGEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V736 trav FKLU01002950.1 11372 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLITDTSDPTVVTAKPPHSRLTVKLNEERNRVDLQISSAVLTDSAVYYCALR
Labrus bergylta V735 trav FKLU01002950.1 12246 EDRVIQPTEDVFASEGDTVTLGCTFETTDPNPNLFWYRQKMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V734 ighv FKLU01002784.1 3 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIAIADVVLAYYSSQLKAGSPSPETTADSRLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V733 ighv FKLU01002784.1 5050 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYYMAWFRQAAGKGLEWIVTISNDGSSYIYYSTSVKGRFTVSRDNSRQQLYLQMNSLQAEDSAVYYCARE
Labrus bergylta V732 ighv FKLU01002784.1 7384 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGEGLEWIAFIYTSSSYIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V731 ighv FKLU01002784.1 9774 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V730 ighv FKLU01002784.1 11197 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIIVGAVGYSTYTKDSLKNQFSINFDSSSNTATLNGLNMQPADTAVYYCARE
Labrus bergylta V729 ighv FKLU01002784.1 13072 VDGQTLAQSQPVVKRPGESHRLTCYAYGFTMSSYWMAWVRQAPGKGLEWIAIIKYDSGEIYYCNSVKSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V728 ighv FKLU01002784.1 14175 VKCEQLTQPASVTVQPGQSLTITCQVSYSVGSYATAWIRQPAGKGLEWIIVGAVGYSTHTKDSLKNQFSINFDSSRNTATLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V727 ighv FKLU01002784.1 16456 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFRSYEMSWVRQAPGKGLEWIAYISSSGSQYYSNSVKSRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V726 igkv FKLU01002759.1 4265 QVTVTQPAAVSSALGASVSISCRTSQDVYYGSSYHYLAWYQQKDGGTPKLLIYFASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFSINSQRC
Labrus bergylta V725 igkv FKLU01002759.1 7186 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYNNNYLAWYQQKDGGTPKLLIYLASTRVSGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V724 igkv FKLU01002759.1 17724 SRGQVTVTQPAAVSSALGASVSISCTTSQDVYVYSSSYHLAWYQQKDGGTPKLLIYLASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFIYQQSGC
Labrus bergylta V723 igkv FKLU01002759.1 21527 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVSTYLNWYLQKPGEAPKLLIYSSTSRQPGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQCYSFP
Labrus bergylta V722 trbv FKLU01002688.1 1218 LSKSHVDQKPAALVIHPGEKVQLTCNHSNSNFEMIQWYKQSKGKHDMALLGYVRYSSATVEDQFKGLYNVSGDGKNQSSLILLKLSGSESAVYFCAASE
Labrus bergylta V721 trdv FKLU01002688.1 2912 QSQAKDVKQEPPSIFGSPDGSTTISCSHTISSFYVILWYQQPTGNSSLNLIGYIQYTNAVVEDKFRERFNVSGDGSKKSELHVVKLRQAEDSGMYYCAAS
Labrus bergylta V720 trdv FKLU01002677.1 16752 RVILPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAISGKSVPLKIQKLQLYYCALRPTVTG
Labrus bergylta V719 trav FKLU01002677.1 19528 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAVLTDSAVYYCALQPTVTGN
Labrus bergylta V717 trav FKLU01002658.1 12036 DRVIQPTEDVFASEGDTVKVDCIFETTRTSPTLIWYRQKCNDFPRYMLKSYSDKAEKASEFQTDRFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V716 ighv FKLU01002658.1 14676 KIYPAVNEVSGTEGESVTLRCNYETTTEYVYLYWYRHHSDLQAPQFILRKGARINSYSEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V715 trav FKLU01002658.1 16908 SSKELVTPFREVMMAVDGDDVTLSCNYSGSANYLYWYQQKSGSSPQLLIGGYSEKTEKLSTRHDKQSNEFHLESSSAALTDSAVYYCALK
Labrus bergylta V714 trav FKLU01002658.1 19244 RVIQPTEDVFASEGDTVTLGCTFETTDPYPNLFWYRQKMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLSDSAVYYCAVR
Labrus bergylta V713 igkv FKLU01002560.1 17651 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVSNRLAWYQQKDGGTPKLLIYRASSRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V712 trav FKLU01002385.1 1070 SSEELVTPFREVMMAVDGENATLSCNYSGSANYLCWYQQKSGSSPQLLIGEYSEKIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V711 trav FKLU01002385.1 4133 IQPTEDVFASQGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYLWKSYVGISENAPGISGDRFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V710 ighv FKLU01002385.1 6618 LTAGDKIYPAVDEVRGTEGESVTLRCNYETTYDVFLYWYRHHSDLQAPQFILWKGARSRSDRKYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V709 trav FKLU01002385.1 23476 NTLEDDITASSTEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAALTDSAVYYCALRPTVTG
Labrus bergylta V708 trav FKLU01002328.1 8093 IQPTEDVFASEGDTVTLDCKFETTDTTPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V707 ighv FKLU01002328.1 10580 KIYPAVDEVSGTEGESVTLRCNYETTEQNVYLFWYRHHSDLQAPQFILLKGARSRSYEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V706 trav FKLU01002283.1 3677 IQPTEDVFASEGDTVTLDCQFETSTAPYLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALSPQ
Labrus bergylta V705 trav FKLU01002283.1 5101 IQPTEDVFTSEGDTVTLDCKFETSTTPYLFWYRQEMGEIPRYLWRGKAGFSENAPGISGDRFKATINGTSILLKIQKLQLTDSAVYYCALR
Labrus bergylta V704 trav FKLU01002283.1 7189 CMAQKDNVLQPEGDVTATEGEAVTLGCQYNSSSSNYYLYWYKQDGNNSPKYILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V775 trav FKLU01003282.1 7268 IQPTEDVFASEGDTVTLDCKVETTDTAPSLFWYRQEMGDFPKYLWKSYVGISENAPGISGDRFKATTNGTSVPLKIQKLQLTDSAVYYCAVR
Labrus bergylta V774 trav FKLU01003282.1 18284 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALR
Labrus bergylta V773 ighv FKLU01003277.1 2338 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIARISNGGGSSQSYSNSVKGRFTISRDDSRQQLYLQMNSLKTADTAVYYCARD
Labrus bergylta V772 ighv FKLU01003277.1 4944 VDGQTLTESEAVVKSPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAYISTSSSYIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V771 ighv FKLU01003277.1 7350 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAYISNGGGSSQYYSNSVKSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V770 ighv FKLU01003277.1 16440 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSYISAPSGSNKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCAR
Labrus bergylta V769 trav FKLU01003277.1 18775 VWSEIRLEQSPSEVKRPGETVKMSCIISGFDMTSDYIHWIRQKPGRALEWIGRMDAGSNSASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCARD
Labrus bergylta V768 trav FKLU01003240.1 3343 SSEELVTPFREVMMAVDGENVTLSCNYSGSVNYLYWYQQKSGSSPQHLMEIFRKNREVVTRHDKQSNEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V767 ighv FKLU01003192.1 5318 KIYPAVDEVRGTEGESVTLRCNYETTKQNVYLYWYRHHSDLQAPQFILRKGAKRWSDEYIPDKRYESQTSPSSTELTIRKLTSEDTALYYCALE
Labrus bergylta V766 trav FKLU01003192.1 7446 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAALTDSAVYYCALRPTVTG
Labrus bergylta V765 trav FKLU01003192.1 11141 CMAQTDNVLQPEGDVTAPEGEAVTLGCQYNSSSSNYYLYWYKQDGNNSPKFIMSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCAVKPTVTG
Labrus bergylta V764 trav FKLU01003192.1 11934 SSEELVTPFREVMMAVDGENVTLSCNYSGSVTNLYWYQQKSGSSPQHVIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V763 trav FKLU01003192.1 16137 EDRVIQPTEDVFASQGDTVTLDCKFETTDTTPSLFWYRQEMDDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V762 trav FKLU01003192.1 17683 SSEELVTPFREVMMAVDGENVTLSCNYSGSVTNLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V761 trav FKLU01003192.1 18749 LGSMNSINPETTEEKVEEGGNINLTCTYDGFIDNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSVYINKTEKQVNLEISSAALTDSAVYYCALKPTVTG
Labrus bergylta V759 trav FKLU01003085.1 1890 LGSMNSINPETTEEKVEEGGNINLTCTYDGQIQNIQWYRQNQRSRPEFLLYITEGGLVYKQVSYFSAHIKKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V758 trav FKLU01003085.1 2853 IQPTQDVFASEGDTVTLDCKVETISTTPSLFWYRQEMGDFPKYLWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALR
Labrus bergylta V757 trav FKLU01003085.1 13289 LGSMNSINPERTEEKVEEGGNINLTCTYDGLIQNIQWYRQNQRSRPEFLLYITEGGTIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALKPTVTG
Labrus bergylta V756 trav FKLU01003085.1 14237 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V755 trav FKLU01003085.1 15821 DRVIQPTEDVFASEGDTVTLVCKFETTDTAPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALK
Labrus bergylta V754 ighv FKLU01003085.1 18305 KIYPAVDEVSGTEGESVTLRCNYETTTDYVVLYWYRHHSDLQAPQFILLKGARLTSGEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V753 trav FKLU01003085.1 19671 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLITDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAALTDSAVYYCALQPTVTGN
Labrus bergylta V752 ighv FKLU01003050.1 6150 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSHISAPSGSNKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARA
Labrus bergylta V751 trav FKLU01003050.1 8485 VWSENRLEQSPSEVKRPGETVKMSCIISGYSMTSNAIHWIRQKPGRALEWIGWMSTGNNAASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCARE
Labrus bergylta V750 ighv FKLU01003050.1 11070 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGWGYTGGTHYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V749 ighv FKLU01003050.1 13054 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISHRWGGGDFYQNNALKNKFSYRTDTSARAVTLTGQNMQPEDTAVYYCVRR
Labrus bergylta V748 ighv FKLU01003050.1 14025 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSFAMSWVRQAPGKGLEWIAHINSGGQYYSNSVRSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V747 ighv FKLU01003050.1 15122 VKCEQLTQPASVTVQPGQSLTITCQVSYSVNSYATAWIRQPAGKGLEGIILGGGGYSTYTKDSLKNQFSINLDSSSNRVTLNGLNMQPADSAVYYCAREPQ
Labrus bergylta V746 trav FKLU01002981.1 2641 NVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALSPQ
