WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Larimichthys crocea JRPU00000000.1 (JRPU01) 121 74 0 18 9 19 1 0
Larimichthys crocea JPYK00000000.1 (JPYK01) 40 9 0 2 8 19 2 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Larimichthys crocea V29 trav JRPU01010703.1 297 VIQSAAVVQDTEVVSASVGDNVTLHCFYDSQVSMHFSWYQQTLGGRPELLSIFYKYDEPSKVFDWMEKNPRFSVQRKEGMNHLHITDVRFSDSAMYFCGS
Larimichthys crocea V28 trav JRPU01010703.1 297 VIQSAAVVQDTEVVSASVGDNVTLHCFYDSQVSMHFSWYQQTLGGRPELLSIFYKYDEPSKVFDWMEKNPRFSVQRKEGMNHLHITDVRFSDSAMYFCGS
Larimichthys crocea V27 igkv JRPU01008622.1 135794 CSGQVTVTQPAAVTSTPGSTVTISCKTSQDVYTDDSYGDRFAWYQQKSGQTPKLLIYYANRLESGTPARFSGSGSRSDFTLTISGVQAEDAAVYYCQSYHNGGV
Larimichthys crocea V26 igkv JRPU01008622.1 135794 CSGQVTVTQPAAVTSTPGSTVTISCKTSQDVYTDDSYGDRFAWYQQKSGQTPKLLIYYANRLESGTPARFSGSGSRSDFTLTISGVQAEDAAVYYCQSYHNGGV
Larimichthys crocea V25 trbv JRPU01005781.1 43485 KSVEFQQSLPKIANVTDRVEIKCSHNDNELYVMLWYQQRQNGQLSLMGFSYDTTNPNYEEQFVDQIEISRESRVSGALIIHSVNLSHSAVYFCAGR
Larimichthys crocea V24 trbv JRPU01005781.1 44106 SSKLCTGQVDGVHQSPPQIVEENTTVTISCSHDDTSRPVMLWYQQRESHSQSIILIGFGYGGGTQSYEGQFEEEFELKRESTLKGALIIRRASPVHSAVYFCAAS
Larimichthys crocea V23 trav JRPU01005781.1 48749 ISPNQSKDVQQTPADVLWEMNTEVKLTCKHKINSYDTILWYQRSQGDSSLKLVGLTRYKSTQTVEKAFKDRFDVSGDGEKEAFLHLLKLSHPEDSGHYFCAA
Larimichthys crocea V22 trbv JRPU01005781.1 52942 LSKKSVDQNPPAMFKTPGEEVLINCNHSNSDDFKMIQWYKQPARSSKMTLIGFARYDSVTVEGPFKETYNVSGDGRSLSSLHTRAASGAEDSVVYFCAASD
Larimichthys crocea V21 trbv JRPU01001393.1 1391 STAKSVTFQQSPPKIVSQTTRVEIKCSHDDSSLTAMLWYQQTKSRLMDLIGYGFTSGNPVYEKQFEHGFEITRKDTLTGALIIQSVNLSDSAVYFCAAS
Larimichthys crocea V20 igkv JRPU01022659.1 317 CSGQVTVTQPAAVTSTPGSTVTISCKTSQAVYSNNRLAWYQQKSGQTPKLLINHASTLVSGTPARFSGRGSSSDFTLTISGVQAEDAAVYYCQSLHYINDGWV
Larimichthys crocea V19 igkv JRPU01022177.1 523 CSGQVTVTQPAAVTSTPGSTVTISCKTSQAVWANNRLTWYQQKSGQPPKLLIRYVSQLESGTPARFSGSGSSSDFTLTISGVQAEDAAVYYCQSYHSGGV
Larimichthys crocea V18 igkv JRPU01021725.1 906 SRGQVTVTQPGAVSSAVGGSVTINCRTSQNVYHGSYHYLAWYQQRDGETPKRLIWGGNQRQSGIPARFTGSGSNSDFTLTISGVQAEDAAVYYCLS
Larimichthys crocea V17 trbv JRPU01017894.1 132898 PSLSDQVYQTPTDMYNRPQQTAKINCSHSIPSYDRILWYKQTNGQLQFLGYMYASSANAEAEMKVKMEGDASKDQICTLIIEKLSLDRSAVYFCAASMHSAT
Larimichthys crocea V16 trbv JRPU01017894.1 126891 ASNTSKVLQTPDFIIKRTGDPVASGINCSHNIAMYDVILWYKQDRQGALKLLGYQYATMKTLEDDVKGKISFDGNGNTHSSLTIFNLLLEDSAVYFCAAS
Larimichthys crocea V15 trbv JRPU01017894.1 110826 QVKSVTFQQSPPKIVNQTTRVEIKCSHDDSSLYTMLWYQQKESRLMDLIGYRYMNNEPVYEKQFEHQFEITRKDTLTGALIIQSVNLSDSAVYFCAAS
Larimichthys crocea V14 trbv JRPU01017894.1 109371 SQAVLITQWPHYIVTAPSVLAEMHCYQNDTDYQYMYWYRQRGKSLQLIVTIVGATSSFEEGFKSGFQAVTSKEKQWSLTVPSVQSEHEAVYLCAAS
Larimichthys crocea V13 trbv JRPU01017894.1 108566 FVLSSVVIQQSVNPLIKHEGEEARLDCYHGDNDYPYMFWYQHKSLAGQRAMELIGKLHYENSNLEENFDARFNITGHSKRRAQLVISNIKLTDSAEYFCAAS
Larimichthys crocea V12 trgv JRPU01017894.1 105264 ACLGVEVRQSASDLVTKPGDKVQIFCTHDKTDYRVMLWYQQSPGDTAMKLIGYLYHKAVTMETLYEADFNITGDLSGSTAKNGSLILKRVEHSAVYYCAARE
Larimichthys crocea V11 trbv JRPU01017894.1 104503 VCLSVQVHQTPPALLRRPGDKVQLVCSHEKTDYYLMYWYQKSPGDRALKRIGHVYHSSIEHEESFKEHFKITGDMSGSTAKNGSLLILDLKAPEHSAVYYCAASY
