WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Lates calcarifer LLXD00000000.1 (LLXD01) 403 164 8 75 62 71 6 17
Lates calcarifer LBLR00000000.1 (LBLR01) 79 37 1 5 13 19 1 3
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Lates calcarifer V22 trgv LLXD01000642.1 96450 VTLGLEVRQSHSDLIIKPGDKVQIFCSHDKTDYRMMLWYQRSPGDTALKLIGYLYFKDVKMEEPYKEHFNISGDLGGSATKNGSLIIQVTGREQSAVYYCAASK
Lates calcarifer V21 trbv LLXD01000642.1 94579 ASVSDKVQQTPADIHKKQEQTAKIYCSHNIDNYYIILWYKQSNRELQLLGYMTGDSENLEPGVNVKIKGNANKGRNCTLTIEGLRTNNSAVYFCVASYHSAT
Lates calcarifer V20 trbv LLXD01000642.1 93742 SSLSDQVHQTPADIQKKPGGTAKIYCSHSIDSYDRIFWYKQLKNKQLQFLGYMFLKNGYPEKGVDVKIEGDANKGQNCTLTIEGLSLNNSAVYFCAAS
Lates calcarifer V19 trbv LLXD01000642.1 92915 SSLSDKVQQTPADIYKNPGQTAKIRCLHKIDNYYTVLWYKQLKNRQLQFLGYMYKDNGNPEKGLNVSMDGSADKGQTSTLTIEGLSLNDSAVYFCAAS
Lates calcarifer V18 trbv LLXD01000642.1 92108 SSLSDKVQQTPADIYKNPGQTAKIRCLHNIQSYNQIFWYKQSKDKKLQLLGYMYGRQFLEPGVNVKIDGGADKGQNCTLTIEGLSLNNSAVYFCAASYHSAT
Lates calcarifer V17 trbv LLXD01000642.1 91056 SSLSDQVHQTPADIQKKPGGTAKIYCSHSIDSYDRIFWYKQLKNKQLQFLGYMLGKDGYPEKGVDVKIDGGANKGQNCTLTIDGLSLSNSAVYFCAASYHSAT
Lates calcarifer V16 trbv LLXD01000642.1 90235 ASVSDKVQQTPADIHKKQEETAKIYCSHNDNSYNQILWYKQSNRELQLLGYMTGDSENLEPGVKVKIEGNANKGQNCTLTIEGLSLNDSAVYFCAAS
Lates calcarifer V15 trbv LLXD01000642.1 89400 SSVSDKVQQTPADIHKKQGQTAKIYCSHNDNNYNQILWYKKSDRELQFLGYMLTISGKPADGVNVKIEGGASKGQNCTLTIEGLSLNNSAVYFCAAS
Lates calcarifer V14 trbv LLXD01000642.1 88536 SSLSDKVQQTPADIYKNPGQTAKIRCLHNIQSYNQILWYKQSKDKKVQLLGYMYITPTLEPGVNVKIDGSADKDQNCTLTIEGLSLNNSAVYFCAASYHSAT
Lates calcarifer V13 trbv LLXD01000642.1 87487 ASLSDKVYQTPADIQKEQEETAKIYCSHGISSYNQILWYKKSDRELQFLGYMTGNIGKPETGVDVKIDGDANTDQNCTLTINKLKPNDSAVYFCAASYHSAT
Lates calcarifer V12 trbv LLXD01000642.1 86637 SSLSDQVQQTPADIYKNPGQTAKIRCLHNIQSYNQILWYKQLKNGQLQFLGYMFKNTGNPEKGLNVSMDGSADKGQNCTLTIEGLSLSSSAVYFCAASYHSAT
Lates calcarifer V11 trbv LLXD01000642.1 84362 ASVSDKVQQTPADIHKKQEETAKIYCSHNDDNYNQILWYKKSDRELQFLGYMTVNTGKPETGVDVKIEGGASKGQNCTLTIERLKPNDSAVYFCVASYHSAT
Lates calcarifer V10 trbv LLXD01000642.1 81368 SSLSDQVHQTPADMYKKPGERATINCSHSIDNYDRILWYKQLKNREPQFLGHMYKDNGNPEKGLNVSMDGSANKGQTSTLTIEGLSLSSSAVYFCAASYHSAT
Lates calcarifer V9 trbv LLXD01000642.1 80582 SSLSDKVQQTPADIYKNPGQTAKIRCLHNIQSYDQILWYKQSKDKKLQLLGYMYGRQFLEPGVNVKIDGGADKGQNCTLTIEGLSLNNSAVYFCAASYHSAT
Lates calcarifer V8 trbv LLXD01000642.1 79264 LSDGSDVTQTPLLWKNEGQSATIDCSHTKDASYFQMYWYRQLPGEMMKQIVFTTTTPPHKYESGFSEDKFPAKKNDAQTGSLTVEKLLHNDSGVYFCAVS
Lates calcarifer V7 trbv LLXD01000642.1 76661 ASDTKRVDQTPPYIIKRAGESVDSEINCAHSIKSYDRILWYKQDEHKAFKYLGYLNLNNPFPENDVKGKISFDGDGSKQSDLTISNLSSNDSGVYFCAAS
Lates calcarifer V6 trbv LLXD01000642.1 73350 ASDTKRVDQTPPVIIKKTGESVTSEIKCSHSIQNHDVILWYKQDEHGLKLLGYLNLDSPYPEDDVKGKISFDGDGRKQSSLTISNLLSSDGGVYFCAAR
Lates calcarifer V5 trbv LLXD01000642.1 71928 ASDTKRVDQTPPVIIKKTGESVTSEIKCSHSIQNHDVILWYKQDEHGLKLLGYLNLDRLYPEDDVKGKISFDGDGSKQSSLTISSLLSNDGGVYFCAAR
Lates calcarifer V4 trbv LLXD01000642.1 69800 ASDTKRVDQTPPVIIKKTGESVTSEIKCSHSITSYNTILWYKQEGQRALKLLGYVFTTTATSEDDVKGKISFDGDGRKQSSLTISNLSSNDSGVYFCAAS
Lates calcarifer V3 trbv LLXD01000642.1 68427 LTDGSDVTQTSILWIKQGENAAMNCSHTKGDLYFQMYWYRQLPGETMKLIVFTRTGNSNHDFGDFSKDKFSATKPNAETGTFTVKNVELGDKGLYFCAVS
Lates calcarifer V2 iglv LLXD01000133.1 1240948 VSGVTVVTQKPPIVTVRKGETVTMDCNLGTVTRSAARWYKQIPGGVPQFVLVYYHGWWSVTYGTGFSSSKHTSNYKDESSYHMIISNVEEGDSAVYYC
Lates calcarifer V1 iglv LLXD01000133.1 1239809 VSGVTVVTQKPPVVTVTKGETVTMDCNLGTVTNYEAVWYKQILGGVPQYVLKSHHSWSSVRYGSGFSSPKFTSNHQSTSDYRLIINTVEEGDSAVYYCKTK
Lates calcarifer V0 iglv LLXD01000133.1 1235277 VSGVMVVTQKPPIVTVTKGETVTMDCDVFTDDGSRWYKQIPGVVPQFVLRNHYSYSSPKYGAGFSSPKFTSSHLSGTMYRLIINNVEEGDSAVYYCETWNDSVKENI
Lates calcarifer V59 ighv LLXD01000758.1 1089 VDGQTLTESEPVVKRPGESHTLTCTYSGFGGNYNKAWIRQVPGKGLEWITYISGSGSSKHYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V58 trbv LLXD01000741.1 62796 HASAVTFQQSPLQIVKENSEVHINCTHDDSTLLLMLWYQQREDSLSMTLITYGYAKTNPNYEGQFDKQFKLTREDATSGTLTIQRANLSHSAVYFCAASTQ
Lates calcarifer V57 trbv LLXD01000741.1 60220 FSLGVQVHQSPSALFRKVGDNVQLFCTHGQTDYRVMLWYQQSPGDKALKLLGYGYTQFNDDSVEEPFRKHFKLAGDLKGDQKNGSLSITDLKAPEHTAVYFCAASK
Lates calcarifer V56 trgv LLXD01000741.1 59359 VSLGLEVRQSHSDLIKKPGDKVQIFCSHDKTDYRVMLWYQRSPGDTALKLIGYLNFKDVKMEELYDEDFKISGDLSGNTAKNGSLILNLAEKEHSAVYYCAARE
Lates calcarifer V55 trav LLXD01000741.1 58618 VSLGLEVHQSHSDLIKKPGDKVQIFCSHDKTDYTLMLWYQRSPGDTALKLIGYLYNQAVKMEKEYEEHFHISGDLRGVAAKNGSLIVQITGHEQSAVYYCAASY
Lates calcarifer V54 trav LLXD01000741.1 57966 RCQDVTQHPAISWNYESKSAEMNCSHNKDIYHTQMYWYRQRPEETMTLIVYTVYEGKSDYGRLPQTKYETIKDTVQTGALTVKNLQPEDSGVYFCAVS
Lates calcarifer V53 trbv LLXD01000741.1 56975 SSLSDKVKQSPAHMFTKPQEKAKITCSHSIQDYNRIYWYKQAKNKELQLLGYMNVNNGYPEDGLDVKIEGSALKNEVCNLTTEGLQLNDNAVYFCAA
Lates calcarifer V52 trbv LLXD01000741.1 54590 FSVSVNVKQTPADIYKDTGEEARINCSHDSTSYDRIYWYKQLQNRQLQLLGYMNFEKDNPEAGAGVKLEGGASKDQTCTLIIEELTWNNTAVYFCGASYHSAT