Labrus bergylta V745 trav FKLU01002981.1 7645 IQPTEDVFASEGDTVTLDCKVETISTTPSLFWYRQEMGDFPKYLWKSYAGSSENALGISDDRFNATINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V744 ighv FKLU01002981.1 10131 KIYPAVDEVSGTEGESVTLRCNYETTSDYVDLYWYRHHSDLQAPQFILWKGAKRRSNDKYIPDKRYESQTSPSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V743 trav FKLU01002981.1 13161 RVIQPTEDVFASERDTVTLDCTFETTDTNPFLFWYRQEAGDFPKYMLRCYSNKAENAPGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V781 ighv FKLU01003286.1 4358 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V780 ighv FKLU01003286.1 10653 VDAQTLTESEAVVKRPGESHRLTCSASGFTFSNYEMNWVRQAPGKGLEWISFIHTGSTPIYYSSSVQGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARD
Labrus bergylta V779 ighv FKLU01003286.1 16746 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAYISTSSSYISYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCTRE
Labrus bergylta V778 trav FKLU01003282.1 3672 SSEELVTPFREVMMAVDGENVTISCNYSGSANYLYWYQQKSGSSPQLFIGGYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALR
Labrus bergylta V777 trav FKLU01003282.1 4738 LGSMNSINPETTEEKVEEGGNINLTCTYDGQIQNIQWYRQNQRSRPEFLLYITEGGLIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V819 trav FKLU01003542.1 14020 SSEELVTPFREIMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQHLIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALR
Labrus bergylta V818 trav FKLU01003523.1 3956 EDRVIQPTEDVFASERDTVTLDCTFETTDTNPFLFWYRQEAGDFPKYMLRCYSNKAENAPGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V817 trav FKLU01003523.1 5378 EDRVIQPTQDVFASEGDTVTLDCKFETSTTSLFWYRQEMGEIPKYLWRGNAGFSENAPGISGERFKATINGTSIPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V816 ighv FKLU01003523.1 6437 KIYPAVDEVRGTEGESVTLRCNYETTSEYVYLYWYRHHSDLQAPQFILWKGARYYSDEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V815 trav FKLU01003520.1 9868 LGSMNSINPERTEETVEEGGNINLTCTYDGQIYNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCAVK
Labrus bergylta V814 trav FKLU01003520.1 12330 SSEELVTPFREVMMAVDGENVTLSCNYSGSAKYLYWYQQKSGSSPQLLIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALR
Labrus bergylta V813 igkv FKLU01003517.1 1023 RVIQPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCWPTVTG
Labrus bergylta V812 trav FKLU01003517.1 8307 CMAQKDNVLQPEGDVTATEGEAVTLGCQYNSSLSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V811 trav FKLU01003517.1 9085 LGSMNSINPETTEEKVEEGVNINLTCRYDGQIYNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V810 trav FKLU01003517.1 12236 LGSMNSINPETTEEKVEEGGNINLTCTYDGLIQNIQWYRQNQRSRPEFLLYITEGGTIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V809 trav FKLU01003517.1 13184 IQPTEDVFASEGDTVTLDCQFETSTTLYLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALRPKVTG
Labrus bergylta V808 ighv FKLU01003517.1 17324 KIYPAVDEVRGTEGESVTLTCNYETTDDDVFLYWYRHHSDLQAPQFILWKGARDLNSYEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V807 trav FKLU01003507.1 2476 NVLQPEGDVTATEGEAVTLGCQYNSSLSNEYLYWYKQDGNNSPKFILSRFKFGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V806 trav FKLU01003507.1 5130 LGSMNSINPETTEEKVEEGGNINLTCTYDGQIQNIQWYRQNQRSRPEFLLYITEGGLIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V805 trav FKLU01003507.1 7497 IQPTEDVFTSEGDTVTLDCKFETSTTPSLFWYRQEMGEIPRYLWRGNAGFSENAPGISGDRFKAKRNGTSIPMKIQKLQLTDSAVYYCALR
Labrus bergylta V804 trav FKLU01003507.1 8677 LGSMNSINPETTEEKVEEGGNINLTCTYDGLIQNIQWYRQNQRSRPEFLLYITEGGTIHTTDSDFSSYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V803 trav FKLU01003507.1 12136 EDRVIQPTEDVFASEGDTVTLDCTFETTRTSPTLFWYRQKCNDFPRYMLKSYSDKAEKASEFQTDRFNAAINGTSIPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V802 ighv FKLU01003507.1 13202 KIYPAVDEVRGTEGESVTLRCNYETTTEYVDLYWYRHHSDLQAPQFILRKGARSRSDRKYMPDERYESQTSPSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V801 igkv FKLU01003438.1 16717 SRGQVTVTQPAAVTSALGASVSISCTTSQNVYLYGSNLLAWYQQKDGGTPKLLIYYASSRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHSINSQMC
Labrus bergylta V800 trav FKLU01003403.1 7980 LGSMNSINPETTEEKVEEGGNINLTCTYDGLIQNIQWYRQNQRSRPEFLLYITEGGTIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V799 trav FKLU01003403.1 8928 IQPTEDVFASEGDTVTLDCQFETSTTLYLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALRPKVT
Labrus bergylta V798 ighv FKLU01003403.1 13065 KIYPAVDEVRGTEGESVTLTCNYETTDDDVFLYWYRHHSDLQAPQFILWKGARDLNSYEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V797 trav FKLU01003338.1 3998 SSEELVTPFREVMMAVDGENATLSCNYSGSANYLYWYQQKSGSSPQLLIGEYSEKIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V796 trav FKLU01003338.1 5030 NTLEDDITASSAEVFSSEGHGVTLSCKYSVKANNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVELNKERNLVDLQISSAVLTDSAVYYCALQPTVTGN
Labrus bergylta V795 trdv FKLU01003338.1 7956 IQPTEDVFASEGDTVTLDCKFETTDTTPSLLWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSALYYCALK
Labrus bergylta V794 ighv FKLU01003338.1 10868 KIYPAVDEVSGTEGESVTLRCNYETTYQKVVLYWYRHHSDLQAPQFILWKGARSWSGSQFIPDKRYESQTSSSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V793 trav FKLU01003338.1 12963 LGSMNSINPETTEENVEEGGNITLTCTYDGVIDNIQWYRQNQKSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALKPTVTG
Labrus bergylta V791 trav FKLU01003330.1 2403 SSEELVTPFREVMMAVDGENVTLSCNYSGSVTNLYWYQQKSGSSPQLLIGEYSEKIENLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V790 trav FKLU01003330.1 5015 LGSMNSINPETTEEKVEEGGNINLTCTYDGLIYNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V789 trav FKLU01003330.1 5978 IQPTEDVFASEGDTVTLDCQFETSMTPYLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLSDSAVYYCALR
Labrus bergylta V788 trav FKLU01003330.1 7183 LGSMNSINPETTEEKVEEGGNINLTCTYDGVINNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKKEKQVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V787 trav FKLU01003330.1 10440 EDRVIQPTEDVFASEGDTVTLDCTFETTRTSPTLFWYRQKCNDFPRYMLKSYSDKAEKASEFQTDRFNAAINRTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V786 trav FKLU01003287.1 10536 SSEELVTAFREVMMAVDGENVTLSCNYSGSVTNLYWYQQKSGSSPQHVIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V785 trav FKLU01003287.1 17358 LGSMNSINPETTEEKVEEGGNINLTCTYDGFIDNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSVYINKTEKQVNLEISSAALTDSAVYYCALKPTVTG
Labrus bergylta V784 trav FKLU01003287.1 18627 DRVIQPTEDVFASEGDTVTLGCTFKTTDPNPNLFWYRQKMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V783 ighv FKLU01003286.1 1723 QTLTESEAVVKRPGESHRLTCSASGFTFSSFAMSWVRQAPGKGLEWLAHINSGGQYYSNSVRSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V782 ighv FKLU01003286.1 3113 QTLTESEAVVKRPGESHRLTCSASGFTFSSYDMNWVRQAPRNGLEWIAWVENDNDKKYYSQSVKSRFTISRDNSRQQVYLQMNSLKTEDTAVYYCARD
Labrus bergylta V858 trav FKLU01003850.1 5193 LGSMNSINPETTEEKVEEGGNINLTCTYDGQIQNIQWYRQNQRSRPEFLLYITEGGTIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALKPTVTG
Labrus bergylta V857 trav FKLU01003850.1 10925 DRVIQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCAVK
Labrus bergylta V856 trav FKLU01003850.1 12339 NVLQPEGDVTATEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPEFILSRFKIGEGKTMEEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V855 trav FKLU01003850.1 13891 EDRVIQPTEDVFASEGDTVTLDCKVETTDTTPSLFWYRQEMGDFPKYLWKSYVGISENAPGISGERFKATTNGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V854 trav FKLU01003754.1 2756 RVIQPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCAVM
Labrus bergylta V853 trav FKLU01003754.1 5582 SSEELVTPFREVMMAVDGENVTLSCNYSGSVTNLYWYQQKSGSSPQLLIGGYSEKKEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V852 trav FKLU01003754.1 6656 EDRVIQPTEDVFASEGDTITLGCTFETTNPYPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNATINGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V851 trav FKLU01003754.1 9265 LRRRSKELVTPFREIMMAVDGDDVTLSCNYSGSVTNLYWYQQKSGSSPQLLIGGYSEKIEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V850 ighv FKLU01003746.1 1697 VHCIDLITPGSMVVQPGQTLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISYQWGGSSGSFYQNNALKNKFSYSRDTSAGTVTLTGQSLQPEDTAVYYCARV
Labrus bergylta V849 ighv FKLU01003746.1 2993 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYFTAWIRQPAGKGLEWIGSGAGSTRYYQDSLKNQFSIDLDSSSNRVTLNGLNMQTADTAVYYCARDPQ
Labrus bergylta V848 ighv FKLU01003746.1 10281 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAYISTSSSYISYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V847 ighv FKLU01003746.1 14996 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYHTAWIRQPAGKGLELIGMRSTGYTYYKDSLKNQFSIDLDASRKDALNGLNMQPADTAVYYCARDPQ
Labrus bergylta V846 trav FKLU01003742.1 6065 LGSMNSINPERTEEKVEEGGNINLTCTYDGRINNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKIVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V845 trav FKLU01003691.1 11363 LGSMNSINPETTEEKVEEGGNINLTCTYDGFITNIQWYRENQRSRPEFLLYITEGGTIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V844 trav FKLU01003691.1 12619 EDRVIQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V843 trav FKLU01003691.1 15346 EDRVIQPTEDVFASEGDTVTLDCTFETTRTSPTLFWYRQKCNDFPRYMLKSYSDKAEKASEFQTDRFNAAINGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V842 ighv FKLU01003691.1 16414 KIYPAVDEVRGTEGESVTLRCNYETTSDYVYLYWYRHHSDLQAPQFILWKGARDYSNREYIPDKRYESQTSSSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V841 igkv FKLU01003681.1 15348 SRGQVTVTQPAAVSSALGASVSISCTTSQNVYNNDYLAWYQQKDGGTPKLLIYFASTPASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHSISSQYV
Labrus bergylta V840 trav FKLU01003660.1 1932 LGSMNSINPETTEEKVEEGGNINLTCTYDGLIKNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V839 trav FKLU01003660.1 3200 DRVIQPTEDVFASEGDTVTLGCTFETTDPYPNLFWYRQKMGDFPKYMLRCYSKDINKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCAVK
Labrus bergylta V838 trav FKLU01003660.1 8300 RVILPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V837 igkv FKLU01003632.1 6760 QVTVTQPAAVRSDLGASVTVSCRTSKDVTTTNSKPYLAWYQQKDGGTPKLLIYDGSTRVSGTSSRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Labrus bergylta V836 igkv FKLU01003632.1 18091 QVTVTQSAAVRSALGASVTVSCRTSEDVDTTDDDEPYLAWYQQKDGGTPKLLIYLGSTRVSGTSSRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Labrus bergylta V835 ighv FKLU01003629.1 4430 KIYPAVDEVRGTEGESVTLRCNYETTYDGVDLYWYRHHSDLQAPQFILWKGARSSSDSKYIPDKRYESQTSSSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V834 trav FKLU01003629.1 6292 SSEELVTPFREVMMAVDGDDVTLSCNYSGSVTNLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V832 trav FKLU01003629.1 8321 IQPTEDVFASEGDTVTLGCKFETSTTPYLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDAAVYYCALR
Labrus bergylta V831 trav FKLU01003629.1 9692 EVRVIQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V830 trdv FKLU01003629.1 14236 QQLDKIYPTVDEVRGTEGESVTLRCNYETTDDDVYLYWYRHHSDLQAPQFILLKGAISRSYEYIPDKRYESQTSPSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V829 trav FKLU01003588.1 4999 IQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V828 ighv FKLU01003588.1 12112 KIYPAVDEVRGTEGESVTLRCNYETTDNDVYLHWYRHHSDLQAPQFILLKGARSRSGEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V827 trav FKLU01003588.1 13159 IQPTEDVFASEGDTVTLDCKVETTDTTLYLFWYRQEMGNFPKYLWKSYVGISENAPGISRERFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V826 trav FKLU01003588.1 15370 LGSMNSINPETTEEKVEEGGNINLTCTYDGLIYNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V824 trav FKLU01003542.1 2867 LGSMNSINPERTEEKVEEGGNINLTCTYDGVIDNIQWYRENQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V823 trdv FKLU01003542.1 4126 IQPTEDVFASEGDTVTIDCKFETTDTAPSLFWYRQEMDDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLSDSPVYYCALQ
Labrus bergylta V822 trav FKLU01003542.1 10926 LGSMNSINPETTEEKVEEGGNINLTCTYDGLIQNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V821 trav FKLU01003542.1 11900 EDRVIQPTEDVFASEGDTVTLDCQFETSTAPYLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V897 trav FKLU01004365.1 9092 LGSMNSINPETTEEKVEEGVNINLTCTYDGVINNIQWYRQNQRSRPEFLLYITEGGLIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V896 trav FKLU01004365.1 10361 RVIQPTEDAFASEGDTVTLGCTFETTNPYPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V895 trav FKLU01004365.1 16451 EDRVIQPTEDVFASEGDTVTLDCKVETISTPCILFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V894 trav FKLU01004332.1 6046 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V893 trav FKLU01004324.1 174 LGSMNSINPETTEEKVEEGGNINLTCTYDGRIQNIQWYRENQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V892 trav FKLU01004324.1 8996 IQPTEDVFASEGDTVTLDCKVETTDTTLYLFWYRQEMGDFPKYLWKSYVGISENAPGISGDRFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V891 trav FKLU01004324.1 11199 LGSMNSINPETTEEKVEEGGNINLTCTYDGLIYNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V890 trav FKLU01004302.1 2173 RVILPTEDVFASEGDTVTLGCTFETTNPNPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNATINGTSVPMKIQKLQLTDSAVYYCAVK
Labrus bergylta V889 trav FKLU01004302.1 8993 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAALTDSAVYYCAL
Labrus bergylta V888 igkv FKLU01004212.1 2264 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVYNSNHYLAWYQQKDGGTPKLLIYFASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V887 igkv FKLU01004212.1 4874 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYYSSYHYLAWYQQKDGGTPKLLIYLASSRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V886 igkv FKLU01004212.1 11970 SRGQVTVTQPAAVTSALGASVSISCRTSQDVYVYSSSHCLAWYQQKDGGTPKLLIYYASSRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V885 igkv FKLU01004212.1 13547 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVGAYLNWYLQKPGEAPKLLIYYSTNRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSSP
Labrus bergylta V883 ighv FKLU01004182.1 7722 VHCIDLITPGSMVVQPGQTLTLTCQVSGYSLTDSSHATGWIRQREGKPMDWISHQRGGSSGSFYQNNALKNKFSYSRDTSARTMTLTGQSLQPEDTAVYYCVRD
Labrus bergylta V882 ighv FKLU01004182.1 9811 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGRSWIHRFYKDSLKNQFSINFDSSRKIATLNGQNMQPADTAVYYCARE
Labrus bergylta V881 ighv FKLU01004182.1 16628 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGMRSLDTLYKDSLKNQFSIDLDSSRKTATLNGLNMQPADSAVYYCARER
Labrus bergylta V880 ighv FKLU01004084.1 8652 KIYPEVDEIRGTEGESVTLRCNYETTEQIVYLYWYRHHSDLQAPQFILWKGARSRSDRKYIPDERYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V879 trav FKLU01004084.1 10794 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQHLIGGYSEKTEKLSARHDKQSKEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V878 trav FKLU01004084.1 12745 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAVLTDSAVYYCALKPTVTGN
Labrus bergylta V877 trav FKLU01004059.1 3377 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAVLTDSAVYYCALKPTVTGN
Labrus bergylta V876 trav FKLU01004059.1 7805 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFEIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V875 trav FKLU01004059.1 9842 DRVIQPTEDVFASEGDTVTLGCTFETTDPYPNLFWYRQKVGDFPKYILRCYSKDINKAPEFRTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V874 trav FKLU01004059.1 16527 DRVIQPTEDVFASEGDTVTLDCTFETTRTSPTLFWYRQKCNDFPRYMLKSYSDNAEKASEFQTDRFNAAINGTSVPLKIQKLQLTDSAVYYCALK
Labrus bergylta V873 trav FKLU01004034.1 3651 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAALTDSAVYYCALRPTVTG
Labrus bergylta V872 trav FKLU01004034.1 8023 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAALTDSAVYYCALQPTVTGN
Labrus bergylta V871 trav FKLU01004034.1 9736 RVIQPTEDVIAYEGDTVTLGCTFETITQNPSMFWYRQEIVDFPKYMFRCYLKQVYKAPEFQTDRFKPAINGTSVPLKIQKLQLTDSAVYYCALKPTATGN
Labrus bergylta V870 trav FKLU01004013.1 5473 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQYPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNKERNCVDLQISSAVLTDSAVYYCALKPTVTGN
Labrus bergylta V869 trav FKLU01004013.1 6365 LGSMNSINPERTEEKVEEGGNINLTCTYDGQIYNIQWYRQNQRSRPEFLLYITEGGSIHPIDSHFSAYINKTEKRVNLEISSAALTDSAVYYCALKPTVTG
Labrus bergylta V868 ighv FKLU01004013.1 9859 KIYPTVDEVRGTEGESVTLRCNYETTDDYVILYWYRHHSDLLAPQFILRKGARSNSGSQYIPDKRYESQTSSSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V867 trav FKLU01004013.1 11729 DRVIQPTEDVFASERDTVTLDCTFETTDTNPFLFWYRQEAGDFPKYMLRCYSNKAENAPGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALK
Labrus bergylta V866 igkv FKLU01003995.1 10938 SRGQVTVTQPAAVSSALGASVSISCRTSQNVHVYNSNHYLAWYQQKDGGTPKLLIYLASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHSISSQYV
Labrus bergylta V865 trav FKLU01003964.1 979 IQPTEDVFASEGDTVTLDCQFETSTTLYLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALRPKVTG
Labrus bergylta V864 trav FKLU01003964.1 4052 EDRVIQPTQDAFASEGDTVTIDCQFETSTTPSLFWYRKEMGDFPKYMWKSYAGSSENAPGFSEDRFNVTINGTSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V863 ighv FKLU01003964.1 5115 KIYPAVDEVRGTEGESVTLTCNYETTDDDVFLYWYRHHSDLQAPQFILWKGARDLNSYEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V862 trav FKLU01003964.1 7500 LGSMNSINPEATEEKVEEGGNINLTCTYDGLINNIQWYRENQRSRPEFLLYITEGGLIHPTDSDFSAYINKTEKRVNLQISSAALTDSAVYYCALRPTVTG
Labrus bergylta V861 trav FKLU01003964.1 8756 EDRVIQPTEDVIASEGDTVTLDCKVETILTTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V860 igkv FKLU01003903.1 5265 SRGQVTVTQPAAVSSALGASVSISCRTSQDVFYSSPYHYLAWYQQKDGGTPKLLIYVASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V936 trav FKLU01005114.1 8647 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAALTDSAVYYCALKPTVTGN
Labrus bergylta V934 trav FKLU01004833.1 7463 LGSMNSINPETTEEKVEEGRNINLTCTYDGRIQNIQWYRQNQRSRPEFLLYITEGGTIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALKPTVTG
Labrus bergylta V933 trav FKLU01004833.1 8693 LGSMNSINPERTEEKVEEGGNINLTCTYDGRIQNIQWYRQNQRSRPEFLLYITEGGTIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALKPTVTG
Labrus bergylta V932 ighv FKLU01004739.1 2152 VRSQTLTESEPVVKSPGESHKLTCTYTGISDSSADISWIRQAEGKGLEWVSHISAPSGSTKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARD
Labrus bergylta V931 ighv FKLU01004739.1 6367 QTLTKSEEVVKRPGESHRLTCSASGFTFSSYNMNWVRQAPGKGLEWIAWVERDNDRKFYSQSVKGQFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V930 ighv FKLU01004739.1 7612 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISYQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V929 trav FKLU01004739.1 8896 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGSGYQSYRFYKDSLKNQFSIDLDSSSNRVTLNGLNMQPADSAVYYCARD
Labrus bergylta V928 ighv FKLU01004739.1 10110 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSVTDNSYATGWIRQREGKPMDWICHRLGGGSFYQNNALKNKFSYRTDTSARTVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V927 ighv FKLU01004739.1 11344 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMNWVRQAPGKGLEWIAIIKYDSGEIYYSNSVKSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V926 ighv FKLU01004739.1 12742 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAEISSSGGSSQYYSNSVKSRFTISRDNSRQQLYLQMNSLQTADTAVYYCARD
Labrus bergylta V925 ighv FKLU01004739.1 13892 TEGQTLTESDAVVKRPGESHTLTCTYSGFSSHPHNAWIRQAAGKGLEWVAYISSGGSIYYSNSVKGRFTISRDNSRQQVFLQMNSLTMEDSAVYYCAREP