Larimichthys crocea V10 trbv JRPU01017894.1 103057 SSLSDQVRQTPAEIYSQQRQQAKISCSHSIDSYNRVLWYKQKEDGQMQLLGYMIGNTGRTETGVNVTMEGSADKDKTCTLTTEELSVNSSAVYFCAASYTVLQ
Larimichthys crocea V9 igkv JRPU01016730.1 2087 SSGQIILTQSPESQSVVPGQTVSIRCQTSTSVSNYLNWYLQKTGEAPKLLIYQVSTLQSGVSDRFSGSGSGTDFTLTIRGVQAEDSGVYYCQQSGSFP
Larimichthys crocea V8 igkv JRPU01012898.1 3701 SRGQVTVTQPGAVSSAVGGSVTISCRTSQDVHVGNHLAWYQQRDGETPKLLIYHASTRQSGTPARFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Larimichthys crocea V7 igkv JRPU01007643.1 683 SRGQVTVTQPGAVSSAVGGSVTISCRTSQNVFVYNNYHELSWYQQRDGETPKLLIKFANQRQSEIPARFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Larimichthys crocea V6 igkv JRPU01007593.1 16531 CSGQVTVTQPAAVTSTPGSTVTISCKTSPDVYGNTYMFWYQQKSGQTPKLLIKFVNELVSGTPARFSGSGSSSDFTLTISGVQAEDAAVYYCQSFHVINSGVV
Larimichthys crocea V5 trav JRPU01006050.1 188 NTLEDDITASKPEEFSSEGRSLTLSCSYSVKADNLQWYRQDPGSAPQFLLLITDTTEPSVVQATPPHPRLTAELNAERNKMDLQISSAAVTDSAVYYCAVT
Larimichthys crocea V4 ighv JRPU01005690.1 3953 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSSSAMNWIRQAPGKGLEWIASISQPSGSNKYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Larimichthys crocea V3 trav JRPU01002920.1 13877 RVIQPQRHVNATEGDTVTLHCTFETSATFSHLFWYKQEVNDVPKFILQRYSGTKDKPLQEDRLDAIIKNDSVPLKIQKLQLSDSAVYYCALQ
Larimichthys crocea V2 trav JRPU01002920.1 9520 NVLQRERHVTATEGQAVTLGCQYNSSSTGPNLFWYKQDGNNSPKFILSRFKFGQGKTEDEERFSSTLNSTSRSVPLEIQKLQLSDSAVYYCALQPTVTG
Larimichthys crocea V1 trav JRPU01002920.1 3358 RVIQPERHVNATEGDTVTLHCTFETSATFSHLFWYKQEVNDVPKFILQRYSGTKDKPLQEDRLDAIINNDSVPLEIQKLQLSDSAVYYCALQ
Larimichthys crocea V0 trav JRPU01002919.1 5414 NVLQRERHVTATEGQAVTLGCQYNSSSTNEYLFWYKQDGNNSPKFILSRFKFGQGKTEDEERFSSTLNSTSRSVPLEIQKLQLSDSAVYYCALQPTVTG
Larimichthys crocea V66 ighv JRPU01015370.1 72252 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSSYGMGWIRQAPGKGLEWIAYIYSDGVYSQSVQGRFTISRDNSREQLFLQMNSLKTEDSAVYYCARE
Larimichthys crocea V65 ighv JRPU01015369.1 1688 VDGQTLTESEPAIKRPGESHRLTCTVSGLSLSSNYMAWIRQAPGKGLEWIAYISSGGSTYYSQSVQGRFTISKDNSRQQVYLQMNRLKTEDSAVYYCARE
Larimichthys crocea V64 ighv JRPU01015369.1 3223 VKCEQLTQPASVTVQPGQRLTITCQVSYSLGYYTAWIRQPAGKGLEWIGMRYTGGSHYKDSLKNKFSIDLDSSSKTVTLNGQNVQPEDTAVYYCARR
Larimichthys crocea V63 ighv JRPU01015369.1 5279 VDGQTLTESEPAIKRPGESHRLTCTTSGLSFSSYWMGWIRQAPGKGLEWIAADGGGSSKYYSQSVQGRFTVSRDNSREQLFLQMNSLKTEDSAVYYCARE
Larimichthys crocea V62 ighv JRPU01015368.1 881 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMRAGSTSYYKDSLKNKFTIDLDSSSNTVTLNGQNVQPEDTAVYYCARR
Larimichthys crocea V61 ighv JRPU01015368.1 1848 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSDYWMHWVRQAPGKGLEWIAIIESGSGSRKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCAR
Larimichthys crocea V60 ighv JRPU01015368.1 3083 VDGQTLTESEPAIKRPGESHRLTCTASGFTLSSYWMGWVRQAPGKGLEWVSTVRNDGGNSYYSQSVQGRFTISRDDSRQQVYLQMNSLKTEDSAVYYCARE
Larimichthys crocea V59 ighv JRPU01015368.1 6019 VDGQTLTESEPVIKSPGESHRLTCTTSGISFSGYWMHWIRQAPGKGLEWIAWINTDGSSTNYPQSVKGRFTISRDNSREQLYLEIHSLKTEDSAVYYCARE
Larimichthys crocea V58 ighv JRPU01015367.1 1751 VKCEQLTQPASATVQPGQRLTITCQVSYSLSGYFTAWIRQPAGKGLEWIGSRYTGDASYKDSLKNKFSIDLDTSSKTVTLNGQNVQPEDTAVYYCARE
Larimichthys crocea V57 ighv JRPU01015367.1 2476 VNSLNLVQPESMVVQPGQSLTITCQVSGYSLTDNSYATGWIRQCEGKPMDWILSRLGGGDFYQNNALKKFLYQTSTSTSSVRLTGQNMQPEDTAVYYCVRV