Lates calcarifer V51 trbv LLXD01000741.1 53341 SSLSDKVEQTPADIYKKPKEEARINCSHSIDNYYRILWYKQLKDKQLQFLGYMNLKDGVPEAGANVKIEGDANKGQTCTLIIEELTWNNSAVYFCAASYHSAT
Lates calcarifer V50 trbv LLXD01000741.1 52152 SSLSDQVHQTPADMYKKPGESATISCSHSIQSYDQILWYKQSEGQLQLLGYVYFNTGYPEAGANAKMEGGANKGQTASLTVEALSLSSSAVYFCAAS
Lates calcarifer V49 trbv LLXD01000741.1 51280 SSLSDKVKQTPADISKEPGEEARINCSHTIDSYERIYWYKQLKDRQLQFLGYMNLAFSNPEAGAGVKMEGGASKGQTCTLIIEKLTWNNSAVYFCAASYHSAT
Lates calcarifer V48 trdv LLXD01000741.1 49105 RSLSNKVDQAPTSILGGPHDSATISCSHSVSSYNIILWYHQPVGDSALKLIGHILYTNPTLEEKFKQHFNVTGDGSSKSLLHVLKFRQPEDSGMYYCAAS
Lates calcarifer V47 trbv LLXD01000741.1 46879 LTDGSDVTQTPLLWKNEGHSATMDCSHTKGIDHDQMYWYRQLPGEMMKQIVLTTTTPPHKYESGFSEDKFPAKKNDAQTGSLTVEKLLHNDSGVYFCAVS
Lates calcarifer V46 trbv LLXD01000741.1 44641 LSDGSDVQQVSILWEKRGNNATIQCRHTKDASYTQMYWYRQLPGETMKQVVFTRLGNNYHDFGNFSKEKFSATKPDSYSGTFTVKNLVPEDKGLYFCAVS
Lates calcarifer V45 trbv LLXD01000741.1 43066 LSDGNDVNQTPLLWSTESQSATMNCSHTKGSSYRQMYWYRQLPGETMKQIVYTTAYSPHEYQSGFSEDKFPAKKNDAETGSLTVKKLLHNDSGVYFCAVS
Lates calcarifer V44 trbv LLXD01000741.1 40748 LSDESDVNQTPLLWSTEGQSATMNCSHTKGSTYWLMYWYRQLPGETMKQIVFTTTATPNHDFGDFSKDKFSATKPNAETGTFTVKNVEPGDKGLYFCAVS
Lates calcarifer V43 trbv LLXD01000741.1 39074 LIDGSDVNQTPILWRKQGDNATIHCNHTKGTYYNQMYWYRQLPGETMKQIVFTTTATPNHDFGDFSKDKFSATKPNAETGTFTVKNVELGDKGSYFCAVS
Lates calcarifer V42 trav LLXD01000741.1 27414 FSCCVKIHQPPFIFSHGSDTSVTLQCEQDDDEYSSMFWYRHRDSGKIQLITYSLGKDVWNIDTPFNKSKYTMSRPAVLSSSLQIKPVEAEDSAVYYCASSR
Lates calcarifer V41 trbv LLXD01000741.1 25148 STTFQPSHPRIVKERARVEIKCSHDNNDLNIMLWYQQTKSGLMNLIGYNYIGSDPNYEKQFEHQFEITRENIRTGALIIHSVNVSDSAVYFCAASTQ
Lates calcarifer V40 trbv LLXD01000741.1 24526 QASAVTFLQSPPQIVKENSEVHINCSHDDSTLVIMLWYQQSKDSLSMTLIGYGYESSQNYEGLFEEQFTMTRQNTVKGTLIIHRASLSHSAVYFCAASTQ
Lates calcarifer V39 trbv LLXD01000741.1 19697 VSLGLEVRQSHSDLIKKPGDKVQIFCSYDKTDYRMMLWYQCSPGDTALKLIGYLNYKDVKMEELYDEDFNISGDLSVNTVKNGSLILEHAKQEHSAVYYCAASK
Lates calcarifer V38 trgv LLXD01000741.1 17811 VSLGLEVRQSHSDLIIKPGDKVQIFCSHDKTDYRMMLWYQRSPGDTALKLIGYLYFKDVKMEEPYKEHFNISGDLGGSATKNGSLIIQVTGREQSAVYYCAASK
Lates calcarifer V37 trbv LLXD01000741.1 15940 ASVSDKVQQTPADIHKKQEQTAKIYCSHNIESYYIILWYKQSNRELQLLGYMTGDSEKLEPGVKVKIEGNANKGQNCTLTIEGLRTNNSAVYFCAASYHSAT
Lates calcarifer V36 trbv LLXD01000741.1 15102 SSLSDQVHQIPADIQKKPGGTAKIYCSHSIDSYDRILWYKQLKNKQLQFLGYMLGKDGYPEKGVDVKIEGDANKGQNCTLTIEGLSLSSSAVYFCAASYHSAT
Lates calcarifer V35 trbv LLXD01000741.1 14277 SSLSDKVQQTPADIYKNPGEKAKINCLHKIDNYYTFLWYKQLKNRQLQFLGYMYKDNGNPEKGLNVSMDGSADKGQTSTLTIEGLSLNDSAVYFCAAS
Lates calcarifer V34 trbv LLXD01000741.1 13467 ASVSDKVQQTPADIHKKQEQTAKIYCSHSIDSYNRILWYKQLKNGQLQFLGYMFKNTGNPEKGLNVSMDGSADKGQNCTLTIEGLSLSSSAVYFCAAS
Lates calcarifer V33 trbv LLXD01000741.1 12633 ASVSDKVQQTPADIHKKQGQTAKIYCSHNDDNYDQILWYKKSDRELQFLGYMLTISGKPADGVNVKIEGGASKGQNCTLTIEGLSLNNSAVYFCAAS
Lates calcarifer V32 trbv LLXD01000741.1 11769 SSLSDKVQQTPADIYKNPGQTAKIRCLHNIQSYDQILWYKQSKDKKVQLLGYMYITPTLEPGVNVKIDGSADKDQNCTLTIEGLSLNNSAVYFCAASYHSAT
Lates calcarifer V31 trbv LLXD01000741.1 9490 ASVSDKVQQTPADIHKKQEETAKIYCSHNDNNYNQILWYKKSDRELQFLGYMTVNTGKPETGVDVKIEGGASKGQNCTLTIERLKPNNSAVYFCAASYHSAT
Lates calcarifer V30 trbv LLXD01000741.1 7278 ASVSDKVYQTPTDIHKKQEETAKIYCSHNDNSYNQILWYKQLKDKKLQLLGYMYITPTLEPGVNVKIEGSADKGQNCTLTIEGLSLNNSAVYFCAASYHSAT
Lates calcarifer V29 trbv LLXD01000741.1 6468 SSLSDQVHQTPADMYKKPGERATINCSHSIDNYDQILWYKQLKNREPQFLGYMYKDNGNPEKGLNVSMDGSANKGQTSTLTIEGLSLSSSAVYFCAASYHSAT
Lates calcarifer V28 trbv LLXD01000741.1 5683 SSLSDKVQQTPADIYKNPGQTAKIRCLHNIQSYDQILWYKQSKDKKLQLLGYMYGRQFLEPGVNVKIDGSADKGQNCTLTIEGLSLNNSAVYFCAARYHSAT
Lates calcarifer V27 trbv LLXD01000741.1 4362 LSDGSDVTQTPLLWKNEGQSATIDCSHTKDASYFQMYWYRQLPGEMMKQIVFTTTTPPHKYESGFSEDKFPAKKNDAQTGSLTVEKLLHNDSGVYFCAVS
Lates calcarifer V26 trav LLXD01000655.1 83386 VKFSSSVHQQSDFLSVEAGGSVTLHCFYKDDGTAWLYWYKQTLGQKPRLVSTFFVYDERGTFYHEFKNNPRFTLETKNGRNHLTISNLRTSDSATYYCARDY
Lates calcarifer V25 trbv LLXD01000642.1 103164 QASAVTFLQSPPQIVKENSEVHINCSHDDSNLVIMLWYQQSKDSLSMTLIGYGYESSQNYEGLFEEQFTMTRQNTVKGTLIIHRASLSHSAVYFCAASTQ
Lates calcarifer V24 trbv LLXD01000642.1 102234 VSQSVTITQWPHYISRPPGGLAEIHCYQNDTDYEYLYWYKQLRGKDIQLVVVLVVGTPNFEEGFKSGFQAVKVNEKQWSLTISSVQGKDEAFYLCAASSHSAV
Lates calcarifer V23 trbv LLXD01000642.1 98336 VSLGLEVRQSHSDLIKKPGDKVQIFCSYDKTDYRMMLWYQRSPGDTALKLIGYLNYKDVKMEELYDEDFNISGDLSVNTVKNGSLILEHAKQEHSAVYYCAASK
Lates calcarifer V98 trbv LLXD01000801.1 32610 SSLSDKVKQTPADIYKKPKEEAIINCSHSIDNYYRILWYKQLKDRQLQLLGYMDYDKANPEAGAGVKIEGDANKDQTCTLIIDGLSLNNSAVYFCAASYHSAT
Lates calcarifer V96 trbv LLXD01000801.1 29636 SSLSDKVEQTPADIYKKPKEEAIISCSHSIDNYYRILWYKQLKDNQMQLLGYMDNSRANLEAGVNVKIEGDANKDKNCTLIIENLTWNNSAVYFCAASYHSAT
Lates calcarifer V95 trbv LLXD01000801.1 27554 SSLSDKVEQTPVDIYKKPKEEARINCSHSIDNYYAILWYKQLKDKQLQFLGYMNLKDGVPEAGAVVKIEGDANKGQTCTLIIERLVPNNSAVYFCAASYHSAT