Labrus bergylta V924 ighv FKLU01004737.1 3194 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSYISAPSGSNKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCAR
Labrus bergylta V923 trav FKLU01004737.1 5528 VWSEIRLEQSPSEVKRPGETVKMSCIISGFDMTSDYIHWIRQKPGRALEWIGRMDAGSNSASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCARD
Labrus bergylta V922 trav FKLU01004737.1 6961 VWSEIRLEQSPSEVKRPGETVKMSCIISGYSMTSYNIHWIRQKPGRALEWIGWMNTGDNAASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCARQ
Labrus bergylta V921 trav FKLU01004714.1 275 LGSMNSINPETTEEKVEEGGNINLTCTYDGVINNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALS
Labrus bergylta V920 trav FKLU01004714.1 8138 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAALTDSAVYYCALSPQ
Labrus bergylta V919 trav FKLU01004644.1 2814 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAALTDSAVYYCALKPTVTGN
Labrus bergylta V918 trav FKLU01004644.1 3702 IQPTQDVFASEGDTVTLDCKVETTDTAPSLFWYRQEMGDFPKYLWKSYVGISENAPGISGDRFKATTNGTSVPLKIQKLQLTDSAVYYCAVRPTVTG
Labrus bergylta V917 trav FKLU01004644.1 6121 EDRVIQPTDVFASEGDTVTLDCKFETTDTAPSLFWFRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V916 trav FKLU01004633.1 922 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIVADIILQIYKDSLKNQFSIDLDSSSNRVTLNGLNMQPADSAVYYCARD
Labrus bergylta V915 ighv FKLU01004633.1 3356 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMNWVRQAPGKGLEWIAIIKYDSGEIYYSNSVKSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V914 ighv FKLU01004633.1 5904 TEGQTLTESDAVVKRPGESHTLTCTYSGFSSHPHNAWIRQAAGKGLEWVAYISSGGSIYYSNSVKGRFTISRDNSRQQVFLQMNSLTMEDSAVYYCAREP
Labrus bergylta V913 ighv FKLU01004633.1 6794 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGWRYTGGTHYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V912 ighv FKLU01004633.1 8794 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISISGEVWSFYQNNALKNKFSYSRDTSARAVTLTGQSLQPEDTAVYYCVRD
Labrus bergylta V911 ighv FKLU01004633.1 11988 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYYMAWVRQAPGKGLEWIARISNGGGSSQYYSNSVKGRFTISRDNSRQQLYLQMNSLKTADTAVYYCARD
Labrus bergylta V910 ighv FKLU01004625.1 8058 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSHISAPSGSNKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCAR
Labrus bergylta V909 trav FKLU01004625.1 11826 VWSEIRLEQSPSEVKRPGETVKMSCIISGYSMTSYNIHWIRQKPGRALEWIGWMNTGNNAASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCARQ
Labrus bergylta V908 ighv FKLU01004625.1 15664 VKAQTLIESEAVVKRPGESHRLTCSASGFTFSSYHMSWVRQAPGKGLEWISWVENDNDRKFYSQSVKSRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V907 igkv FKLU01004546.1 5847 SRGQVTVTQPAAVTSALGASVSISCRTSQDVYGSSPYHRLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHVISSQWV
Labrus bergylta V906 igkv FKLU01004459.1 13163 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVYSSNHLLAWYQQKDGGTPKLLIYYASSRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V905 trav FKLU01004410.1 3365 DRVIQPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V904 trav FKLU01004410.1 10649 IQPTEDVFASEGDTVTLDCQFETSTAPYLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLSDSAVYYCALR
Labrus bergylta V903 trav FKLU01004410.1 12057 IQPTEDVFTSEGDTVTLDCKFETSTTPYLFWYRQEMGEIPRYLWRGNAGFSENAPGISGDRFKATINGTSILLKIQKLQLTDSAVYYCALR
Labrus bergylta V902 ighv FKLU01004410.1 16136 KIYPAVDEVRGTEGESVTLRCNYETTDDDVYLHWYRHHSDLQAPQFILWKGARDYSDQEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V901 ighv FKLU01004390.1 2925 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYHTAWIRQPAGKGLELIGMRSTGYTYYKDSLKNQFSIDLDASRNRVTLNGLNMQPADTAVYYCARDPQ
Labrus bergylta V900 ighv FKLU01004390.1 4883 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWISHQWGGSSGSFCQNNALKNKFSYSRDTSAGTVTLTGQSLQPEDTAVYYCVRR
Labrus bergylta V899 ighv FKLU01004390.1 5545 VDGQTLTQSEAVVKRPGESHRLTCYAYGFTMSSYWMAWVRQAPGKGLEWITTISNGGGSIYYSNSVRSWFTISRDDSRQQLYLQMNSLKTEDTAVYYCARD
Labrus bergylta V975 trav FKLU01006189.1 8518 RVILPTEDVFASEGDTVTLGCTFETTNPNPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNATINGTSVPMKIQKLQLTDSAVYYCAVK
Labrus bergylta V974 trav FKLU01006189.1 12145 IQPTQDVFASEGDTVTFDCQFETSTTPSLFWYRQKMGEIPRYLWRGNAGFSENAPGISGDRFKATINRTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V973 igkv FKLU01006075.1 12894 QVTVTQPAAVRSALEASVTVSCRTSEDVATTGGKPFLAWYQQKDGGTPKLLIYYGSTRVSGTSSRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Labrus bergylta V972 trav FKLU01005950.1 3317 EDRVIQPTEDVFASEGDTVTLDCKFETSTTPYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V971 ighv FKLU01005950.1 7110 KIYPAVDEVSGTEGESVTLRCNYETTYDDVYLYWYRHHSDLQAPQFILRKGARDYSNYEYIPDKRYESQTSPSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V970 trav FKLU01005950.1 11695 SSEELVTPFREVMMAVDGDDLTLSCNYSGSANYLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V969 ighv FKLU01005944.1 7145 KIYPAVDEVRGTEGESVTLRCNYETTSEYVYLYWYRHHSDLQAPQFILWKGARYYSDEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V968 trav FKLU01005907.1 3470 EDRVIQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V967 trav FKLU01005861.1 618 IQPTEDVFASEGDTVTLDCKVETISTTPSLFWYRQEMGDFPKYLWKSYGSFSENAPGISMTDLMQNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V966 trav FKLU01005861.1 4936 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAVLTDSAVYYCALKPTVTGN
Labrus bergylta V965 trav FKLU01005861.1 5839 IQPTEDVFASEGDTVTLDCKVETTDTTLYLFWYRQEMGDFPKYLWKSSVGISENAPGISGERFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V964 ighv FKLU01005838.1 287 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSSYDMNWVRQAPGKGLEWIAWVENDNDRKYYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V963 ighv FKLU01005838.1 2303 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSSYHMNWVRQAPGKGLEWIAWVENDNDRKYYSQSVKSRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V962 igkv FKLU01005762.1 4555 SRGQVTVTQPAALTSALGASVSISCRTSQNVHVYNSNHLLAWYQQKDGGTPKLLIYFASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V961 igkv FKLU01005762.1 7432 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYNNNYLAWYQQKDGGTPKLLIYLASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHSINSQHV
Labrus bergylta V960 igkv FKLU01005745.1 8765 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVGAYLHWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQ
Labrus bergylta V959 igkv FKLU01005679.1 12499 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYVYNSYHCLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTFSGVQTEDAAVYYCQSFHVINSQYV
Labrus bergylta V958 ighv FKLU01005675.1 8628 VRSQTLTESEPVVKSPGQSHKLTCTYTGISDSSADISWIRQAEGKGLEWVSHISAPSGSTKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCAR
Labrus bergylta V957 ighv FKLU01005675.1 14065 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V956 trav FKLU01005641.1 6991 HSDSACSMTSALGASVSISCRTSQNVYVYNSNHLLAWYQQKDGGTPKLLIYFASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHEINSQAV
Labrus bergylta V955 trbv FKLU01005594.1 1875 VSHSNDVNQTPPSIFKRINESVTGEIKCSHNITNYDRILWYKQDAHRALKLLGVLNVQHVNLEPDVKGKINFDGDGREKSSLSVSNLSLTDSGVYFCAAS
Labrus bergylta V954 ighv FKLU01005588.1 3741 KIYPAVDEVRRTEGESVTLRCNYETTDDDVDLYWYRHHSDLQAPQFILWKGARSRSGSQYIPDKRYESQTSRSSTELTIRKLTSEDTALYYCALE
Labrus bergylta V953 trav FKLU01005588.1 9474 CMAQKDNVLQPEGDVTATEGEAVTLGCQYNSSSSNYYLYWYKQDGNNSPKFIMSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V952 trav FKLU01005588.1 10267 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQLLIGGYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALK
Labrus bergylta V951 ighv FKLU01005519.1 4555 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGQRVGSTIYYKDSLKNQFSIDIDASRNTATLNGQNMQPADTAVYYCARD
Labrus bergylta V950 trav FKLU01005486.1 5479 SSEELVTPFREVMMAVDGENVTISCNYSGSANYLYWYQQKSGSSPQLFIGGYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALR
Labrus bergylta V949 trav FKLU01005486.1 9072 IQPTEDVFASEGDTVTLDCKVETTDTAPSLFWYRQEMGDFPKYLWKSYVGISENAPGISGDRFKATTNGTSVPLKIQKLQLTDSAVYYCAVR
Labrus bergylta V947 trav FKLU01005406.1 8319 VWSEIRLEQSPSEVKRPGETVKMSCIISGFDMTSDYIHWIRQKPGRALEWIGWMSTGSNSASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCARE
Labrus bergylta V946 ighv FKLU01005406.1 11380 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCAR
Labrus bergylta V945 igkv FKLU01005314.1 6790 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVSTYLNWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGNSSP
Labrus bergylta V944 trav FKLU01005251.1 6600 RVILPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALS
Labrus bergylta V943 trav FKLU01005241.1 8303 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAVLTDSAVYHCALRPTVTG
Labrus bergylta V942 trav FKLU01005241.1 14752 DRVIQPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALS
Labrus bergylta V941 igkv FKLU01005151.1 9743 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYVSNRLAWYQQKDGGTPKLLIYLASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHVINSQWV
Labrus bergylta V940 igkv FKLU01005127.1 6879 SRGQVTVTQPAAVTSALGASVSISCRTSQDVYVYSSSHCLAWYQQKDGGTPKLLIYYASSRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V939 igkv FKLU01005127.1 8459 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVGAYLNWYLQKPGEAPKLLIYYSTNRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSSP
Labrus bergylta V938 ighv FKLU01005114.1 592 KIYPAVDEVRGTEGESVTLRCNYETTDQKVYLHWYRHHSDLQAPQFILLKGARDYSDEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1014 trbv FKLU01007007.1 6806 SSSSDQVHQTPRDIYSKPGEPARIQCSHQIQGYNVILWYKKSNKQMQLLGYMFTTTSNPEKDVKVKMEGDASKGENCTLIIERVNQNSSAVYFCAAS