Larimichthys crocea V56 ighv JRPU01015367.1 3675 VDGQTLTESEPAIKRPGESHRLTCTTSGFTFSGYWMHWARQAPGKGLEWIATISTGSSSIYYSQSVQGRFTISRDDGRQQLYLQMNSLKTEDSAVYYCARD
Larimichthys crocea V55 ighv JRPU01015365.1 7537 VDGQTLTQSEPAIKRPGESHRLTCTTSGLSFSSYYMAWIRQAPGKGLEWIAWIDTGGSSKHYSQSVQGRFTISRDNSREQLFLEMNSLKTEDSAVYYCARD
Larimichthys crocea V54 ighv JRPU01015365.1 9527 VDGQTLTESEPAIKRPGESHRLTCTASGFTFSSAEMVWIRQAPGKGLEWIAYIYSSSIYYSQSVQGRFTISKDNSRQQVYLQMNSLKTEDSAVYYCARQ
Larimichthys crocea V53 ighv JRPU01015365.1 10993 VDGQTLTESEPAIKRPGEAHRLTCTASGFSFSGSSMAWIRQAPGKGLEWLSVIYSSGSIYYSQSVQGRFTISRDNNRQQVYLQMNILKTEDSAVYYCARE
Larimichthys crocea V52 ighv JRPU01015365.1 12835 VKCEQLTQPASVTVQPGQRLTITCQVSYALSGYYTAWIRQPAGKGLEWIGMRYTGAAYYKDSLKNKFSIDLDTSSKTVTLNGQNVQPEDTAVYYCARE
Larimichthys crocea V51 ighv JRPU01015365.1 13894 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSSYYMAWIRQGPGKGLEWVASISQSSSYIYYSQSVQGRITISRDDSRQQLYLQMNSLKTEDSAVYYCAR
Larimichthys crocea V50 ighv JRPU01015365.1 16576 VDGQTLTESEPAIKRPGESHKLTCTTSGLSFSSNWMGWIRQAPGKGLEWIAAMYDSSNIHHSQSVKGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARG
Larimichthys crocea V49 ighv JRPU01015365.1 18165 VDGQTLTESEPAIKRPGESHRLTCTASGLSISSNWMGWIRQAPGKGLEWLALINSASDSIHYSQSVKGRFTISRDNSREQLFLQMNSLKTEDSAVYYCARE
Larimichthys crocea V48 ighv JRPU01015365.1 20548 CTGQSMESIPSSAVVKKPGETLNLSCRGSGFTFTCCVMGWIRQPAGKALELIGIGWSDASKNTYASSLQGRVEISRDDSNSMVNLRLSNLKPEDSAVYYCAR
Larimichthys crocea V47 ighv JRPU01015365.1 25383 VKCEQLTQPASVTVQPGQRLTITCQVSYSLGSYWTAWIRQPAGKGLEWIGMKYTGGSYYKDSLKNKFSIELDTSSKTVTLNGQNVQPEDTAVYYCARE
Larimichthys crocea V46 ighv JRPU01015365.1 27312 TEGQTLTESEPVVKRPGESHRLTCTYSGFSSPPHSAWIRQAAGKGLEWLALIYSDSSSISYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Larimichthys crocea V45 ighv JRPU01015364.1 14470 VCSQTLTESEPAMKRPGESHKLTCTYAGISDDNAHIGWIRQAEGKGLEWVAYISAPTGADKFYSTSVKNRFTISRDNNVDQVYLQMNSLTTEDSAVYYCARK
Larimichthys crocea V44 ighv JRPU01015364.1 15491 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSSSAMNWIRQAPGKGLEWVAFISQPSGSKKYYSQSVQGRFTISRDNSRQQVNLQMTSLKTEDSAVYYCARE
Larimichthys crocea V43 trbv JRPU01015364.1 16644 VWSKNMDQSPSEVKRPGETVKMSCVISGFHMTSYHIHWTRQKPGKALELIGWMNAGSNSASYASSFQNRFTMTEDVSSSTQYLEVKSLTAEDSAVYFCARG
Larimichthys crocea V42 ighv JRPU01015364.1 21017 VCSQTLTESEPAMKRPGESHKLTCTYAGISDNNAHIGWIRQAEGKGLEWVAYISAGGTKAYSTSVKNRFTISRDNNRQQVYLQMNSLTTEDSAVYYCARD
Larimichthys crocea V41 ighv JRPU01015364.1 22570 VDSLNLVQPESVVVQPGQSLTITCQVSGYSLTDDSYATGWIRQCEGKQMDWISHQWGGGTLRQNSALKNKFSYSRDTSAATVTLKGQNVQPEDTAVYYCARR
Larimichthys crocea V40 ighv JRPU01015364.1 24218 TAGQTLTESEPVVKRPGESHRLTCTYSGFGGNPNNAWIRQAAGKGLEWVAYISSGSGSIYYSQSVQGRFTVSRDNSRQQVYLQMNSLKTEDSAVYYCARE
Larimichthys crocea V39 ighv JRPU01015364.1 25336 VKCEQLTQPASVPVQPGQRLTITCQVSYSVSEYYTAWIRQPAGKGLEWVSRDTDVKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDTAVYYCARD
Larimichthys crocea V38 ighv JRPU01015364.1 26911 VDGQTLTESEPVIKRPGESHRLTCTTSGFTFSSYAMNWIRQAPGKALEWIAFIHTGSSHIYYSQSVKGRFTISRDDSNSKLYLQMNSLKTEDTAVYYCARR
Larimichthys crocea V37 ighv JRPU01015364.1 29442 CTGQSMESIPSSAVVKKPGETLNLSCRGSGFTFSCCVMGWIRQPAGKSLEWIGSGFSDASKNTYASSLRGRIEISRDDSNSMVNLRLSNLKPEDSAVYYCAK