Lates calcarifer V94 trbv LLXD01000801.1 26366 SSLSDQVHQTPADMYKKPGENATISCSHSIQSYDQILWYKQSEGQLQLLGYVYFNTGYPEAGANAKMEGGANKGQTATLTVEALSLNNSAVYFCAAR
Lates calcarifer V93 trbv LLXD01000801.1 25497 SSLRVKQTPADIYKKPKEEARINCSHSIDDYYTILWYKQLKDRQLQLLGYMNYEKDNPEAGAGVKLEGGASKGQTCTLIIEELTWNNSAVYFCAASYHSAT
Lates calcarifer V92 trbv LLXD01000801.1 24667 SSLSDKVKQTPADISKEPGEEARINCSHTIDSYERIYWYKQLKDRQLQFLGYMNLAFSNPEAGAGVKMEGGASKGQTCTLIIEELTWNNSAVYFCAASYHSAT
Lates calcarifer V91 trdv LLXD01000801.1 22490 RSLSNKVDQAPTSILGGPHDSATISCSHSVSSYNVILWYHQPVGDSALKLIGHILYTNPTLEEKFKQHFNVTGDGSSKSLLHVLKFRQPEDSGMYYCAAS
Lates calcarifer V90 trbv LLXD01000801.1 19763 LSDGNDVNQTPLLWSTESQSATMNCSHTKGSSYRQMYWYRQLPGETMKQIVYTTAYSPHEYQSGFSEDKFPAKKNDAETGSLTVKKLLHNDSGVYFCAVS
Lates calcarifer V89 trbv LLXD01000801.1 18999 LSDGNDVNQTPLLWSTEGQSATMNCSHTKDATFYQMYWYRQLPGETMKLIVFTTTATPNHDFGDFSKDKFSATKPDVETGTFTVKNLVPEDKGLYFCAVS
Lates calcarifer V88 trbv LLXD01000801.1 17446 LSDESDVNQTPLLWSTEGQSATMNCSHTKGSTYWLMYWYRQLPGETMKQIVFTTTATPNHDFGDFSKDKFSATKPDAETGTFTVKNVEPGDKGLYFCAVS
Lates calcarifer V87 trbv LLXD01000801.1 15766 LIDGSDVNQTPILWRKQGDNATIHCNHTKGTYYNQMYWYRQLPGETMKQIVFTTTATPNHDFGDFSKDKFSATKPDAETGTFTVKNVEPGDKGLYFCAVS
Lates calcarifer V86 trav LLXD01000801.1 4540 FSCCVKIHQPPFIFSHGSDTSVTLQCEQDDDEYSSMFWYRHRDSGKIQLITYSLGKDVWNIDTPFNKSKYTMSRPAVLSSSLQIKPVEAEDSAVYYCASSR
Lates calcarifer V85 trbv LLXD01000801.1 2281 STTFQPSHPRIVKERARVEIKCSHNNNDLNIMLWYQQTKSGLMNLIGYNYIGSDPNYEKQFEHQFEITRENIRTGALIIHSVNVSDSAVYFCAASTQ
Lates calcarifer V84 ighv LLXD01000758.1 54763 VDGQTLTESEPVVKRPGESHRLTCTASGLSISSYYMAWVRQAPGKGLEWITSISGGGSIYYSQSFQGRFTISRDDSRQQVYLQMNSLKTEDSAVYYCARNQ
Lates calcarifer V83 ighv LLXD01000758.1 52195 VDGQTLTQSEPVVKRPGESHTVTCTTFGLSFSSYYMGWIRQTPGKGLEWIATISNGGGSTYYPQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARR
Lates calcarifer V82 ighv LLXD01000758.1 49694 VDGQTLTQSEPVVKRPGESHRLTCTTSGFTFSSYWMAWVRQAPGKGLEWIATISSGGGSSTYYSQSVQGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCAR
Lates calcarifer V81 ighv LLXD01000758.1 46628 WTITESEPAVKRPGESHRLTCTTSGLSFSSSWMAWIRQAPGKGLEWIATDTNGGSNRYSQSVQGRFTISRDNSREQVYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V80 ighv LLXD01000758.1 44003 VKCEQLTQPASVTVQPGQHLTITCQVSYSVSDYYTAWIRQPAGKELEWIGHAAAGYTTYYKDSLKNKFSISTDSSSNTVTLNGQNVQPEDTAVYYCARD
Lates calcarifer V79 ighv LLXD01000758.1 39278 WTITESEPAVKRPGESHRLTCTTSGLSFSSYWMAWIRQAPGKGLEWIATDGGGSSKYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARDTQ
Lates calcarifer V78 ighv LLXD01000758.1 37361 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSWYTAWIRQPAGKQLEWIGSARVGYTTYYKDSLKNKFSISLDSSRNTVTLNGQNVQPEDTAVYYCARDTQ
Lates calcarifer V77 ighv LLXD01000758.1 35946 VDGQTLTPSEPVVKRPGESHTLTCTASGFTFSSYYMGWIRQAPGKGLEWVASISYGGGSSKFYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARG
Lates calcarifer V76 ighv LLXD01000758.1 34368 VNCEQLTQPASVTVQPGQHLTITCQVSYSVSSYWTAWIRQPAGKELEWIGHASAGSTTRYKDSLKNKFSITTDSSSNTVTLNGQNVQPEDTAVYYCAR
Lates calcarifer V75 ighv LLXD01000758.1 31102 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSSYNMNWIRQAPGKGLEWVAYISYDSSSKYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V74 ighv LLXD01000758.1 28275 VKCEQLTQPASVTVQPGQRLTITCQVSYYLSSYATAWIRQPAGKGLEWIGRRGGGYNTYYKDSLKNKFSINLDTSSKTVTLNGQNVQPEDTAVYYCARDTT
Lates calcarifer V73 ighv LLXD01000758.1 26327 VDGQTLTQSEPVVKRPGESHTLTCTASGFTFSSYNMAWIRQAPGKGLEWVALHGTGSNKYYSQSVQGRFTISRDNSREQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V72 ighv LLXD01000758.1 24917 VDGQTLTESEPVVKRPGESHTLTCTASGFTLSSYYMAWIRQAPGKGLEWLARIDSGSGSYKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V71 ighv LLXD01000758.1 23480 VDGQTLTESEPVVKRPGESHRLTCTVSGFTLSSYYMAWVRQAPGKGLEWIAFIHTGSTSIYYSQSVQGRFTISRDDYSSKIYLQMTSLKTEDTAVYYCARE
Lates calcarifer V70 ighv LLXD01000758.1 22042 VKCEQLTQPASVTVQPGQHLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGYAAAGSTTYYKDSLKNKFSINTDSSSSTVTLNGQNVQPEDTAVYYCAR
Lates calcarifer V69 ighv LLXD01000758.1 20034 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSYAMAWVRQAPGKGLEWIAWHDSGSGSTTYYSQSVRGWFTISKDNSRQQLYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V68 ighv LLXD01000758.1 16877 VDGQTLTESEPVVKRPGESHRLTCTVSGFTLSSYPMNWVRQAPGKGLEWIAFIHTGSSHIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCA
Lates calcarifer V67 ighv LLXD01000758.1 15154 VDGQTLTESEPVVKRSGESHRLTCTASGFSFSGYWMGWIRQAPGKGLEWIASISDDSSSTYYSQSVQGRFTISRDDSRQQVYLQMKSLKTKDSAVYYCARE
Lates calcarifer V66 ighv LLXD01000758.1 14172 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTDNNYGTGWIRQREGKLMDWIFYMWGGGSFYQNDALKNKFSYNRDTSARTVTITGQNLQPEDTAVYYCARY
Lates calcarifer V65 ighv LLXD01000758.1 12211 VDGQTLTESEPVVKRPGESHRLTCTGSGFIFSSLYLAWIRQAPGKGLEWIAYINTGGGYKSYSQSVLGRFAISKDHSREQVYLQMNSLKTEDSAVYYCA
Lates calcarifer V64 ighv LLXD01000758.1 10941 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYATHWIRQPAGKELEWIGYRSTGGFNYKDSLKNKFSISLDSSSKTLTLNGQNVQPEDTAVYYCARDTQ