Labrus bergylta V1013 trbv FKLU01007007.1 8562 LSKSHVDQKPAALVIHPGEKVQLTCNHSNSNFDMIQWYKQSKGKHDMALLGYVRYSSATVEDQFKGLYNVSGDGKNQSSLILLKLSGSESAVYFCAASE
Labrus bergylta V1012 igkv FKLU01007003.1 4211 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVSTYLNWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGNSSP
Labrus bergylta V1011 igkv FKLU01006986.1 6799 QVTVTQPAAVSSALGASVSISCRTSQNVYNNNFLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFISTVRMC
Labrus bergylta V1010 igkv FKLU01006984.1 4666 SRGQVTVTQPAAVTSALGASVSISCRTSQDVYNSNRLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHVINSQYV
Labrus bergylta V1009 trav FKLU01006903.1 1017 DRVIQPTEDVFASERDTVTLDCTFETTDTNPFLFWYRQEAGDFPKYMLRCYSNKAENAPGISEDRFKAAINGTSIPLKIQKLQLTDSAVYYCALK
Labrus bergylta V1008 trav FKLU01006903.1 3055 SSDELVTPFREVMMAVDGDDVTLSCNYSGSANYLCWYQQKSGSSPQLLIGGYSEKTEKLSTRHDKQSKEFHLEISSAALTDSAVYYCALR
Labrus bergylta V1007 trav FKLU01006903.1 4121 LGSMNSINPETTEEKVEEGGNINLTCTYDGVINNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLQISSAALTDSAVYYCALKPTVTG
Labrus bergylta V1006 trav FKLU01006903.1 5076 IQPTQDVFASEGDTVTLDCKVETSTTPYFSWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1005 trav FKLU01006903.1 7098 RVIQPTEDVFTSEGDTVTLDCTFETTRTSPTLFWYRQKCNDFPRYMLKSYSDNAEKAPEFQTDRFNAAINGTSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V1004 trav FKLU01006903.1 9219 IQPTEDVFASEGDTVTLDCKVETISTTPSLFWYRQEMGDFPTYLWKSYAGSSENAPGISEDRFNVTINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1003 trav FKLU01006828.1 1461 IQPTEDVFASEGDTVTLDCKVETTDTTLYLFWYRQEMGDFPKYLWKSYVGISENAPGISGDRFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1002 ighv FKLU01006828.1 8723 KIYPAVDEVRGTEGESVTLRCNYETTYDDVYLYWYRHHSDLQAPQFILWKGARDYSNYEYIPDKRYESQTSPSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1001 igkv FKLU01006811.1 9706 SRGQVTVTQPAAVSSALGASVSISCRTSQNVFYSSPYHYLAWYQQKDGGTPKLLIYVASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V1000 igkv FKLU01006811.1 11817 SSGDILLTQTPGSQSVVLGQTVSIRCKPAQVLVLIHWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGYSSP
Labrus bergylta V999 ighv FKLU01006804.1 1263 KIYPAVDEVRGTEGESVTLRCNYETTDDGVYLYWYRHHSDLQAPQFILLKGAKRSSDEEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V998 trav FKLU01006804.1 2582 NTLEDDITASSAEVFSSEGHSVTRSCKYSVKADNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAVLTDSAVYYCALQPTVTGN
Labrus bergylta V997 trav FKLU01006804.1 3489 DRVIQPTEDVFASEGDTVTLGCTFETITQNPSMFWYRQEMGDFPKYMLRCYSKDVYKASEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V996 trav FKLU01006804.1 11646 DRVIQPTEDVFASEGDTVTLDCTFETTRTSPTLFWYRQKCNDFPRYMLKSYSDKAEKASEFQTDRFNAAINGTSVPLKIQKLQLTDSAVYYCAL
Labrus bergylta V995 trav FKLU01006756.1 3258 CKGEDRVILPTEDVFASERDTVTLDCKFETTDTNPFLFWNREEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALRPTVTG
Labrus bergylta V994 trav FKLU01006696.1 726 CMAQTDNVLQPEGDMTATEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALRPTVTG
Labrus bergylta V993 trav FKLU01006696.1 1518 IQPTEDVFASEGDTVTLDCKVETTDTTLYLFWYRQEMGDFPKYLWKSYVGISENAPGISGERFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V992 trav FKLU01006696.1 3721 LGSMNSINPETTEEKVEEGGNINLTCTYDGQIQNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V991 trav FKLU01006696.1 4971 EDRVIQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V990 trav FKLU01006420.1 2141 RVIQPTEDAFASEGDTVTLGCTFETTNPYPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V989 trav FKLU01006420.1 4783 IQPTEDVFASEGDTVTLDCKVETTDTTLYLFWYRQEMGNFPKYLWKSYVGISENAPGISRERFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V988 trav FKLU01006420.1 6990 LGSMNSINPETTEEKVEEGGNINLTCTYDGQSNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V987 trav FKLU01006372.1 2830 IQPTEDVFASEGDTVTLGCKFETSTTPYLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDAAVYYCALR
Labrus bergylta V986 trav FKLU01006372.1 4206 EVRVIQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V985 ighv FKLU01006372.1 8760 KIYPTVDEVRGTEGESVTLRCNYETTDDDVYLYWYRHHSDLQAPQFILLKGAISRSYEYIPDKRYESQTSPSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V984 trav FKLU01006372.1 10613 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAVLTDSAVYHCALRPTVTG
Labrus bergylta V983 trav FKLU01006303.1 3217 NVLQPEGDVTATEGEAVTLGCQYNSSLSNEYLYWYKQDGNNSPKFILSRFKFGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCAVR
Labrus bergylta V982 trav FKLU01006303.1 6986 DRVIQPTEDVFASEGDTVTLGCTFETTDPYPNLFWYRQEMGDFPKYMLRCYSKDINKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALK
Labrus bergylta V980 trav FKLU01006287.1 9379 DRVIQPTEDVFASEGDTVTLGCTFETITQNPSMFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V979 trav FKLU01006189.1 3406 NVLQPEGDVTATEGEAVTLGCQYNSSLSNEYLYWYKQDGNNSPKFILSRFKFGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V978 trav FKLU01006189.1 4174 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQHLIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V977 trav FKLU01006189.1 6355 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQYPGSAPQFLLLITDTSDPTVVTGKPPHPRLTVKLNKDKKHLDLQISSAALTDSAVYYCALQPTVTGN
Labrus bergylta V1053 ighv FKLU01007774.1 5390 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSSYDMNWVRQAPGKGLEWIAWVENDNDRKYYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V1052 trav FKLU01007668.1 3507 SSEELVTPFREVMMAVDGENVTISCNYSGSVNYLYWYQQKSGSSPQLLIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V1051 trav FKLU01007668.1 4588 RVIQPTEDVIASERDTVTLDCTFETTDTNPFLFWYRQEAGDFPKYMLRCYSNKAENAPGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1050 trav FKLU01007668.1 6630 DRVIQPTEDVFASEGDTVTLDCTFETTRTSPTLFWYRQKCNDFPRYMLKSYSDNAEKASEFQTDRFNAAINGTSVPLKIQKLQLTDSAVYYCAVK
Labrus bergylta V1049 ighv FKLU01007668.1 9227 KIYPAVDEVRGTEGESVTLRCNYETTTDYVDLYWYRHNSDLQAPQFILWKGARSSGSQYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1048 igkv FKLU01007614.1 4264 QVTVTQSAAVRSALGASVTLSCRTSEDVETTLDEPELAWYQQKDGGTPKLLIYDGSTRESGISDRFTGSGSNSDFTLTISGVQTEDAAVYYCQSFISSTVSLC
Labrus bergylta V1047 igkv FKLU01007614.1 8146 SRGQVSVTQSAAVISALGASVTLSCTTSEDVETTPLGEPLLAWYQQKDGGTPKLLIYDGSTQESGTSDRFTGSGSNSDFTLTISGVQTEDAAVYYCQSYHSINSQDV
Labrus bergylta V1046 trbv FKLU01007613.1 5638 TSVTFQPSHPKVVVEKARVEFNCSHNDENLNVMLWYQQTQSGLMDLIGYGYTSSEPDYEEKFKDRFKMTKKDVTTGALIIPSVTPSDSAVYFCAAR
Labrus bergylta V1045 trbv FKLU01007613.1 6194 QACAVTFVKFDPQIVQKDIAVEIKCSHNDTSLVNMLWYQQRKGGTSLTLIGYGYESSPTYEGQFEEQFKLTRDGPEKGALIISKAQPSHSAVYFCAAS
Labrus bergylta V1044 trbv FKLU01007613.1 8752 VSQSVLITQWPQIISRHPNGSAEMHCYQNETDYPYLYWYRQLRGQSFQLMVMVSAGSATFEEDFKSGYQAVRQKKEEKQWSLSIESVQRKDEAVYLCAAS
Labrus bergylta V1043 trav FKLU01007599.1 3311 LGSMNSINPERTEETIEEGGNINLTCTYDGLIYNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAVLTDSAVYYCALK
Labrus bergylta V1042 trav FKLU01007599.1 6359 LGSMNSINPETTEEKVEEGGNINLTCTYDGPIQNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V1041 igkv FKLU01007563.1 7119 SRGQVSVTQPAAVISALGASVTVSCRTSEDVATTNDDEPLLAWYQQKDGGTPKLLIYYGSNRVSGTSSRFTGSGSNSDFTLTISGVQTEDAAVYYCQSYHISTVSC
Labrus bergylta V1040 trbv FKLU01007496.1 8407 QACAVTFVKFDPQIVQKDIAVEIKCSHNDTSLVNMLWYQQRKGGTSLTLIGYGYESSPTYEGQFEEQFKLTRDGPEKGALIISKAQPSHSAVYFCAAS
Labrus bergylta V1039 trbv FKLU01007496.1 10964 VSQSVLITQWPQIISRHPNGSAEMHCYQNETDYSYLYWYRQLRGQSFQLMVMVSAGSATFEEDFKSGYQAVRQKKEEKQWSLSIESVQRKDEAVYLCAAS
Labrus bergylta V1038 igkv FKLU01007407.1 6411 SRGQVTVTQPAAVTSALGASVSISCRTSQDVFYSSPYHYLAWYQQKDGGTPKLLIYVASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V1037 igkv FKLU01007407.1 8524 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVSTNLHWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGYSFP
Labrus bergylta V1036 trav FKLU01007255.1 6446 LGSMNSINPETTEEKVEEGGNINLTCTYDGFIDNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSVYINKTEKQVNLEISSAALTDSAVYYCALKPTVTG
Labrus bergylta V1035 trav FKLU01007255.1 7717 DRVIQPTEDVFASEGDTVTLGCTFKTTDPNPNLFWYRQKMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1034 trav FKLU01007153.1 4348 EDRVIQPTEDVFASQGDTVTLDCKFETTDTTPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V1033 trav FKLU01007141.1 901 EDRVIQPTQDVFASEGDTVTLDCKFETSTTFYLFWYRQEMGEIPRYLWRGNAGFSENAPGISGKRFKATINGTSIPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V1032 ighv FKLU01007141.1 1962 LTAGDKIYPAVDEVRGTEGESVTLRCNYEATYQNVYLFWYRHHSDLQAPQFILWKGARSRSDEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1031 trav FKLU01007141.1 4087 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVHLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V1030 trav FKLU01007141.1 5666 IQPTEDVFASEGDTVTLDCKFETTDTTLYLFWYRQEMGDFPKYLWKSYVGISENAPGISGDRFKATTNGTSVPLKIQKLQLTDSAVYYCAVR
Labrus bergylta V1028 trav FKLU01007134.1 3833 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAVLTDSAVYYCALR
Labrus bergylta V1027 trav FKLU01007134.1 10432 NVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1026 igkv FKLU01007129.1 4802 SRGQVTVTQPAAVSSALGASVAISCRTSQNVYVYSSSHYLAWYQQKDGGTPKLLIYRASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHSINSQYV
Labrus bergylta V1025 igkv FKLU01007129.1 6087 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVSAYLHWYLQKPGEAPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSSP
Labrus bergylta V1024 trav FKLU01007109.1 1889 LGSMNSINPETTEEKVEEGGNINLTCTYDGLINNIQWYRENQRSRPEFLLYITEGGLIHPTDSDFSAYINKTEKRVNQISSAALTDSAVYYCALRPTVTG