Larimichthys crocea V36 ighv JRPU01015364.1 31772 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSNYWMNWVRQAPGKGLEWVAIIESSSGSRTFYSQSVQGRFTISKDNGRQQLYLQMNSLKTEDSAVYYCARG
Larimichthys crocea V35 igkv JRPU01015298.1 1822 IVLTQTPAVHTVSTGQEVVLKCNIQRFDAGYDVSWYKQVPGEAPQYVLKFHHSDSSPSFGTGFSSDRFNSKASSNIDYQFIIKRAEAGDSAVYY
Larimichthys crocea V34 trav JRPU01014873.1 26440 WISVSASESQTVEVQPGQEVTLLCSNFSSGPTQIFWFKLVNRRHPRCISHMFNPHEPAKFCSGFQNEKFEMRSNISTVFLKIKQVDLSDSGLYFCGK
Larimichthys crocea V33 igkv JRPU01013502.1 1085 TVTQPGAVSSAVGGSVTISCRISQNVQTGNRLSWYQQRDGETPKLLIYLASTRQSGIPARFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Larimichthys crocea V32 igkv JRPU01013499.1 1459 SRGQDTVTQPGAVSSAVGGSVTISCRISQNVNGGNRLAWYQQRDGETPKEIIYGASTRPSGIPAHFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Larimichthys crocea V31 igkv JRPU01013498.1 28837 QDTVTQPGAVSSAVGGSVTISCRISQNVQTGNCLSWYQQRDGETPKLLIYLASTRLSGIPARFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Larimichthys crocea V30 igkv JRPU01012489.1 127 SRGQVTVTQPGAVSSAVGGSVTINCRTSQNVYNGNHLAWYQQRDGETPKLLIKLVNQRQSGIPARFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Larimichthys crocea V104 ighv JRPU01015370.1 1485 VDGQTLTESEPANKRPGESHKLTCTASGFTFSSYWMHWVRQAPGKGLEWIAAIYDSSSIYYSQSVQGRFTISRDNGRQQLYLQMNSLKTEDSAVYYCARE
Larimichthys crocea V103 ighv JRPU01015370.1 3168 VDGQTLTESEPAIKRPGESHKLTCTASGFTFSSYRMAWVRQAPGKGLEWIAWIDTGSSSKYYSQSVQGRFTISRDDGRQQLYLQMNSLKTEDSAVYYCARD
Larimichthys crocea V102 ighv JRPU01015370.1 4632 VKCEQLTQPASVTVQPGQRLTITCQVSYALSSYYTAWIRQPAGKGLEWIGSRYTGAAYYKDSLKNKFSIDLDSSSKTVTLNGQNVQPEDTAVYYCARD
Larimichthys crocea V101 trbv JRPU01015370.1 7015 VDGQTLTESEPVTKRPGESHRLTCTTSGLSFSSSWMNWVRQTPGKGLEWVATITSDSSSKYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYFCT
Larimichthys crocea V100 ighv JRPU01015370.1 10044 ADGQTLTESEPVIKRPGESHKLTCTTSGLSFSSNWMAWIRQAPGKGLEWIATDTGGSSKYYSQSVQGRFIVSRDNSREQLYLQMNSLKTEDSAVYYCARQ
Larimichthys crocea V99 ighv JRPU01015370.1 11406 VDGQTLTESEPVIKRPGESHKLTCTTSGFTFSSYDMGWIRQAPGKGLEWVAWINSASSSIYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARQ
Larimichthys crocea V98 ighv JRPU01015370.1 12995 VDGQTLTESEPVIKRPGESHRLTCTTSGISFSSKWMHWIRQAPGKGLEWIAWINTDGSSTSSPQSVKGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARD
Larimichthys crocea V97 ighv JRPU01015370.1 14411 VKCEQLTQPASVTVQPGQRLTITCQVSYALSSYHTAWIRQPAGKGLEWIGMRSTGYSYYKDSLKNKFSIDLDTSSKTVTLSGQNVQPEDTAVYYCARE
Larimichthys crocea V96 ighv JRPU01015370.1 16017 VDGQTLTESEPVIKRPGESHKLTCTASGFTFSSYWMAWVRQAPAKGLEWIALIYTDSSGTFYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Larimichthys crocea V95 ighv JRPU01015370.1 18259 CTGQSMESIPSSAVVKKPGETLNLSCRGSGFTFSCCGMNWIRQPAGKTLEWMGFVKSDATATGYANSLQGRLEITRDNSNSMTYLRLSSLKPEDSAVYYCAK
Larimichthys crocea V94 ighv JRPU01015370.1 23069 TEGQTMTESEPVVKRPGESHRLTCTYSGFSSPPYSAWIRQAAGKGLEWIAWIHSDGSSEIYYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Larimichthys crocea V93 trbv JRPU01015370.1 24282 DTQFNMMGYRTGLLISHRLTCTASGITFSDYWMAWVRQAPGKGLEWIAWHDGSSTNYPQSVQGRLTISRDNSRQQVHLQMNSLKTEDSAVYFCARE
Larimichthys crocea V92 ighv JRPU01015370.1 25381 VDGQTLTESEPVIKRPGESHKLTCTASGFTFSSYNMHWIRQAPGKGLEWIALIYNDGSGTFYSQSVRGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARQ
Larimichthys crocea V91 ighv JRPU01015370.1 26776 VDGQTLTESEPAIKRPGESHRLTCTASGFSLSSYWMAWVRQAPGKGLEWIATDGGGSSKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDYAVYYCARE
Larimichthys crocea V90 ighv JRPU01015370.1 28116 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSDYWMQWARQAPGKGLEWIAIISSGSGSSKSYSQSVQGWFTISRDNSRQQLYLQMNSLKTEDSAVYYCARD
Larimichthys crocea V89 ighv JRPU01015370.1 31376 VDGQTLTESEPVIKRPGESHRLTCTASGLSFSSYSMVWIRQAPGKRLEWVAYVRHDSSSISYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Larimichthys crocea V88 ighv JRPU01015370.1 33725 VDGQTLTESEPVIKRPGESHKLTCTTSGLSFSSNWMAWIRQAPGKGLEWVATISTGSSNIYYSQSVQGRFTISRVDSREQLFLQMNSLKTEDSAVYYCARE
Larimichthys crocea V87 ighv JRPU01015370.1 35477 VDGQTLTESEPVIKRPGESHRLTCTTSRLSFSSYYMAWIRQAPGKGLEWIASISTGSSSIYYSQSVQGRFTISRDDSREQLFLQMNSLKTEDSAVYYCARD
Larimichthys crocea V86 ighv JRPU01015370.1 37065 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSSYRMSWIRQAPGKGLEWIAYISTASSPIYYSQSVQGRFTISRDDSNSKLYLQMNSLKTEDTAVYYCART
Larimichthys crocea V85 ighv JRPU01015370.1 39325 VDGQTLTESEPVIKRPGESHRLNCTASGFTFSSYGMGWIRQAPGTGLEWIAYIYSDGVYSQSVKGRFTISRANSREQLFLQMNSLKTEDSVVYYCARE
Larimichthys crocea V84 ighv JRPU01015370.1 42150 KCQQFTQPTSVTVQPGQRLTITCQVSYSIGSYFTAWIRQPAGKGLEWIGMRATGDSHYKHSLKNKFSIDLDTSSNTVTLNGQNVQPEDTAVYYCASE
Larimichthys crocea V83 ighv JRPU01015370.1 44090 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSNHWMGWVRQAPGKGLEWIAFIDSGSGSTKYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDSAVYYCARD
Larimichthys crocea V82 ighv JRPU01015370.1 46009 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSNYDMNWIRQAPGKGLEWIAYISNGGSSIHYSQSVKGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Larimichthys crocea V81 ighv JRPU01015370.1 47278 VDGQTLTESEPAIKRPGESHRLTCTASGFTFSSYAMNWIRQAPGKGLEWLAFIYGDGSGTFYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCA
Larimichthys crocea V80 ighv JRPU01015370.1 48893 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSDYWMHWIRQAPGKGLEWIAWISTDGSSTNYPQSVKGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARD
Larimichthys crocea V79 ighv JRPU01015370.1 50554 VDGQTLTESEPAIKRPGESHRLTCTASGFTLSSYWMAWVRQAPGKGLEWIAWIEHNDDRKFYSQSVQGRFTISRDNGRQQVYLQMNSLKTEDSAVYYCAR
Larimichthys crocea V78 ighv JRPU01015370.1 51887 IDGQTLTESEPVIKRHGESHKLTCTASGFTFSSFAMGWVRQAPGQGLEWIAHIHGDGSHTFYSQSVQGRFIISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Larimichthys crocea V77 ighv JRPU01015370.1 52588 VDGQTLTESEPAIKRAGESHRLTCTTSGLSFSSYSMGWIRQAPGKGLELAAWIHPGSSSKYYSQSVQGRFTISRDDGREQLFLQMNSLKTEDSAVYYCARE
Larimichthys crocea V75 ighv JRPU01015370.1 56079 VDGQTLTESEPVIKRPGESHKLTCTASGFTFSHYWMAWIRQAPGKGLEWIAIIERGSGSSKFYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCVGE
Larimichthys crocea V74 ighv JRPU01015370.1 57014 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYLTAWIRQPAGKGLEWIGVRNTGASFYKDSLKNKFSIDLDTSSNTVTLNGQNVQPEDTAVYYCARE
Larimichthys crocea V73 ighv JRPU01015370.1 59739 VKCEQLTQPASVTVQPGQRLTITCQVSYSVGSHYTAWIRKPAGKGLEWIGMRSTRGSFYKDSLKNKFSIDLDSSSNTVTLNEQNVQPEDTAVYYCARD
Larimichthys crocea V72 ighv JRPU01015370.1 61525 VDGQTLTESEPVIKRPGESHRLTCTTSGFTFSSYAMAWIRQAPGKGLEWIAYIYTDGSKSFYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARA
Larimichthys crocea V71 ighv JRPU01015370.1 62908 VDGQTLTESEPVIKRPGESHRLTCTASGFSLSSYWMAWVRQAPGKGLEWIAWIEHNDDRKFYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCA
Larimichthys crocea V70 ighv JRPU01015370.1 64235 VDGQTLTVSEPVIKRPGESHRLTCSASGFTFSSYHMVWTRQAPGKGLEWIAFIDIDSSGIFYPQSVQGRFTISRDNSRQQVYLQMNSLKTEYSAVYYCARY
Larimichthys crocea V69 ighv JRPU01015370.1 65892 VDGQTLTESEPAIKRPGESHRLTCTTSGFTFSSYHMDWVRQAPGKALEWIAFIHTGSSSSYYSQSVKGRFTISRDDSSSKLYLQMNNLKTEDTAVYYCARH
Larimichthys crocea V68 ighv JRPU01015370.1 68659 VDGQTLTESEPVIKRPGESHRLTCTTSGLSFSSYYMAWIRQAPGKGLEWIASISTGSSSIYYSQSVQGRFTISRDDSREQLFLQMNSLKTEDSAVYYCARD
Larimichthys crocea V119 igkv JRPU01022056.1 81 QDTVTQPGAVSSAVGGSVTISCRISQNVQTGNCLSWYQQRDGETPKEIIYGASTRPSGIPARFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Larimichthys crocea V118 trbv JRPU01021039.1 740 ASETNRVLQTPAFIIKRTDESVLSGINCSHKIPNYNVILWYKQDQHKALKLLGYLLMNSPKPEDDVKGKISFDGDGQTHSSLTISDLVLNDTGVYFCAAS
Larimichthys crocea V117 trbv JRPU01021039.1 1827 YTDADGVTQTGMLWEKKGNSATMNCSHTKGAGYYQMYWYRQLPGETMELIVFTSGKNHDFGKFSKEKFSATKPDAESGTFTVNDLVPDDKGLYFCAVSKHSDT
Larimichthys crocea V116 trbv JRPU01021039.1 3020 ASETNRVLQTPAFIIKRTGQSVLSGINCSHKIPNYNVILWYKQDQHKALKLLGYLTVTSPKPEDDVKGKISFDGDGQTHSSLTISDLVLNDTGVYFCAAS
Larimichthys crocea V115 trbv JRPU01021039.1 4107 YTDADDVTQTGMLWEKKGNSATMNCSHTKGAGYYQMYWYRQLPGETMELIVFTTTGNKNHDFGKFSKEKFSATKPDAESGTFTVNDLVPDDKGLYFCAVSKHSDT
Larimichthys crocea V114 trbv JRPU01021039.1 5257 ASETNRVLQTPAFIIKRTDESVLSGINCSHKIPNYNVILWYKQDQHKALKLLGYLFMNSPNPEDDVKGKISFDGDGQTHSSLTISDLVLNDTGVYFCAAS
Larimichthys crocea V113 igkv JRPU01018966.1 14132 SRGQVTVTQPGAVSSAVGGSVTISCRTSQNVYKNYLSWYQQRDGETPKLIIKYPNQVVSGIPDRFSGSGSNSDFTLTISGVQTEDVAVYYCMGEFSVS
Larimichthys crocea V112 igkv JRPU01018721.1 8551 SRGQVTVTQPGAVSSAVGGSVTINCRTSQNVHVSSNYHLLSWYQQRDGETPKLLIYWASTRPSGIPARFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Larimichthys crocea V111 ighv JRPU01015373.1 577 VDGQTLTESEPVIKRPGESHKLTCTASGFTFSHYWMHWVRQAPGKGLEWIAIIERGSGSSKFYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Larimichthys crocea V110 ighv JRPU01015373.1 4514 VDGQTLTESEPVIKRPGESHKLTCTASGFTFSHYWMHWVRQAPGKGLEWIAIIERGSGSSKFYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCVGE
Larimichthys crocea V109 ighv JRPU01015373.1 5458 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYLTAWIRQPAGKGLEWIGVRNTGASFYKDSLKNKFSIDLDTSSNTVTLNGQNVQPEDTAVYYCARE
Larimichthys crocea V108 ighv JRPU01015373.1 8183 VKCEQLTQPASVTVQPGQRLTITCQVSYSVGSHYTAWIRQPAGKGLEWIGMRYTGGSFYKDSLKNKFSIDLDTSSNTVTLNGQNVQPEDTAVYYCARD
Larimichthys crocea V107 ighv JRPU01015371.1 2006 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSNHWMGWVRQAPGKGLEWIAFIDSGSGSTKYYSQSVQGRFTISRDNSKEQLYLQMNSLKTEDSAVYYCARD
Larimichthys crocea V106 ighv JRPU01015371.1 3973 VDGQTLTESEPVIKRPGESHRLTCTASGFSLSSYWMAWVRQAPGKGLEWIAWIEHNDDRKFYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Larimichthys crocea V120 igkv JRPU01023545.1 107 CSGQVTVTQPAAVTSTPGSTVTISCKTSRAVYTDSHGGRLAWYQQKSGQTPKLLIYLASTLVSGTPARFSGSGSSSDFTLTISGVQAEDAAVYYCQSYHYISSVNM
Larimichthys crocea V105 ighv JRPU01015370.1 238 VDGQTLTESEPAIKRPGESHRLTCTASGFTFSSYWMNWIRQAPGKGLEWIATDTGGSSKYYSQSVQGRFIVSRDNSRQQLYLQMNSLKTEDSAVYYCARV