Lates calcarifer V63 ighv LLXD01000758.1 9536 VKCEQLTQPASVTVQPGQHLTITCQVSYSLSSYWTGWIRQPAGKGLEWIGYGCAGCTSIYKDSLKNKFSISAESSSSTVTLNGQNVQPEDTAVYYCAR
Lates calcarifer V62 ighv LLXD01000758.1 5843 VKCVQLTQPASVTVQPGQRLTITCQVSYSVSSYRTAWIRQPAGKGLEWIGSARVGYTTYYKDSLKNKFSIDIDSSSNTATLNGQNVQPEDTAVYYCAR
Lates calcarifer V61 ighv LLXD01000758.1 3597 VKKPGETLSLSCRGSGFTFSCCSMHWVRQPVGKALEWIGRIYSDASRTDYSSSVQGRIEITRDNSNSMVHLRLSNLKPEDSAVYYCAKH
Lates calcarifer V136 trgv LLXD01002491.1 2720 VTLGLEVRQSHSDLIIKPGDKVQIFCSHDKTDYRMMLWYQRSPGDTALKLIGYLYFKDVKMEEPYKEHFNISGDLGGSATKNGSLIIQVTGREQSAVYYCAASK
Lates calcarifer V135 igkv LLXD01001850.1 4844 CSGQVTVTQPPVLTTTPGSTVTITCKTSQDVYTYSDGDQAMFWYQQKSGQPPKLLITYVSSHESGTPARFSGSGSGSDFTLTISGVQAEDAAVYYCQSYHEISGADVL
Lates calcarifer V134 trav LLXD01001652.1 10956 FSLCVKINQPPFAFIREGDPSVTLQCEQDDSQFYYMFWYRQSNSGKMDLVTYSINKDNVNTEAPFNKSKYTMSRPAVLSSSLQIKPVEAEDSAVYYCASSR
Lates calcarifer V133 trbv LLXD01001652.1 8537 KVKSVTFEQSPSQIVKKGTKELRINCSHDGSNLQTMLWYQHKPSSQSMSLIGYTVLTSDPVFEDQFKDRFQLKREDILRGSLIILTVDSSDSAVYFCAASTH
Lates calcarifer V132 trbv LLXD01001652.1 5576 HASAVTFQQSPLQIVKENSEVHINCTHDDSTLLLMLWYQQREDSLSMTLITYGYAKTNPNYEGQFDKQFKLTREDATSGTLTIQRANLSHSAVYFCAASTQ
Lates calcarifer V131 trbv LLXD01001652.1 3001 FSLGVQVHQSPSALFRKVGDNVQLFCTHGQTDYRVMLWYQQSPGDKALKLLGYGYTQFNDDSVEEPFRKHFKLAGDLKGDQKNGSLSITDLKAPEHTAVYFCAASK
Lates calcarifer V130 trgv LLXD01001652.1 2138 VSLGLEVRQSHSDLIKKPGDKVQIFCSHDKTDYRVMLWYQRSPGDTALKLIGYLNFKDVKMEELYDEDFKISGDLSGNTAKNGSLILNLAEKEHSAVYYCAARE
Lates calcarifer V129 trav LLXD01001560.1 22134 VIHSATVKQDTGVVSASVGDNVTLRCFYDSQVAMHFSWYRQTLGGRPELMSTIYKYDQPSKVFHWLEKNPRFSVHREQGMNHLHIADIHLSDSATYFCGS
Lates calcarifer V128 igkv LLXD01001109.1 19943 TFTPGSTVTITCKTSQDVDVYCASAAAAAAAECLHWYQQKSGQPPKLLISVVSDHESGTPARFSGSGSDSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V127 igkv LLXD01001109.1 15420 LTTTPGSTVTITCKTSQDVADCVSSVGEDGDVTFAECLHWYQQKSGQPPKLLINSVSSRESGTPDRFSGSGSDSDFTLTISGVQAEDAAVYYCQSLHEINSADV
Lates calcarifer V126 igkv LLXD01001109.1 12291 CSGQVTVTQPPVLTTTPGSTVTITCKTSQDVDVYCGSAECLHWYQQKSGQPPKLLISVVSDHESGTPARFSGSGSGSDFTLTISGVQAEDAAVYYCQSLHEINSAYV
Lates calcarifer V125 ighv LLXD01000880.1 51861 VDGQTLTESEPVVKRPGESHTLTCTASGFSFSSYDMAWVRQTPGKGLEWIAWIYSSGSSKSYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V124 ighv LLXD01000880.1 49118 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSSYGMAWIRQAPGKRLEWIAYISTDSSPIYYSQSVQGRFTISRDDSSSKLYLQKNSLKTEDTAVYYCAR
Lates calcarifer V123 ighv LLXD01000880.1 47629 VKCEQLTQPASVTVQPGQRLTITCQVSYSVGSYYTGWIRQPAGKGLEWIGSKYTGGTAYKDSLKNKFSIDVDSSSNTATLNGQNVQPEDTAVYYCARDTQ
Lates calcarifer V122 ighv LLXD01000880.1 44380 VDGQTLTESEPVVKRPGESHTLTCTASGFTLSSYHMAWVRQAPGKGLEWVAWLDSSGSSKHYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V121 ighv LLXD01000880.1 42799 VNCVQLTQPASVTVQPGQRLTITCQVSYSVSRFRTSWVRQPAGKKMEWIGSRHVGYDTYYKNSLKNKFSISLDSSRNTVTLNGQNVQSEDTAVYYCAR
Lates calcarifer V120 ighv LLXD01000880.1 40773 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSSYGMAWIRQAPGKRLEWIAYISTDSSPIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCAR
Lates calcarifer V119 ighv LLXD01000880.1 39403 VKCQQLTQPASVTVQPGQHLTITCQVSYSVGSYYTAWIRQPAGKGLEWIGMKYTGASYYKDSLKNKFSIDVDSSSNTATLNGQNVQPEDTAVYYCA
Lates calcarifer V118 ighv LLXD01000880.1 35085 VDGQTLTESGPVVKRPGGSHTLTCTGSGFTFSSYYMAWIRQAPGKGLEWIAWVQSSGGSEKYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V117 ighv LLXD01000880.1 33937 VKCEPLTQPASVTVQPGQRLTITCQLSYSVSGYWTAWIRQPAGKGLEWIGMRSTGGSYYKDSLKNKFSIDVDSSSNTVTLNGQNVQPEDTAVYYCARDTQ
Lates calcarifer V116 ighv LLXD01000880.1 31719 VKCEQLTQPASVTVQPGQHLTITCQVSYSVGSHHTVWIRQPAGKELEWIIGGRVGHTTFYKDSLKNKFSISLDSSSNTVTLNGQNVQPEDTAVYYCAR
Lates calcarifer V115 ighv LLXD01000880.1 30174 VKCEQLTQPVSVTVQPGQRLTITCQVSYSVSSLYTDWIRQPAGKELEWIGRAHTGGSYYKDSLKSKFSISADSSSKTVTLNGQNMQPEDTAVYYCA
Lates calcarifer V114 ighv LLXD01000880.1 26556 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSDYYTAWFRQPAGKEMEWIGMRDTGSSHYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDTAVYYCAR
Lates calcarifer V113 ighv LLXD01000880.1 25012 VKCEQLTQPASVTVQPGQRLIITCQVSYSVGSYHTAWIRQPAGKTLEWIGSRRDGGSSYYKDSLKNKFSIDLDSSSKTVTLNGQNVQPEDTAVYYCARDTQ
Lates calcarifer V112 ighv LLXD01000880.1 23740 VDGQTLTESEPVVKRPGESHTLTCTGSGFTFSDYSMHWIRQAPGKGLEWVAFISNSGGSYIYYSQSVQGRFTISRDDSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V111 ighv LLXD01000880.1 19811 VDGQTLTQSEPVVKRPGESHRLTCTGSGFTFSDHWMGWVRQAPRKGPEWISFISSGDGSTTHYSQSVQGRFTISRDNSREQVYLQMNSLKTEDSAVYYCARD
Lates calcarifer V110 ighv LLXD01000880.1 13249 VDGQTLTQSEPVVKRPGESHRLTCTGSGFTFSSQPMVWVRQAPGKGPEWIAYIGTSSSPIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCAR
Lates calcarifer V109 ighv LLXD01000880.1 12284 VDGQTLTESEPVVKRPGESHRLTCTASGFTLSGYHMDWVRQAPGKGLEWIAFIYTSSSYIHYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCA
Lates calcarifer V108 ighv LLXD01000880.1 11094 VKRPGETLSLSCRGSGFTFTCCGMNWIRQPAGKPLEWIGVGHIPASSNAYSSSVRGRAEISRDDSNSMVHLRLSNLKPEDSAVYYCAKH
Lates calcarifer V107 trav LLXD01000880.1 7538 PIKNACFNVQAFIPLAVPPQEALSLSCRGTGFTFSQHGMHWIRQPAGKALEWMGLIYYDASKTVYASSEQGRIEITRDNSNSMVNLRLSNLKPEDSAVYYCAR
Lates calcarifer V106 trav LLXD01000801.1 46324 FSLCVKINQPPFAFIREGDPSVTLQCEQDDNQFYYMFWYRQSNSGKMDLVTYSTSKDNANTEAPFNKSKYIMSRPAVLSSSLQIKPVEAEDSAVYYCASSR
Lates calcarifer V105 trbv LLXD01000801.1 43926 KVKSVTFEQSPSQIVKKGTKELRINCSHDGSNLQRMLWYQHKPSSQSMSLIGYTVLTSDPVFEDQFKDRFQLKREDILRGSLIILTVDPSDSAVYFCAASTH
Lates calcarifer V104 trbv LLXD01000801.1 40975 HASAVTFQQSPLQIVKENSEVHINCTHDDSTLLLMLWYQQREDSLSMTLITYGYAKTNPNYEGQFDKQFKLTREDATSGTLTIQRANLSHSAVYFCAASTQ
Lates calcarifer V103 trbv LLXD01000801.1 38399 FSLGVQVHQSPSALFRKVGDNVQLFCTHGQTDYRVMLWYQQSPGDKALKLLGYGYTQFNDDSVEEPFRKHFKLAGDLKGDQKNGSLSITDLKAPEHTAVYFCAASK
Lates calcarifer V102 trgv LLXD01000801.1 37538 VSLGLEVRQSHSDLIKKPGDKVQIFCSHDKTDYRVMLWYQRSPGDTALKLIGYLNFKDVKMEELYDEDFKISGDLSGNTAKNGSLILNLAEKEHSAVYYCAARE
Lates calcarifer V101 trav LLXD01000801.1 36797 VSLGLEVHQSHSDLIKKPGDKVQIFCSHDKTDYTLMYWYQRSPGDTALKLIGYLYNQAVKMEKEYEEHFHISGDLRGVAAKNGSLIVQITGHEQSAVYYCAASY
Lates calcarifer V100 trav LLXD01000801.1 36145 RCQDVTQHPAISWNYESKSAEMNCSHNKDIYHTQMYWYRQRPEETMTLIVYTVYEGKSDYGGLPQTKYETIKDTVQTGALTVKNLQPEDSGVYFCAVS
Lates calcarifer V174 ighv LLXD01000042.1 2611881 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTDNNYGTGWIRQHEGKPMDWIFYMWGGGSFYQNDALKNKFSYNRDTSARTVTITGQNLQPEDTAVYYCARY
Lates calcarifer V173 ighv LLXD01000042.1 2613425 VDGQTLTESEPVVKRPGESHRLTCTGSGFIFSSLYLAWIRQAPGKGLEWIAYINTGGGYKSYSQSVLGRFAISKDHSRKQVYLQMNSLKTEDSAVYYCA
Lates calcarifer V172 ighv LLXD01000042.1 2614951 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYATHWIRQPAGKELEWIGYRSTGGFNYKDSLKNKFSISLDSSSKTLTLNGQNVQPEDTAVYYCARDTQ
Lates calcarifer V171 ighv LLXD01000042.1 2616349 VKCEQLTQPASVTVQPGQRLTITCQVSYSLSSYWTAWIRQPAGKGLEWIGYGCAGCTSIYKDSLKNKFSISAESSSSTVTLNGQNVQPEDTAVYYCAR
Lates calcarifer V170 ighv LLXD01000042.1 2618312 VDGQNLKESEPVAKRPGESHRLTCTASGIIWLTFSSYAMAWIRQAPGKGLEWIAYIDTSSSPIYYSQSVQGRFTISRDDSSAHVYLQMNSLKTEDTAVYFCAR
Lates calcarifer V169 ighv LLXD01000042.1 2619931 VKCVQLTQPASVTVQPGQRLTITCQVSYSVSSYWTGWIRQPAGKGLEWIGYAAGSSAYYKDSLKNKFSISLDSSSNTATLNGQNVQPEDTAVYYCAR
Lates calcarifer V168 ighv LLXD01000042.1 2622205 CTGQRMESISSSSVVKKPGETLSLSCRGSGFTFSCCSMHWVRQPVGKALEWIGRIYSDASRTDYSSSVQGRIEITRDNSNSMVHLRLSNLKPEDSAVYYCA
Lates calcarifer V167 ighv LLXD01000042.1 2623350 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSGYYTGWIRQPAGKRLEWIGSAAGSTTYYKDSLKNKFSISTDSSSNTVTLNGQNVQPEDTAVYYCARD
Lates calcarifer V166 ighv LLXD01000042.1 2624676 VDGQTLTESEPVVKRPGESHTLTCTYSGFGGNYNKAWIRQVPGKGLEWITYISGSGSSKHYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V165 ighv LLXD01000042.1 2626146 VNCEQLTQPASVTVQPGQHLTITCQVSYSLSSYWTGWIRQPAGKGLEWIGIKYTGGSYYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDTAVYYCARDTQ
Lates calcarifer V164 ighv LLXD01000042.1 2628282 VNGQTLTQSEPVVKRPGESHTLTCTTSGFTFSDYYMHWIRQAPGKGLEWVARIESGSGSSKLYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V163 ighv LLXD01000042.1 2630333 VDGQTLTESEPVVKRPGESHTLTCTASGFSFSSYDMAWVRQAPGKGLEWVAWIYSSGSSKSYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V162 ighv LLXD01000042.1 2633077 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSSYGMAWIRQAPGKRLEWIAYISTDSSPIYYSQSVQGRFTISRDDSSSKLYLQKNSLKTEDTAVYYCAR
Lates calcarifer V161 ighv LLXD01000042.1 2634565 VKCEQLTQPASVTVQPGQRLTITCQVSYSLSSYWTGWIRQPAGKGLEWIGSKYTGGTAYKDSLKNKFSIDVDSSSNTATLNGQNVQPEDTAVYYCARDTQ
Lates calcarifer V160 ighv LLXD01000042.1 2637309 VDGQTLTESEPVVKRPGESHTLTCTASGFTLSSYHMAWVRQAPGKGLEWVAWLDSSGSSKRYSQSVQGRFTISRDNSRQQVYLQMSSLKTEDSAVYYCARE
Lates calcarifer V159 ighv LLXD01000042.1 2638138 QNTSSSQIQPASVTVQPDQRLTITCQVSYSVSDYFTAWIRQPAGKELEWFGMRYTGDSHYKESLKNKFSINVDSSSKTVTLNGQNLQPEDTAVYYCAR
Lates calcarifer V158 ighv LLXD01000042.1 2639015 TVPLSLLNLNTQSEPVVKRPGESHTLTCTASGLSFSSYTMNWIRQAPGKGLEWIALVHTSSTPISYSQSVQGRFTISRDDSSSKVYLQMKRLKSEDTAVYYCA
Lates calcarifer V157 ighv LLXD01000042.1 2639998 VDGQTLTESGPVVKRPGGSHTLTCTGSGFTFSSYYMAWIRQAPGKGLEWIAWVQSSGGSEKYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V156 ighv LLXD01000042.1 2641153 VKCEPLTQPASVTVQPGQRLTITCQLSYSVSGYWTAWIRQPAGKGLEWIGMRSTGGSYYKDSLKNKFSIDVDSSSKTLTLNGQNVQPEDTAVYYCARDTQ
Lates calcarifer V155 ighv LLXD01000042.1 2643380 VKCEQLTQPASVTVQPGQHLTITCQVSYSVGSHHTVWIRQPAGKELEWIIGGRVGHTTFYKDSLKNKFSISLDSSSNTVTLNGQNVQPEDTAVYYCAR
Lates calcarifer V154 ighv LLXD01000042.1 2644939 VKCEQLTQPVSVTVQPGQRLTITCQVSYSVSSLYTDWIRQPAGKELEWIGRAHTGGSYYKDSLKSKFSISADSSSKTVTLNGQNVQPEDTAVYYCA