Labrus bergylta V1023 trav FKLU01007109.1 3151 DRVIQPTEDVFASEGDTVTLDCKVETIITTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALK
Labrus bergylta V1022 ighv FKLU01007109.1 8456 KIYPAVDEVRGTEGESVTLTCNYETTEKYVILYWYRHHSDLQAPQFILWKGARDLESQEYIPDKRYESQTSSSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1021 trav FKLU01007016.1 5183 LGSMNSINPETTEEKVEEGGNINLTCTYDGVIDNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLQISSAVLTDSAVYYCAVK
Labrus bergylta V1020 trav FKLU01007016.1 7139 IQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCAVR
Labrus bergylta V1019 trav FKLU01007016.1 9151 LGSMNSINPETTEEKVEEGGNINLTCTYDGVITNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSVYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V1018 trav FKLU01007016.1 10135 IQPTEDVFASEGDTVTLDCQFETSTTPSLFWYKQEMGDFPKYLWKSYAGSSENALGISEDRFNVTINGKSVPLKIQKLQLTDSALYNCALR
Labrus bergylta V1017 trbv FKLU01007007.1 4491 SSSSDQVHQTPRDIYSKPGEPARIQCSHQIQSYDQILWYKKSNKQMQLLGYTYSTSSNTEKDVKVKIEGDASKGKNCTLIIERVNQSSSAVYFCAAS
Labrus bergylta V1016 trbv FKLU01007007.1 5240 SSNSDKVDQTPQDIFIKPGKDAKINCKHKIDNYDRILWYKQSNKQMQLLGYMFTTSSNPEKDVKVKMEGDANKGKNCTLIIERVNQNSSAVYFCAAS
Labrus bergylta V1072 ighv FKLU01007975.1 5479 KIYPAVDEVRGTEGESVTLTCNYETTDDDVFLYWYRHHSDLQAPQFILWKGARDLNSYEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1071 trav FKLU01007975.1 7865 LGSMNSINPEATEEKVEEGGNINLTCTYDGLINNIQWYRENQRSRPEFLLYITEGGLIHPTDSDFSAYINKTEKRVNLQISSAALTDSAVYYCALRPTVTG
Labrus bergylta V1070 trav FKLU01007975.1 9119 EDRVIQPTEDVFASEGDTVTLDCKVETIITTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V1069 trav FKLU01007961.1 2099 RVIQPTEDVFTSEGDTVTLDCTFETTRTSPTLFWYRQKCNDFPRYMLKSYSDNAEKAPEFQTDRFNAAINGTSVPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V1068 trav FKLU01007961.1 4208 IQPTEDVFASEGDTVTLDCKVETISTTPSLFWYRQEMGDFPKYLWKSYAGSSENAPGISEDRFNVTINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1067 trav FKLU01007961.1 8522 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNKERNRVDLQISSAVLTDSAVYYCALKPTVTGN
Labrus bergylta V1066 trav FKLU01007929.1 6990 LGSMNSINPETTEEKVEEGGNINLTCTYDGLIKNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V1065 trav FKLU01007904.1 2974 IQPTQDVFASEGDTVTIDCQFETSTTPYLFWYKQEMGDFPKYMWKSYAGSSENALGISEDRFNVTINGKSVPLKIQKLQVTDSAVYYCALR
Labrus bergylta V1064 ighv FKLU01007904.1 7587 KIYPAVDEVRRTEGESVTLRCNYETTDDGVDLSWYRHHSDLQAPQFILWKGARSRSGSQYIPDKRYESQTSSSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1062 ighv FKLU01007890.1 10331 VDGQTLTESEAVVKSPGESHRLTCSASGFTFSSHHMSWVRQAPGKGLEWIATISSGSGSSQYYSNSVKSRFTISRDDSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V1061 igkv FKLU01007813.1 6460 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYYSSPYHLLAWYQQKDGGTPKLLIYVASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V1060 ighv FKLU01007807.1 9137 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSYISAPSGSNKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARA
Labrus bergylta V1059 trav FKLU01007779.1 234 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAALTDSAVYYCALKPTVTGN
Labrus bergylta V1058 trav FKLU01007779.1 2740 LGSMNSINPETTEETIEEGGNINLTCTYDGLIKNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAVLTDSAVYYCALQ
Labrus bergylta V1057 trav FKLU01007779.1 6593 EDRVIQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V1056 ighv FKLU01007779.1 9449 KIYPAVDEVRGTEGESVTLRCNYETTTDYVDLYWYRHNSDLQAPQFILWKGARSSGSQYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1055 ighv FKLU01007774.1 1025 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKLSYSRDTSAATVTLTGQNMQPEDTAVYYCVRV
Labrus bergylta V1093 ighv FKLU01008699.1 4440 VHCIDLITPGLMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARE
Labrus bergylta V1092 ighv FKLU01008699.1 5870 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYATAWIRQPAGKGLEWIIVGRVGYNTDTKDSLKNQFSINFDSSSNTVTLNGQNMQPADTAVYYCARE
Labrus bergylta V1091 ighv FKLU01008697.1 1803 KIYPAVDEVRGTEGESVTLRCNYETTYDGVFLYWYRHHSDLQAPQFILWKGARSRSDRKYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1090 igkv FKLU01008634.1 3231 QVTVTQPAAVSSALGASVSISCRTSQDVHVYSSYHCLAWYQQKDGGTPKLLIYLASSRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHEISRQAV
Labrus bergylta V1089 igkv FKLU01008603.1 9964 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVSTYLHWYLQKPGEPPKLLIYYSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSFP
Labrus bergylta V1088 ighv FKLU01008440.1 5959 VRSQTLTESEPVVKSPGESHKLTCTYTGISDSSADISWIRQAEGKGLEWVSFISAPSGSDKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARD
Labrus bergylta V1087 trav FKLU01008440.1 7757 VWSEIRLEQSPSEVKRPGETVKMSCIISGFDMTSFYIHWIRQKPGRALEWIGWMSTGSNSASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCARD
Labrus bergylta V1086 igkv FKLU01008396.1 10137 SRGQVTVTQPAAVSSALGASVAISCRTSQNVYVYSSSHYLAWYQQKDGGTPKLLIYRASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHSINSQYV
Labrus bergylta V1085 trav FKLU01008351.1 3942 LGSMNSINPERTEEKVEEGGNINLTCTYDGQIQNIQWYRQNQRSRPEFLLYITEGGLVYKQVSYFSAHINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V1084 igkv FKLU01008179.1 8452 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYVYNSYHCLAWYQQKDGGTPKLLIYYASTRVSGIPGRFSGSGSNSAFTLTFSGVQTEDAAVYYCQSFHVINSQYV
Labrus bergylta V1083 igkv FKLU01008179.1 10597 DILPTQTPGSQSVVLGQTVSIRCQTSTSVGANLNWYLQKPGEAPKLLIYSSTNRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQYSSYP
Labrus bergylta V1082 trav FKLU01008130.1 2627 DRVIQPTEDVFASEGDTVTLGCTFETTDPYPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNAAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1081 trav FKLU01008122.1 4814 EDRVIQPTEDVFASEGDTVTLDCKFETIDTTPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V1080 ighv FKLU01008122.1 7034 KIYPTVDEVRGTEGESVTLRCNYETTDQNVYLYWYRHHSDLQAPQFILLKGAKRRSDEEYIPDERYESQTSPSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1079 trav FKLU01008122.1 8887 NTLEDDITASSAEVFSSESHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLIIDTSDPTVVTAKPPHPRLTVKLNKERNCVDLQISSAALTDSAVYYCALKPTVTGN
Labrus bergylta V1078 trav FKLU01008122.1 9779 LGSMNSINPETTEETVEEGGNINLTCTYDGLIQNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V1077 trav FKLU01008094.1 7336 LGSMNSINPETTEEKVEEGGNINLTCTYDGLINIQWYRQNQRSRPEFLLYITEGGTIHPTDSDFSSYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V1076 trav FKLU01008094.1 8602 IQPTEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWKGYAGLSQNALGISEDRFNATINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1075 trav FKLU01008043.1 2190 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCAVR
Labrus bergylta V1074 trav FKLU01007975.1 395 LGSMNSINPETTEEKVEEGGNINLTCTYDGLIQNIQWYRQNQRSRPEFLLYITEGGTIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V1131 trav FKLU01009681.1 836 DRVIQPTEDVFAYEGDTVTLGCTFETITQNPSMFWYRQEIVDFPKYMFRCYLKQVYKAPEFQTDRFKPAINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1130 trav FKLU01009681.1 3263 LGSMNSINPERTEEKVEEGGNINLTCTYDGVINNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V1129 ighv FKLU01009681.1 6727 KIYPAVDEVSGTEGESVTLRCNYETTSEDVFLYWYRHHSDLQAPQFILWKGARDYSNREYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1128 trav FKLU01009652.1 7550 NVLQPEGDVTATEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLTIQKLQLTDSAVYYCALR
Labrus bergylta V1127 igkv FKLU01009604.1 3844 QVTVTQPAAVSSALGASVSISCRTSQDVHVYSSYHCLAWYQQKDGGTPKLLIYLASSRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHEISRQAV
Labrus bergylta V1126 trav FKLU01009499.1 5858 NVLQPEGDVTATEGDAVTLGCQYNSSSSNYYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALSPQ
Labrus bergylta V1125 trav FKLU01009499.1 8518 CMAQKDNVLQPEGDVTATEGEAVTLGCQYNSSSSNYYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V1124 trav FKLU01009419.1 4041 LGSMNSINPETTEEKVEEGGNINLTCTYDGLIQNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALKPTVTG
Labrus bergylta V1123 trav FKLU01009419.1 5030 IQPTEDVFASEGDTVTLDCQFETSTTLYLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALR
Labrus bergylta V1122 ighv FKLU01009419.1 7481 KIYPAVDEVSGTEGESVTLRCNYETTYDDVYLYWYRHHSDLQAPQFILRKGARDYSNYEYIPDKRYESQTSPSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1121 ighv FKLU01009394.1 7479 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCAR
Labrus bergylta V1120 trav FKLU01009362.1 1072 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLITDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAVLTDSAVYYCALR
Labrus bergylta V1119 trav FKLU01009349.1 73 LGSMNSINPERTEEKVEEGGNINLTCTYDGQITNIQWYRQNQRSRPEFLLYITEGGTIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V1118 trav FKLU01009349.1 4433 IQPTEDVFASEGDTVTLDCKFETTDTAPSLFWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCAMR
Labrus bergylta V1117 ighv FKLU01009349.1 6912 KIYPAVDEVRGTEGESVTLTCNYETTDQKVYLHWYRHHSDLQAPQFILWKGARDYSNREYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1116 igkv FKLU01009286.1 4163 SSGDILLTQTPGSQSVVLGQTVSIRCKTSTSVGAYLHWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQVNSYP
Labrus bergylta V1115 trav FKLU01009262.1 6381 LGSMNSINPERTEEKVEEGGNINLTCTYDGVINNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V1114 igkv FKLU01009221.1 6493 QVTVTQPAAVRSALGASVTLSCRTSEDVDTTLDEPDLAWYQQKDGGTPKLLIYSGSTRESGTSDRFTGSGSNSDFTLTISGVQTEDAAVYYCQSYMISTVSMC