Larimichthys crocea V76 ighv JRPU01015370.1 55314 VDGQTLIESEPVIKRPGESHRLTCTTSGFTFSSQWMAWVRQVPGKGLEWIAIISSGSGSSKSYSQSVQGRFTISRDNSRDQLYLQMNSLKTEDSAVYYCV
Larimichthys crocea V67 ighv JRPU01015370.1 70247 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSSYRMSWIRQAPGKGLEWIAYISTASSPIYYSQSVQGRFTISRDDSNSKLYLQMNSLKTEDTAVYYCART
Larimichthys crocea V12 trgv JPYK01033178.1 6944 ACLGVEVRQSASDLITKPGDKVQIFCTHDKTDYTMMLWYQQSPGDTAMKLIGYLYHKAVTMEKLYEADFNIAGDLSGSTAKNGSLILKRVEHSAVYYCAARE
Larimichthys crocea V11 trbv JPYK01033178.1 6196 ACLGVEVRQSASDLITKPGDKVQIFCTHDKTDYRLMLWYQQSPGDTAMKLIGYLYFKTVTMENLYEKQFNISGDLGGNTAKNGSLVLQTSGFEHSAVYYCAASE
Larimichthys crocea V10 trav JPYK01033178.1 5056 ACLGVEVRQSPSDLITKPGDKVQIFCTHDKTDYTMMLWYQQSPGDTAMKLIGYLNYKAVTMETLYEADFNITGDLSVNTAKNGSLITKVTRPEQAVYYCAASR
Larimichthys crocea V9 trav JPYK01033178.1 4135 GCLGVEVRQSPSDLVTKPGDKVQIFCTHDKTDYRVMLWYQQSPGDTAMKLIGYLNYKAVTMETLYEADFNITGDLSVNTAKNGSLITKVTRPEQAVYYCAASR
Larimichthys crocea V8 trbv JPYK01033178.1 3374 VCLSVQVHQTPPALLRRPGDKVQLVCSHEKTDYYLMYWYQKSPGDRALKRIGHVYHSSIEHEESFKEHFKITGDMSGSTAKNGSLLILDLKAPEHSAVYYCAASY
Larimichthys crocea V7 trbv JPYK01033178.1 1932 SSLSDQVHQTPAEIYSKQRQQAKISCSHSIDSYNRILWYKQTNGQLQLLGYMNVNTGLPEKGVNVMIEGSAFKDKTCTLTTEELSVNSSAVYFCAASYTVLQ
Larimichthys crocea V6 trbv JPYK01033178.1 1172 SSLSDQVHQTPAEIYSKQRQQAKISCSHSIDSYNRILWYKQKEDGQLQLLGYMIGNTGRTETGVNVTMEGGADKDKTCTLTTEELSVNSSAVYFCAASYTVLQ
Larimichthys crocea V5 trbv JPYK01033178.1 412 SSLNDQVHQTPANIYEKPGKAAKISCSHSIQYYDRILWYKQSKNREMQLLGYMNVNNGFPEKGVNVTMEGSANKDKICTLTIEGLSVNSSAVYFCRRSM
Larimichthys crocea V4 trbv JPYK01033177.1 9625 LSKYSVHQTPTAVIRHAGEDVLMNCSHSNTDFDMIQWYKQSAGKNDMVLVGYVRFSSSVVESPFKDSYNVSGTGGSLSCLHIPKSRSENSAVYFCAASRAQC
Larimichthys crocea V3 trbv JPYK01033177.1 5932 SSLSDQVRQTPAEIYSQQRQQAKISCSHSIDTYNQILWYKQKEDGQLQFLGYMIGSIGRTETGVNVTMEGSADKDKTCTLTTEELSVNSSAVYFCAASYTVLQ
Larimichthys crocea V2 trbv JPYK01033177.1 2838 ASNTSKVLQTPDFIIKRTGDPVASGINCSHNIAMYDVILWYKQDRQGALKLLGYQYATMKTLEDDVKGKISFDGNGNTHSSLTIFNLLLEDSAVYFCAAS
Larimichthys crocea V1 ighv JPYK01024066.1 1968 VDGQTLTESEPAIKRPGESHRLTCTASGFTFSDYGMVWIRQAPGKGLEWIAYISGGSYIHYSQSVKCWFTISRDDSRQQLYLQMNSLKTEDSAVYYCA
Larimichthys crocea V0 ighv JPYK01024066.1 895 VKCEQLTQPASVTVQPGQRLTITCQVSYSVGSHYTAWIRKPAGKGLEWIGMRYTGGSFYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDTAVYYCARD
Larimichthys crocea V39 ighv JPYK01044706.1 1873 CTGQSMESIPSSAVVKKPGETLNLSCRGSGFTFSCCGMNWIRQPAGKTMEWMGFVQYDATATGYANSLQGRLEITRDNSNSMTYLRLSSLKPEDSAVYYCAK
Larimichthys crocea V38 ighv JPYK01044094.1 1095 VDGQTLTESEPAIKRPGESHKLTCTTSGLSFSSYWMSWVRQAPGKGLEWIATEGLSSGKFYSQSVQGRFIVSRDNGKEQLYLQMNSLKTEDSAVYYCARQ
Larimichthys crocea V37 trgv JPYK01041491.1 2085 QMTNLKFSSSVHQEAGFVSAYVGDSVTLRCFYEGDLAARFYWYKQTLREKPRLISTYYKYEKNGTFHSEFNNLRFTLDTEIGRNHLSMTNLQISDTATYYCASSFS
Larimichthys crocea V36 trav JPYK01040466.1 2402 WITVSGSELQTVDVQPGQEVTLLCSNISKHPTHADWFRLAYGTKPLCISSMYGSGGEAESCDGFQNEKFEMSSNDSTVFLKIKQVDVSDSGLYFCGFYID
Larimichthys crocea V35 trav JPYK01040466.1 2402 WITVSGSELQTVDVQPGQEVTLLCSNISKHPTHADWFRLAYGTKPLCISSMYGSGGEAESCDGFQNEKFEMSSNDSTVFLKIKQVDVSDSGLYFCGFYID
Larimichthys crocea V34 trbv JPYK01027422.1 865 ISPKQSKDVQQTPADVLWEMNTEVKLTCKHKINSYDTILWYQRSQGDSSLKLVGLTRYKSTQTVEKAFKGRFDVSGDGEKEAFLHLLKLSHPEDSGHYFCAA