Lates calcarifer V153 ighv LLXD01000042.1 2646812 VDGWTLTESEPVVKRPGESHTLTCTVSGFTFSDYSMHWVRQAPGKGLEWVAYIRYDFSGTTFYSQSVQGRFTISRDDSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V152 ighv LLXD01000042.1 2648553 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSDYYTAWFRQPAGKELEWIGMRDTGSSHYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDTAVYYCAR
Lates calcarifer V151 ighv LLXD01000042.1 2650078 VKCEQLTQPASVTVQPGQRLTITCQVSYSVGSYHTAWIRQPAGKTLEWIGSRRDGGSSYYKDSLKNKFSIDLDSSSKTVTLNGQNVQPEDTAVYYCARDTQ
Lates calcarifer V150 ighv LLXD01000042.1 2652008 VDGQTLTESEPVVKRPGESHTLTCTGSGFTFSDYSMHWIRQAPGKGLEWVAFISNSGGSYIYYSQSVQGRFTISRDDSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V149 ighv LLXD01000042.1 2653235 SRYERQTLTESEPVVKRPGESDTLTCTVSAFTFSGYWMNWVRQPPGKGLEWLAWHKTGSSKQYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCAQL
Lates calcarifer V148 ighv LLXD01000042.1 2653769 CTGQRMESIPSSSVVKRPGETLSLSCRGSGFTFACCVMSWIRQPAGKPLEWIGVGLSDASRNSYSSSVRGRAEISRDDSSSMVHLKLSNLKPEDSAVYYCAK
Lates calcarifer V147 ighv LLXD01000042.1 2656330 VDGQTLTQSEPVVKRPGESHTLTCTGSGFTFSDHWMGWVRQAPGKGPEWISFISSGDGSTTHYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARD
Lates calcarifer V146 ighv LLXD01000042.1 2658201 VDGQTLPESEPVVKRPRESHRLTCTASGFTFSSHEMHWVRQAPGKGLEWIAYIDSGSGSGKYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCAQW
Lates calcarifer V145 ighv LLXD01000042.1 2661132 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTDSSYATGWIRQREGKQMDWIIHWWGGGDFNQNNALKNKFLYHTYTTTSSVTITGQNLQPEDTAVYYCVRL
Lates calcarifer V144 ighv LLXD01000042.1 2665191 VDGQTLTQSEPVVKRPGESHRLTCTGSGFTFSSQPMVWVRQAPGKGPEWIAYIGTSSSPIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCAR
Lates calcarifer V143 ighv LLXD01000042.1 2666159 VDGQTLTESEPVVKRPGESHRLTCTASGFTLSGYHMDWVRQAPGKGLEWIAFIYTSSSYIHYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCA
Lates calcarifer V142 ighv LLXD01000042.1 2667386 CTGQRMESIPSSSVVKRPGETLSLSCRGSGFTFTCCGMNWIRQPAGKPLEWIGVGHIPASSNAYSSSVRGRAEISRDDSNSMVHLRLSNLKPEDSAVYYCA
Lates calcarifer V141 ighv LLXD01000042.1 2669209 VDGQTLTESEPVVKRPGESHRLTCTTSEFTFRDYAMNWVRQAPGKGLEWIAYISDGGSDKYYSQSVQGRFTISRDDSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V140 trav LLXD01000042.1 2670895 PIKNACFNVQAFIPLAVPPQEALSLSCRGTGFTFSQHGMHWIRQPAGKALEWMGLIYYDASKTVYASSEQGRIEITRDNSNSMVNLRLSNLKPEDSAVYYCAR
Lates calcarifer V139 trav LLXD01002491.1 12317 FSCCVKIHQPPFIFSHGSDTSVTLQCEQDDDEYSSMFWYRHRDSGKIQLITYSLGKDVWNIDTPFNKSKYTMSRPAVLSSSLQIKPVEAEDSAVYYCASSR
Lates calcarifer V138 trbv LLXD01002491.1 9437 QASAVTFLQSPPQIVKENSEVHINCSHDDSNLVIMLWYQQSKDSLSMTLIGYGYESSQNYEGLFEEQFTMTRQNTVKGTLIIHRASLSHSAVYFCAASTQ
Lates calcarifer V212 trbv LLXD01000042.1 2540100 VWSEIKLDQSPSEVKRPGETVKVSCIISGYSMADNFIHWIRQRPGEALEWIGRISPYRNTASYASSFQSRFSFTQDVSSSTQYLQVKSLTAEDSAVYLCAR
Lates calcarifer V211 ighv LLXD01000042.1 2541632 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTDSSYATGWVRQCEGKAMDWIFHQWGGSSGSLYQNNALKNKFIYNRDMSAGTVTITGQNLQPEDTAVYYCVHY
Lates calcarifer V210 ighv LLXD01000042.1 2543779 VKCEQLTQPASVTVQPGQHLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGSAAAGYTTYYKDSLKNKFSINTDSSRNTVTLNGQNLQPEDTAVYYCARDTQ
Lates calcarifer V209 ighv LLXD01000042.1 2545276 VDGQTLTESEPVVKRPGESHRLTCTVSGFSLSSYWMSWIRQAPGKGLEWIAADGGSSSKYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V208 ighv LLXD01000042.1 2548565 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSYEMDWVRQAPGKGLEWIAYINSGGSTTYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V207 ighv LLXD01000042.1 2549823 VKCVQLTQPASVTVQPGQRLTITCQVSYSVSSHYTAWIRQPAGKEMEWIGSAAAGYPTYYKDSLKNKFSISTDSSRNTYTAVYYCARESQ
Lates calcarifer V206 ighv LLXD01000042.1 2551458 VDGQTLTQSEPVVKRPGESHRLTCTVSGFSLSSYWMSWIRQAPGKGLEWIATDTSGSNYYSQSVQGRFTTSRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V205 ighv LLXD01000042.1 2553613 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTDGSYATGWIRHREGKLMDWIFHQWGGSSGSFWQNDALKNRFSYSRDMSAGTVTITGQNLQPEDTAVYYCVRC
Lates calcarifer V204 ighv LLXD01000042.1 2555200 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSTYYTAWIRQPAGKGLEWIGSRRDGGSTYYKDSLKNKFSIDLDSSRNTATLNGQNVQPEDTAVYYCARDTQ
Lates calcarifer V203 ighv LLXD01000042.1 2556730 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFNSYWMAWVRQAPGKGLEWIAIIRYDSAEIYYSQSVRGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V202 ighv LLXD01000042.1 2557797 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTDSSYATGWIRQCEGKPMDWIFHQYGGSSSNLYQNNALKNRFSYSRDMSAGTVTITGQNPQPEDTAVYYCV
Lates calcarifer V201 ighv LLXD01000042.1 2558907 VDGQTLTQSEPVVKRPGESHRLTCTVSGFTLGDYWMVWIRQAPGKGLEWITTDAGDSRKYYSQSVQGQFTVSRDNSRQQLYLQMNSLNTEDTAFYYCAT
Lates calcarifer V200 ighv LLXD01000042.1 2562469 VKCEQLTQPASVTVQPGQHLTITCQVSYSVSDYYTVWIRQPAGKEMEWIAVRSAGDSQYKDSLENKFSINLDSSSNTVTLNGQNVQPEDTAVYYCARDTI
Lates calcarifer V199 ighv LLXD01000042.1 2564052 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTSSSYATGWIRQCEGKPMDWIFDQWGGSSGSLYQNNALKNKFSYSRDMSAGTVTITGQNLQPEDTAVYYCVRR