Labrus bergylta V1113 trav FKLU01009215.1 8556 DRVIQPTEDVFASEGDTVTLDCTFETTRTSPTLFWYRQKCNDFPRYMLKSYSDNAEKASEFQTDRFKAAINGTSVPLKIQKLQLTDSAVYYCALK
Labrus bergylta V1111 ighv FKLU01009008.1 43 KIYPAVNEVRGTEGESVTLRCNYETTDNDVYLHWYRHHSDLQAPQFILLKGARSRSGEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1110 trav FKLU01009008.1 1103 IQPTEDVFASEGDTVTLDCKVETTDTTLYLFWYRQEMGDFPKYLWKSYVGISENAPGISGERFKATTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1109 trav FKLU01009008.1 4280 CMAQKDNVLQPEGDVTATEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPKFILSRFKIGEGKTIKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYSALR
Labrus bergylta V1108 trav FKLU01008950.1 2105 NVLQPEGDVTATEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLTIQKLQLTDSAVYYCALR
Labrus bergylta V1107 trav FKLU01008950.1 2882 SSEELVTPFREIMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQHLIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALR
Labrus bergylta V1106 trav FKLU01008950.1 3971 LGSMNSINPETTEENVEEGGNINLTCTYDGQINNIQWYRQNQRSRPEFLLYITEGGLIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALR
Labrus bergylta V1105 trav FKLU01008950.1 9546 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAHQFLLLITDTSDPTVVTAKPPHPRLTVKLNKERNLVDLQISSAALTDSAVYYCALKPTVTGN
Labrus bergylta V1104 igkv FKLU01008867.1 8575 QVTVTQPAAVRSALGASVTLSCTTSKDVDTTGGKPYLAWYQQKDGGTPKLLIYYGSTRVSGTSSRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Labrus bergylta V1103 trav FKLU01008858.1 6397 LGSMNSINPERTEEKVEEGGNINLTCTYDGVINNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKKEKRVNLEISSAALTDSAVYYCALS
Labrus bergylta V1102 trav FKLU01008847.1 60 RVIQPTEDVFASEADTVTLGCTFETTNPYPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNATINGISVPMKIQKLQLTDSAVYYCALR
Labrus bergylta V1101 trav FKLU01008847.1 5745 RVILPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALS
Labrus bergylta V1100 ighv FKLU01008785.1 1312 VRSQTLTESEPVVKSPGESHKLTCTYTGISDSSADISWIRQAEGKGLEWVSFISAPSGSDKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARD
Labrus bergylta V1099 trav FKLU01008785.1 3102 VWSEIRLEQSPSEVKRPGETVKMSCIISGFDMTSFYIHWIRQKPGRALEWIGWMSTGSNSASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCARD
Labrus bergylta V1098 ighv FKLU01008785.1 6101 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKLSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V1097 ighv FKLU01008785.1 7484 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYSTAWIRQPAGKGLEWIILGRVGYNTDTKDSLKNQFSINFDSSSNTVTLNGLNMQPADTAVYYCARR
Labrus bergylta V1096 ighv FKLU01008770.1 1673 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSFISAPSGSTKSYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARD
Labrus bergylta V1095 ighv FKLU01008770.1 7037 VHCIDLITPGLMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARE
Labrus bergylta V1094 trav FKLU01008699.1 1384 VWSEIRLEQSPSEVKRPGETVKMSCIISGFDMTSDYIHWIRQKPGRALEWIGWMDAGRNSASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCAREDTA
Labrus bergylta V1170 trav FKLU01011264.1 5532 EDRVIQPTQDVFASEGDTVTLVCKVETISTTPSLFWYRQEMGDFPKYLWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V1169 trav FKLU01011181.1 5329 LGSMNSINPETTEEKVEEGGNINLTCTYDGQIYNIQWYRENQRSRPEFLLSITEGGSIHPTDSDFSAYINKMEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V1167 igkv FKLU01011145.1 1408 QVTVTQPAAVRSDLGASVTLSCTTSKDVDTTNSKPDLAWYQQKDGGTPKLLIYSGSTRESGTSDRFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Labrus bergylta V1166 ighv FKLU01011112.1 2968 VRSQTLTESEPVVKSPGESHKLTCTYTGISDSSADISWIRQAEGKGLEWVSFILLRVEAKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARD
Labrus bergylta V1165 trav FKLU01011091.1 1305 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQHDPGSAPQFLLLIIDTSDPTVMTAKPPHPRLTVKLNKERNRVDLQISSAVLTDSAVYYCALQPTVTGN
Labrus bergylta V1164 trav FKLU01011091.1 3185 DRVIQPTEDVFASEGDTVTLDCQFETSTTLYLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCAV
Labrus bergylta V1163 igkv FKLU01010998.1 2261 QVTVTQPAAVRSALGASVTLSCRTSEDVDTTLDEPDLAWYQQKDGGTPKLLIYSGSTRESGTSDRFTGSGSNSDFTLTISGVQTEDAAVYYCQSYMISTVSMC
Labrus bergylta V1162 trav FKLU01010978.1 4107 NVLQPEGDVTATEGEAVTLGCQYNSSSSNYYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALSPQ
Labrus bergylta V1161 trav FKLU01010978.1 4898 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQHLIGEYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V1160 trav FKLU01010978.1 7040 LCSMNSINPERTEEKVEEGGNINLTCTYDGVITNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V1159 trav FKLU01010946.1 2864 SSEELVTPFREVMMAVDGDDLTLSCNYSGSANYLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V1158 trav FKLU01010946.1 4691 LGSMNSINPETTEEKVEEGGNINLTCTYDGQIYNIQWYRENQRSRPEFLLSITEGGSIHPTDSDFSAYINKMEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V1157 trav FKLU01010946.1 5959 SSEELVTPFREVMMAVDGENATLSCKYSGSAKYLYWYQQKSGSSPQLLIGEYSEKIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALE
Labrus bergylta V1156 trav FKLU01010888.1 2760 DRVIQPTEDVFASEGDTVTLDCKFETTDTNPFLFWNRQEAGDFPKYMLRCYSNIAENAFGISEDRFKAAINGKSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1155 trav FKLU01010888.1 5457 RVIQPTEDVFASEGDTVTLDCTFETTRPSPTLFWYRQKCNDFPRYMLKSYSDNAEKASEFQTDRFNAAINGTSIPLKIQKLQLTDSAVYYCALE
Labrus bergylta V1154 igkv FKLU01010830.1 3946 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYNNNYLHWYQQKDGGTPKLLIYTASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V1153 igkv FKLU01010830.1 6641 SRGQVTVTQPAAVTSALGASISISCRTSQNVYNNNHLAWYQQKDGGTPKLLIYAASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHVISSQWV
Labrus bergylta V1152 igkv FKLU01010808.1 6566 SRGQVTVTQPAAVTSALGASVSISCRTSQNVYYSSPYHYLAWYQQKDGGTPKLLIYIASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHSINSQWV
Labrus bergylta V1151 trav FKLU01010679.1 5239 EDRVIQPTEDVFASEGDTVTLDCQFETSTAPYLFWYRQEMGDFPKYMWKGYGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V1150 trav FKLU01010671.1 4624 NVLQPEGDVTATEGEAVTLGCQYNSSSSNYYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALKSPQ
Labrus bergylta V1149 trav FKLU01010671.1 5420 SSEELVTPFREVMMAVDGDDVTLSCNYSGSVNNLYWYQQKSGSSPQHLIGGYSEKTEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQ
Labrus bergylta V1148 igkv FKLU01010605.1 5487 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYYSSPYHLLAWYQQKEGGTPKLLIYVASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V1147 igkv FKLU01010605.1 7058 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVSTYLNWYLQKPGEAPKLLIYSSTSRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGNSSP
Labrus bergylta V1146 trav FKLU01010399.1 1175 LGSMNSINPETTEEKVEEGGNINLTCTYDGFINNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V1145 igkv FKLU01010364.1 5477 SRGQVTVTQPAAVSSALGASVSISCRTSQDVYVYNSYHCLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTFSGVQTEDAAVYYCQSFHVINSQYV
Labrus bergylta V1144 igkv FKLU01010364.1 7614 DILPTQTPGSQSVVLGQTVSIRCQTSTSVGANLNWYLQKPGEAPKLLIYSSTNRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQYSSYP
Labrus bergylta V1143 trav FKLU01010332.1 5855 VWSEIRLEQSPSEVKRPGETVKMSCIISGFDMTSDYIHWIRQKPGRALEWIGWMDAGSNSASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCAREGQQ
Labrus bergylta V1142 trav FKLU01010259.1 7506 IQPTQDVFASEGDTVTIDCHLRLQQPLFVLVQTKMGDFPKYMWKSYAGSSENALGISEDRFNVTINGKSVPLKIQKLQVTDSAVYYCALR
Labrus bergylta V1140 ighv FKLU01010081.1 1590 KIYPAVDEVRGTEGESVTLRCNYETTYDDVYFHWYRHHSDLQEPQFILWKGAKRRSNYEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1139 trav FKLU01010020.1 4286 SSEELVTPFREVMMAVDGENVTLSCNYSGSANYLYWYQQKSGSSPQLLIGEYSEKIEKLSTRHDKQSNEFHLEISSAALTDSAVYYCALQPQ
Labrus bergylta V1138 ighv FKLU01010002.1 169 KIYPAVDEVSGTEGESVTLRCNYETTSEYVVLYWYRHHSDLQAPQFILLKGARSWSDEYIPDKRYESQTSRSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V1137 trav FKLU01010002.1 6241 LGSMNSINPETTEETIEEGGNINLTCTYDGFIDNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V1136 trav FKLU01010002.1 7229 DRVIQPKEDVFASEGDTVTLDCKVETISTTLYLFWYRQEMGDFPKYLWNSYVGISENAPGISGDRFKATRNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1135 trav FKLU01009958.1 864 IQPTEDVFASEGDTVTLVCKFETTDTAPSLLWYRQEMGDFPKYLWKSYGSFSGNAPGISDDRFKAAKNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V1134 trav FKLU01009958.1 5456 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAVLTDSAVYYCALSPQ
Labrus bergylta V1133 trav FKLU01009916.1 3010 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAALTDSAVYYCALSPQ
Labrus bergylta V1178 igkv FKLU01012034.1 2517 SRGQVTVTQPAAVSSALGASVSISCTTSQNVYNNDYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSFHTSAVSMC
Labrus bergylta V1177 trav FKLU01011800.1 5799 CMAQKDNVLQPEGDVTATEGEAVTLGCQYNSSSSNYYLYWYKQDGNNSPKFIMSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG
Labrus bergylta V1176 igkv FKLU01011656.1 5108 QVTVTQPAAVRSDLGASVTLSCTTSKDVDTTNSKPDLAWYQQKDGGTPKLLIYSGSTRESGTSDRFTGSGSNSDFTLTISGVQTEDAAVYYCQSYIIQSVC
Labrus bergylta V1175 trav FKLU01011408.1 3186 LGSMNSINPERTEEKVEEGGNINLTCTYDGVINNIQWYRQNQRSRPEFLLYITEGGTIHPTDSDFSAYINKTEKRVNLEISSAVLTDSAVYYCALS
Labrus bergylta V1174 trav FKLU01011408.1 4939 LGSMNSINPETTEEKVEEGGNINLTCTYDGVITNIQWYRENQRSRPEFLLSITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALQPTVTG
Labrus bergylta V1173 trav FKLU01011408.1 5928 RVIQPTEDVFASEGDTVTLGCTFETTNPYPNLFWYRQEMGDFPKYMLRCYSKDVYKAPEFQTDKFNATINGTSVPLTIQKLQLADSAVYYCALR