Larimichthys crocea V33 trbv JPYK01027421.1 12656 SSKLCTGQVDGVHQSPPQIVEENTTVTISCSHDDTSRPVMLWYQQRESHSQSIILIGFGYGGGTQSYEGQFEEEFELKRESTLKGALIIRRASPVHSAVYFCAAS
Larimichthys crocea V32 trbv JPYK01044682.1 2944 VDGQTLTESEPVTKRPGESHRLTCTTSGLSFSSSWMNWVRQTPGKGLEWVATITSDSSSKYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYFCTRH
Larimichthys crocea V31 ighv JPYK01044668.1 3096 VDGQTLTESEPVIKRPGESHKLTCTASGFTFSSYWMAWVRQAPAKGLEWIALIYTDSSGTFYSQSVQGRFTISRDNGRQQLYLQMNSLKTEDSAVYYCARE
Larimichthys crocea V30 trbv JPYK01041646.1 5702 VWSENMDQSPSEVKRPGETVKMSCVISGFDMTSYFIHWIRQKPGKALEWIGRMNTGSNSASYASSFQNRFIMTEDVSSSTQYLEVESLTAEDSAVYFCARE
Larimichthys crocea V29 ighv JPYK01041644.1 471 VKCEQLTQPASVTVQPGQRLTITCQVSYALSSYWTAWIRQPAGKGLEWIGMKYTGGSYYKDSLKNKFSIELDTSSKTVTLNGQNVQPEDTAVYYCARE
Larimichthys crocea V28 ighv JPYK01040746.1 5040 QSMESIPSSAVVKKPGETLNLSCRGSGFTFSCCVMGWIRQPAGKSLEWIGSGFSDASRNTYASSLRGRIEISRDDSNSMVNLRLSNLKPEDSAVYYCAK
Larimichthys crocea V27 ighv JPYK01040746.1 471 VKCEQLTQPASVTVQPGQRLTITCQVSYALSSYWTGWIRQPAGKGLEWIGSRYTGDASYKDSLKNKFSIDLDTSSKTVTLNGQNVQPEDTAVYYCARD
Larimichthys crocea V26 ighv JPYK01040743.1 211 TEGQTLTESEPVVKRPGESHRLTCTYSGFSSTPHNAWIRQAAGKGLEWLAWIHSDGRSGIYYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Larimichthys crocea V25 trav JPYK01039768.1 6796 NTLEDDITASKPEEFSSEGRSLTLSCSYSVKAQNLQWYRQDPGSAPQFLLLITDTTEPSVVQATPPHPRLTAELNAERNRVDLQISSAAVTDSAVYYCAVT
Larimichthys crocea V24 trav JPYK01038018.1 5918 NTLEDDITVSKPEEFSSEGRSLTLSCSYSVKANNLQWYRQDPGSAPQFLLLITDATEPSVVQATPPHPRLTAELNAERNRVDLQISSAAVTDSAVYYCAVT
Larimichthys crocea V23 igkv JPYK01033856.1 1078 SRGQVTVTQPGAVSSAVGGSVTITCKTSQNVQVWNNYHLLAWYQQRDRETPKRLIHYASTRPSGIPARFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Larimichthys crocea V22 igkv JPYK01033855.1 2498 QVTVTQPGAVSSAVGGSVTINCRTSQNVYVGSNYHHLAWYQQRDGETPKLLIYWASTRVSGIPARFTGSGSNSDFTLTISGVQTEDSAVYYCQSKNRIDNQHL
Larimichthys crocea V21 trav JPYK01033179.1 5009 KSVTFQQSPPKIVNQTTRVEIKCSHDDSNLYAMLWYQQKESRLMDLIGYRYMNNDPVYEKQFEHGFEITRKDTLTGALIIQSVNLSDSAVYFCAVSTQ
Larimichthys crocea V20 trbv JPYK01033179.1 4414 KSVTFQQSPPKIVNQTTRVEIKCSHDDSNLYMMLWYQQKESRLMDLIGYRYMNNDPVYEKQFEHQFEITKGHSTLTGALIIQSVNLSDSAVYFCAAS
Larimichthys crocea V19 trbv JPYK01033179.1 2605 KSVTFQQSPPKIVSQTTRVEIKCSHDDSNLYAMLWYQQKESRLMDLIGYRYMNNDPVYEKQFEHQFEITKGHSTLTGALIIQSVNLSDSAVYFCAAS
Larimichthys crocea V18 trbv JPYK01033179.1 2007 QVSAVTFQQSPPQIVKESSEVNIDCSHDDSSRPLMLWYQQTKDSLSMTLIGYGYQSSPNYEGQFEKEFKLTRESTTRGTLIILRANLSHSAVYFCAASTQ
Larimichthys crocea V17 trbv JPYK01033178.1 13209 KSVTFQQSPPKIVNQTTRVEIKCSHDDSNLYMMLWYQQKESRLMDLIGYRYMNNDPVYEKQFEHQFEITKGHSTLTGALIIQSVNLSDSAVYFCAAS
Larimichthys crocea V16 trbv JPYK01033178.1 12597 KSVTFQQSPPKIVNQTTRVEIKCSHDDSNLYMMLWYQQKESRLMDLIGYRYMNNDPVYEKQFEHQFEITKGHSTLTGALIIQSVNLSDSAVYFCAAS
Larimichthys crocea V15 trbv JPYK01033178.1 11140 SQAVLITQWPHYIVTAPSVLAEMHCYQNDTDYQYMYWYRQRGKSLQLIVTIVGATSSFEEGFKSGFQAVTSKEKQWSLTVPNVQSEHEAVYLCAAS
Larimichthys crocea V14 trbv JPYK01033178.1 10335 FVLSSVVIQQSVNPLIKHEGEEARLDCYHGDNDYPYMFWYQHKSLAGQRAMELIGKLHYENSNLEENFDARFNITGHSKRRAQLVISNIKLTDSAEYFCAAS
Larimichthys crocea V13 trav JPYK01033178.1 7766 FSLGVQVHQSPSAVIRKADGEVQLFCTHGQSDYRVMLWYQQPPGDTALKLVGYGYGEFRNDSVEEPFKKHFRLTGDLGGHKTKNGALSITNLKAPEHTATYFCAARE