Lates calcarifer V198 ighv LLXD01000042.1 2565586 AEGQSLTSSEPVVSRAGESVTLSCKVEGLALAWLHWIRQKPGKGLEWIGRIDSGTGTIFAQSLQGQFSITKDTSRNIVYLEVKSLKQEDSAVYYCARE
Lates calcarifer V197 ighv LLXD01000042.1 2566920 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSDYNMNWVRQSPGKGLEWIAYISSLSSYIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V196 ighv LLXD01000042.1 2568318 VDGQTLTESEPVVKRPGESHTLTCTASGLSISSYYMAWVRQAPGKGLEWITSISGGGSIYYSQSFQGRFTISRDDSRQQVYLQMNSLKTEDSAVYYCARNQ
Lates calcarifer V195 ighv LLXD01000042.1 2570883 VDGQTLTQSEPVVKRPGESHRLTCTASGLSFSSYYMGWIRQTPGKGLEWIATISNGGGSTYYPQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V194 ighv LLXD01000042.1 2573404 VDGQTLTQSQPVVKRPGESHRLTCTTSGFTFSSYWMAWVRQAPGKGLEWIATISSGGGSSTYYSQSVQGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCAR
Lates calcarifer V193 ighv LLXD01000042.1 2576482 WTITESEPAVKRPGESHRLTCTTSGLSFSSSWMAWIRQAPGKGLEWIATDTNGGSNRYSQSVQGRFTISRDNSREQVYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V192 ighv LLXD01000042.1 2579093 VKCEQLTQPASVTVQPGQHLTITCQVSYSVSDYYTAWIRQPAGKELEWIGHASAGYTTYYKDSLKNKFSISTDSSSNTVTLNGQNVQPEDTAVYYCARDTI
Lates calcarifer V191 ighv LLXD01000042.1 2582150 VDGQTLTESEPVVKRPGESHRLTCTASGFSFSSQYLAWIRQAPGKGLEWIAYISSGGGSSTYYSQSVQGRFTISRDNSREQVYLQMNSLKTEDTAVYYCAR
Lates calcarifer V190 ighv LLXD01000042.1 2583831 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSYWMAWVRQAPGKGLEWIAYISSGGGSSTYYSQSVQGRFTVSRDNSKQQLYLQMNSLKTEDTAVYYCAR
Lates calcarifer V189 ighv LLXD01000042.1 2584836 VWSEIKLDQSPSEVKRPGETVKMSCIISGFDMTSFYLHWVQQRPGRALEWIGWMSTGRNSAIYGSSFQSRFIMTQDVSSSTQYLQVNSLTAEDSAVYFCAR
Lates calcarifer V188 ighv LLXD01000042.1 2586840 WTITESEPAVKRPGESHRLTCTTSGLSFSSSWMAWIRQAPGKGLEWIAADGGGSSKYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARDTQ
Lates calcarifer V187 ighv LLXD01000042.1 2588750 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSWYTAWIRQPAGKQLEWIGSARVGYTTYYKDSLKNKFSISLDSSRNTVTLNGQNLQPEDTAVYYCARDTQ
Lates calcarifer V186 ighv LLXD01000042.1 2590164 VDGQTLTPSEPVVKRPGESHTLTCTASGFTFSSYYMGWIRQAPGKGLEWVASISYGGGSSKFYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V185 ighv LLXD01000042.1 2591615 VNCEQLTQPASVTVQPGQHLTITCQVSYSVSSYWTAWIRQPAGKGLEWIGHASAGSTTRYKDSLKNKFSISTDSSSNTVTLNGQTVQPEDTAVYYCAR
Lates calcarifer V184 ighv LLXD01000042.1 2594905 VDGQTLTESEPVVKRPGESHRLTCTASGFTFSSYNMNWVRQAPGKGPEWIAYISSSGSSIYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V183 ighv LLXD01000042.1 2596341 QTDGQTLTESEPVVKRPGESHTLTCTGSGFTFSSLYLAWIRQAPGKGLEWLARIDSGSGSYKYYSQSVQGRFTISRDNSRQQLYLQMNSLKTKDSAVYYCARE
Lates calcarifer V182 ighv LLXD01000042.1 2596832 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTDNSYATGWVRQREGKLMDWIMHQWGGGDFNQNDALKNKFNYSREMSAGTVTITGQNLQPEDTAVYYCVLGATVQQ
Lates calcarifer V181 ighv LLXD01000042.1 2597711 VKCEQLTQPASVTVQPGQRLTITCQVSYYLSSYATAWIRQPAGKGLEWIGRRGGGYNTYYKDSLKNKFSINLDTSSKTVTLNGQNVQPEDTAVYYCARDTT
Lates calcarifer V180 ighv LLXD01000042.1 2599586 VDGQTLTQSEPVVKRPGESHTLTCTASGFTFSSYNMAWIRQAPGKGLEWVALHGTGSNKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V179 ighv LLXD01000042.1 2600989 VDGQTLTESEPVVKRPGESHRLTCTGSGFTFSSLYLAWIRQAPGKGLEWLARIDSGSGSYKYYSQSVQGRFTISRDDSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V178 ighv LLXD01000042.1 2602432 VDGQTLTESEPVVKRPGESHRLTCTASGFTLSSYPMNWVRQAPGKGLEWIAFIHTGSTSIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCARE
Lates calcarifer V177 ighv LLXD01000042.1 2605858 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSYAMAWVRQAPGKGLEWIAWHDSGSGSTTYYSQSVQGRFTISKDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V176 ighv LLXD01000042.1 2607032 VYSIDLIQPESKIVQPGQSLTITCQVSGYSLTDNSYATGWIRQHEGKPMDWIFHMWGGGGFYQNNALKNKFSYNRDTSTRTVTLTGQNLQPEDTAVYYCVRC
Lates calcarifer V250 trdv LLXD01000084.1 401316 LTAGDSISPERGEVSEREGQSVTLRCTYETTNTYIYLYWYRHHSDLQTPQFILYKGEGTQKGDDHIPDKRYESETTDKSTELTINRLTLADTGLYYCALE
Lates calcarifer V249 trav LLXD01000084.1 402233 SSEDLVKPSKDVMMALEGDTVTLSCSYSQSGSYLYWYQQKSSSSPQLLMMEHSKVEGLSFNHDKKTKEFHLQISSAAVTDSAVYYCAVR
Lates calcarifer V248 trav LLXD01000084.1 404780 QDTVTQPTGDVTAAEGDTVTLNCTFETTYSSPTLFWYKQEENEFPKYMLKCFSKSVDHAPEIQKDRFHAAIKEKSVPLKIQMLQLSDSAVYYCALQPTVTG
Lates calcarifer V247 trav LLXD01000084.1 406823 QDTVTQPTGDVTAAEGDTVTLNCSFKTTRASPTLYWYKQEFNDFPKYLLKSLSSTVYHASEIQKDRLDAERKDNWFPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V246 ighv LLXD01000084.1 408475 LTSGNSIYPVGSEVRGGEGQSVTLRCDYKTSASGFNLYWYRHHSDLQSPQFILWKGAGSWTSEHIPDKRYESQTTGTSIYLTINRLTLADTGLYYCALE
Lates calcarifer V245 trav LLXD01000084.1 413222 SSEDLVKPSKDVMMALEGDTVTLSCSYSQSVQNLYWYQQKSSSSPQLLMMEHSKAEGLSFNHDKKTKEFHLQISSAAVTDSAVYYCAVR
Lates calcarifer V244 trdv LLXD01000084.1 414544 LTAGDSISPVEGEVSGREGQSVTLRCRYDTTETYIRLYWYRHHSDLQAPQFILGKGAKGSGYDYNPNTNRYKSQTTDTSTELTINSLTLADTGLYYCALE