Labrus bergylta V1172 ighv FKLU01011355.1 2859 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSFAMSWVRQAPGKGLEWIAHINSGGQYYSNSVRSRFTISRDNSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V1073 trav FKLU01007975.1 1340 IQPTEDVFASEGDTVTLDCQFETSTTLYLFWYRQEMGDFPKYMWKGSGGFSENAPGISIERYKAAINGTSVPLTIQKLQLTDSAVYYCALRPKVTG
Labrus bergylta V1063 trav FKLU01007890.1 8446 VWSEIRLEQSPSEVKRPGETVKMSCIISGFDMTSDYIHWIRQKPGRALEWIGWMDAGSNSASYASSFQSRFSMTEDVPSSTQFLQIQTLTAADSAVYFCARD
Labrus bergylta V1054 ighv FKLU01007774.1 2401 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYSTAWIRQPAGKGLEWIILGRVGYNTDTKDSLKNQFSINFDSSSNTVTLNGLNMQPADTAVYYCARR
Labrus bergylta V1029 trav FKLU01007141.1 7890 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAVLTDSAVYYCALR
Labrus bergylta V1015 trbv FKLU01007007.1 6023 SSNSDKVDQTPRDIFIKPGKNAKMNCKHKIDNYNQILWYKQSNKQMQLLGYMFTTTSNPETDVKVKMEGDASKGKNCTLIIERVNQSSSAVYFCAAS
Labrus bergylta V981 trav FKLU01006287.1 8472 NTLEDDITASSAEVFSSEGHSVTRSCKYSVKADNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAVLTDSAVYYCALQPTVTGN
Labrus bergylta V976 trav FKLU01006189.1 7247 LGSMNSINPETTEEKVEEGGNINLTCRYDGVIDNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V948 ighv FKLU01005406.1 5989 VRSQTLTESEPVVKSPGESHKLTCTYTGISDGDAHISWIRQAEGKGLEWVSYISAPSGSNKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARD
Labrus bergylta V937 trav FKLU01005114.1 7584 SSEELVTPFREVMMAVDGENVTISCNYSGSVTNLYWYQQKSGSSPQLFIGEYSEKTEKLSARHDKQSNEFHLEISSAALTDSAVYYCALR
Labrus bergylta V935 trav FKLU01004833.1 6571 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAALTDSAVYYCALQPTVTGN
Labrus bergylta V898 ighv FKLU01004390.1 6510 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGSEAGSTRFYKDSLKNQFSINFDSSRKIATLNGLNMQPADTAVYYCVREPQ
Labrus bergylta V884 igkv FKLU01004203.1 11593 SRGQVTVTQPAAVSSALGASVSISCTTSQDVYVYSTYHYLAWYQQKDGGTPKLLIYVASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHEISSQAV
Labrus bergylta V859 trav FKLU01003850.1 4303 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLISDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAALTDSAVYYCALQPTVTG
Labrus bergylta V833 trav FKLU01003629.1 7358 LGSMNSINPETTEETVEEGGNINLTCTYDGRIQNIQWYRQNQRSRPEFLLYITEGGLVYKQVSYFSAHINKTEKRVNLEISSAALTDSAVYYCALEPTVTG
Labrus bergylta V820 trav FKLU01003542.1 13242 CMAQTDNVLQPEGDVTATEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLTIQKLQLTDSAVYYCALR
Labrus bergylta V776 trav FKLU01003282.1 5701 CMAQTDNVLQPEGDVTAPEGEAVTLGCQYNSSSSNEYLYWYKQDGNNSPKFILSRFKIGEGKTMEEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V760 igkv FKLU01003171.1 14767 SRGQVSVTQPAAVISALGASVTLSCTTSEDVETTLDEPDLAWYQQKDGGTPKLLINSGSTRESGTSDRFTGSGSNSDFTLTISGVQTEDAAVYYCQSIHDINSQYV
Labrus bergylta V742 trav FKLU01002981.1 14567 EDRVIQPTQDVFTSEGDTVTLDCKFETSTTFYLFWYRQEMGEIPKYLWRGNAGFSENAPGISGERFKATINGTSIPLKIQKLQLTDSAVYYCALKPTVTG
Labrus bergylta V718 trav FKLU01002658.1 10765 LGSMNSINPETTEEKVEEGGNINLTCTYDGLIQNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V703 trav FKLU01002283.1 8774 IQPTQDVFASEGDTVTLDCKVETTDTSPSLFWYRQEMGDFPKYLWKSYVGISENAPGISGDRFKASTNGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V673 igkv FKLU01002101.1 20595 SRGQVTVTQPAAVTSALGASVSISCRTSQDVYVYSSSHCLAWYQQKDGGTPKLLIYYASSRESGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V1179 ighv FKLU01012497.1 2614 VRSQTLTESEPVVKSPGQSHKLTCTYKGISDSSADISWIRQAEGKGLEWVSHISAPSGSTKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARA
Labrus bergylta V1171 ighv FKLU01011355.1 3951 VKCEQLTQPASVTVQPGQSLTITCQVSYSVNSYATAWIRQPAGKGLEGIILGGGGYSTYTKDSLKNQFSINLDSSSNRVTLNGLNMQPADSAVYYCAREPQ
Labrus bergylta V1141 trav FKLU01010207.1 6688 CMAQTDNMLQPEGDVTATEGEAVTLGCQYNSSSSNDYLYWYKQDVNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALRPTVTG
Labrus bergylta V1132 igkv FKLU01009841.1 2048 QVTVTQPAAVTSALGASVSISCRTSQNVYYSSPYHYLAWYQQKDGGTPKLLIYIASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSLHSINSQWV
Labrus bergylta V1112 ighv FKLU01009205.1 7271 VRSQTLTESEPVVKSPGESHKLTCTYTGISDSSADISWIRQAEGKGLEWVSFISAPSGSDKYYSTSVKNRFTISRDNDVDQVYLHMNSLTAEDSAVYYCARD
Labrus bergylta V664 trav FKLU01002071.1 2504 LGSMNSINPERTEEKVEEGGNINLTCTYDGVINNIQWYRQNQRSRPEFLLYITEGGTIHPTDSDFSAYINKTEKRVNLEISSAVLTDSAVYYCALR
Labrus bergylta V659 trav FKLU01002071.1 15134 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKANNLQWYQQDPGSAPQFLLLITDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAALTDSAVYYCALQPTVTGN
Labrus bergylta V625 ighv FKLU01001903.1 4639 KIYPAVDEVRGTEGESVTLTCNYETTEKYVILYWYRHHSDLQAPQFILWKGARDLKSQEYIPDKRYESQTSSSSTELTIRKLTPEDTALYYCALE
Labrus bergylta V603 ighv FKLU01001661.1 8412 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWICHRWGGGNLYQNNALKNKFSYRTDTSARTVTLTGQNMQPADTAVYYCVRR
Labrus bergylta V586 trav FKLU01001470.1 11149 LGSMNSINPETTEEKVEEGGNINLTCTYDGPIQNIQWYRQNQRSRPEFLLYITEGGSIHPTDSDFSAYINKTEKRVNLEISSAALTDSAVCYCALQPTVTG
Labrus bergylta V572 trav FKLU01001462.1 20748 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLITDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAALTDSAVYYCALQPTVTGN
Labrus bergylta V547 ighv FKLU01001320.1 24328 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQPAGKGLEWIGIRYTGGTYYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V538 trav FKLU01001283.1 19245 NTLEDDITASSAEVFSSEGHSVTLSCKYSVKADNLQWYQQDPGSAPQFLLLITDTSDPTVVTAKPPHPRLTVKLNEERNRVDLQISSAVLTDSAVYYCALR
Labrus bergylta V508 igkv FKLU01000738.1 4580 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYNNNHLAWYQQKDGGTPKLLIYAASTRASGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V430 trav FKLU01008694.1 8147 NVLQPEGDVTATEGEAVTLGCQYNSSSSNYYLYWYKQDGNNSPKFILSRFKIGEGKTIKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V400 ighv FKLU01007700.1 10131 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDDSYATGWIRQREGKPMDWISHQWGTSGLLQNNALKIKFSYSRDTSAATVTLTGQNMQPEDTAVYYCARV
Labrus bergylta V391 igkv FKLU01007393.1 10225 SRGQVTVTQPAAVSSALGASVSISCRTSQNVYNNDYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V363 ighv FKLU01006743.1 10335 VKAQTLTESEAVLKRPGESHRLTCSASGFTFSNYHMNWVRQAAGKGLEWIAWVERDNDRKFYSQSVKSRFTISRDNSRQQMYLQMNSLKTEDSAVYYCARD
Labrus bergylta V352 trav FKLU01006471.1 4888 DRVIQPTEDVFASEGDTVTLGCTFETTNPYPNLFWYRQEMGDFPKYMLRCDSKDVYKAPEFQTDKFNATINGTSVPLKIQKLQLTDSAVYYCALR
Labrus bergylta V342 ighv FKLU01006196.1 6367 VDGQTLTQSEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAYISTSSSYISYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V792 trav FKLU01003338.1 14193 LGSMNSINPERTEEKVEEGGNINLTCTYDGLIQNIQWYRQNQRSRPEFLLYITEGGTIHTTDSDFSAYINKTEKRVNLEISSAALTDSAVYYCALRPTVTG
Labrus bergylta V313 ighv FKLU01005524.1 7154 VHCIDLITPGSMVVQPGQSLTLTCQVSGYSLTDNSYATGWIRQREGKPMDWICHRWGGGDFYQNNALKNKFSYSRDTSAGTVTLTGQSLQPEDTAVYYCARV
Labrus bergylta V274 ighv FKLU01004489.1 15924 VKAQTLTESEAVVKRPGESHRLTCSASGFTFSSYEMSWVRQAAGKGLEWIAYITNGGGSSQYYSNSVKSRFTISRDDSRQQLYLQMNSLQTEDTAVYYCARE
Labrus bergylta V254 ighv FKLU01004169.1 16191 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIAEISSSGGSSQSYSNSVKSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V235 ighv FKLU01003951.1 10557 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYWTAWIRQPAGKGLEWIIVGQVGYSAYTKDSLKNQFSINFDSSSNTATLNGLNMQPADTAVYYCARE
Labrus bergylta V215 ighv FKLU01003335.1 17822 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSYWMAWVRQAPGKGLEWIATISNGGGSSQYYSNSVRSRFTISRDDSRQQLYLQMNSLKTEDTAVYYCARE
Labrus bergylta V196 igkv FKLU01002864.1 5511 SSGDILLTQTPGSLSVVLGQTVSIRCQTSTSVSAYLNWYLQKPGEAPKLLIYYSTNRQSGVSTHFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGSSFP
Labrus bergylta V174 ighv FKLU01002710.1 15427 VKCEQLTQPASVTVQPGQSLTITCQVSYSVGSYYTAWIRQPAGKGLEWIGMRYTGAAYYKDSLKNQFSIDLDSSRNRATLNGLNMQTADTAVYYCARDPQ
Labrus bergylta V157 ighv FKLU01002686.1 13540 TEGQTLTESDAVVKRPGESHTLTCTYSGFSSHPHNAWIRQAAGKGLEWVAYISSGGSIYYSNSVKGRFTISRDNSRQQVFLQMNSLTMEDSAVYYCARE
Labrus bergylta V149 ighv FKLU01002542.1 15027 VDGQTLTESEAVVKRPGESHRLTCSASGFTFSSSYMNWVRQAAGKGLEWIAYIGTFSSPIYYSSSVRGRFTISRDDSSSKLYLQMNSLQTADTAVYYCARE
Labrus bergylta V118 trbv FKLU01002151.1 16578 QSLTSSEPVVSRAGEPATLYCNVSGLALSWLHWIRQKTGKGLEWIGRIDRGTGTIFAQNLQGQFSITKDTSNNVVYLEVKSLKQEDSAVYFCARE
Labrus bergylta V106 igkv FKLU01001933.1 21945 SRGQVTVTQPAAVSSALGASISISCRTSQDVYYSSPYHYLAWYQQKDGGTPKLLIYRASSRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V79 ighv FKLU01001684.1 9470 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSGSYTAWIRQPAGKGLEWIGMRYTGAAFYKDSLKNQFSIDLDASNNRVTLNGLNMQPADTAVYYCAREPQ
Labrus bergylta V74 ighv FKLU01001643.1 25153 VKAQTLTESEAVVKRPGESHRLTCSASGFTLSSYHMNWVRQAPGKGLEWIAWVERDNDEKYYSQSAKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Labrus bergylta V481 igkv FKLU01010854.1 6058 SRGQVTVTQPAAVSSALGASVSISCTTSQNVYYGSSYHYLAWYQQKDGGTPKLLIYYASTRASGIPDRFSGSGSNSAFTLTISGVQTEDAAVYYCQSYHSISSQM
Labrus bergylta V469 igkv FKLU01010278.1 177 SSGDILLTQTPGSQSVVLGQTVSIRCQTSTSVGTYLHWYLQKPGEAPKLLIYYSTNRQSGVSTRFSGSGSGTDFTLTVSGVQTEDSGDYYCQQGYSYP
Labrus bergylta V439 igkv FKLU01009023.1 8280 SRGQVTVTQPAAVTSALGASVSISCRTSQNVYVYSSNHLLAWYQQKDGGTPKLLIYYASTRESGIPGRFSGSGSNSAFTLTISGVQTEDAAVYYCQS
Labrus bergylta V40 ighv FKLU01001361.1 6001 VKCEQLTQPASVTVQPGQSLTITCQVSYSVSSYATAWIRQPAGKGLEWIIVGRVGYNTDTKDSLKNQFSINFDSSSNTVTLNGLNMQPADTAVYYCARE
Labrus bergylta V3 trav FKLU01000951.1 9745 CMAQKDNVLQPEGDVTATEGEAVTLGCQYNSSSSNDYLFWYKQDGNNSPKFILSRFKIGEGKTMKEFEERFSSTLDSTLRSVPLKIQKLQLTDSAVYYCALQPTVTG