Lates calcarifer V243 trav LLXD01000084.1 415446 QDTVTQPTGDVTAAEGDSVTLNCTFKTSGTPTLFWYKQEVNESPKYMLRKFTSGPPDKSPGFQGERFDTEIKEKSVSLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V242 ighv LLXD01000062.1 882730 VDGQTLTQSESAIKRPGQSHTLTCTASGFSFSDYWMLWFRKAPGKGLEWIASIIYHSGSTKNYAPSVQGRFIINRDNSKQQLYLQMNSLKTQDSAVYYCARD
Lates calcarifer V241 ighv LLXD01000062.1 882730 VDGQTLTQSESAIKRPGQSHTLTCTASGFSFSDYWMLWFRKAPGKGLEWIASIIYHSGSTKNYAPSVQGRFIINRDNSKQQLYLQMNSLKTQDSAVYYCARD
Lates calcarifer V240 ighv LLXD01000062.1 882730 VDGQTLTQSESAIKRPGQSHTLTCTASGFSFSDYWMLWFRKAPGKGLEWIASIIYHSGSTKNYAPSVQGRFIINRDNSKQQLYLQMNSLKTQDSAVYYCARD
Lates calcarifer V239 ighv LLXD01000062.1 882730 VDGQTLTQSESAIKRPGQSHTLTCTASGFSFSDYWMLWFRKAPGKGLEWIASIIYHSGSTKNYAPSVQGRFIINRDNSKQQLYLQMNSLKTQDSAVYYCARD
Lates calcarifer V238 trav LLXD01000052.1 39820 VIHSATVKQDTGVVSASVGDNVTLRCFYDSQVAMHFSWYRQTLGGRPELMSTIYKYDQPSKVFHWLEKNPRFSVHREQGMNHLHIADIHLSDSATYFCGS
Lates calcarifer V237 trav LLXD01000052.1 39820 VIHSATVKQDTGVVSASVGDNVTLRCFYDSQVAMHFSWYRQTLGGRPELMSTIYKYDQPSKVFHWLEKNPRFSVHREQGMNHLHIADIHLSDSATYFCGS
Lates calcarifer V236 ighv LLXD01000042.1 2495870 VDGQTLTQSEPVVKKPAESHRLTCTASGLSFSGYWMHWIRQAPGKGLEWIASHYDSSNIYYSQSFQGRFTISRDDSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V235 ighv LLXD01000042.1 2495870 VDGQTLTQSEPVVKKPAESHRLTCTASGLSFSGYWMHWIRQAPGKGLEWIASHYDSSNIYYSQSFQGRFTISRDDSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V234 ighv LLXD01000042.1 2496988 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTDNSYATGWIRQREGKPMDWIMHRWGGGDFYQNNALKNKFLYHTYTSTSSVTLTGQNLQPEDTAVYYCVR
Lates calcarifer V233 ighv LLXD01000042.1 2498318 VKCEQLTQPASLTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWMSRDSSVKDSLKNKFSVDLDSSSNTVTLNGQNLQPEDTAVYYCARDTQ
Lates calcarifer V232 ighv LLXD01000042.1 2502512 VDGQTLTESEPVVKRPGQSHRLTCTGSGFDFSSAWMAWIRQAPGKGLEWVATIEYDSDSIFYSQSVQGRFTTSRDNSKQQLYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V231 ighv LLXD01000042.1 2505121 VWSEIKLDQSPSEVKRPGETVKMSCIISGYSMTSYYIHWIQQRPGRGLEWIGRMDTGSNSASYGSSFQSRFVMTEDVSSSTQYLQVNSLTAEDSAVYFCAR
Lates calcarifer V230 ighv LLXD01000042.1 2506435 VYSIDLIQPESKVVQPGQSLTITCQVSGYSVTDNSYATGWIRQREGKPMDWIFHMWGGGSLTQNNALKNKFSFNRDTSARTVTITGQSLQPEDTAVYYCVRY
Lates calcarifer V229 ighv LLXD01000042.1 2507705 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSDYWMVWIRQAPGKGLEWIAATNYGGGSKYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V228 ighv LLXD01000042.1 2509419 VDGQTLTESEPVVKRPGESHRLTCTGSGFTFSDYEMDWVRQTPGKGLEWVAWHDRFSSITKYYSQSVQGRFTISRDNSRQQLFLQMNSLKTEDSAVYYCARQ
Lates calcarifer V227 ighv LLXD01000042.1 2510682 QTITESEPAVKRPGESHRLTCTTSGFDFRNSRWSWNRQAPGKGLEWIAYISTASTPIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCAR
Lates calcarifer V226 ighv LLXD01000042.1 2512023 VYSIDLIQPESKVVQPGQSLTITCQVSGYSMTDDSYATGWLRQREGKLMDWISHMWGGGTLRQNDALKNKFSYNRDTSARTVTITGQNLQPEDTAVYYCVRY
Lates calcarifer V225 ighv LLXD01000042.1 2514715 VDGQTLTQSEPVVKRPGESHTLTCTASGFTFSDYAMVWIRQAPGKGPEWITYISWDSSYICYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCSRE
Lates calcarifer V224 ighv LLXD01000042.1 2516438 VYSIDLIQPESKVVQPGQSLTITCQVSGYSMTSSSYATGWIRQREGKPMDWIMHRWGGGTFEQNDALKNKFLYHTYTSTSSVTLTGKNLQPEDTAVYYCVR
Lates calcarifer V223 ighv LLXD01000042.1 2517768 VDGQTLTQCEPVVKRPGESHRLTCTASGFTFSDYGMHWIRQAPGKGLEWITSTAYAYGYFGGRSRTEYYSQSVQGRFTISRDNSREQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V222 ighv LLXD01000042.1 2519715 VNGQTLTESEPVVKRPGESHTLTCTASGFNLGSYHMNWVRQASGKGLEWVAFSSNGGSSKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V221 ighv LLXD01000042.1 2521551 VNCEQLTQPASVTVQPGQRLTITCQVSYSVSSYFTAWIRQPAGKEMEWIGYAAGSNAYYKDSLKSKFSISTDSSSNTVTLNGQNLQPEDTAVYYCAR
Lates calcarifer V220 ighv LLXD01000042.1 2523839 CTGQRMESIPSSSVVKRPGETLSLSCRGSGFTFSCCTMNWVRQPAGKPLEWIGEGFSDASRNSYSSSVRGRAEISRDDSNSMVHMRLSNLKPEDSAVYYCA
Lates calcarifer V219 ighv LLXD01000042.1 2525224 WTITESEPAVKRPGESHRLTCTTSGFNFGGSVWSWIRQAPGKGLEWIAYISTASTPIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCAR
Lates calcarifer V218 ighv LLXD01000042.1 2527009 VWSEIKLDQSPSEVKRPGETVKMSCIISGYSMTSYYIHWIQQRPGRGLEWIGWMNTGRNSASYGSSFQSRFVMTEDVSSSTQYLQVNSLTAEDSAVYFCAR
Lates calcarifer V217 ighv LLXD01000042.1 2530868 VDGQTLTESEPVVKRPGESHRLTCTGSGFTFSSHLMGWVRQAPGKGLEWVATIDVTSIYYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCA
Lates calcarifer V216 ighv LLXD01000042.1 2534195 VDGQTLTQSEPVVKRPGESHTLTCTGSGYTFSDYAMVWVRQAPGKGLEWIAWHEWKSSTSKSYSQSVQGRFTISKDNSRQQLYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V215 ighv LLXD01000042.1 2535762 VDGQTLTQSEPVVKRPGESHTLTCTTSGFTFSSYYMAWIRQAPGKGLEWIASHYDSSNIYYSQSFQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V214 ighv LLXD01000042.1 2537071 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTDNSYATGWIRQREGKPMDWIFEMWGGGSFYQNDALKNKFSYNRDTSARTVTITGQNLQPEDTAVYYCARN
Lates calcarifer V289 trav LLXD01000084.1 297127 SSEDLVKPSKDVMMALEGDTVTLSCSYSQSVQNLYWYQQKSSSSPQLLMMEHSKAEGLSFNHDKKTKEFHLQISSAAVTDSAVYYCAVR
Lates calcarifer V288 trdv LLXD01000084.1 298506 LTAGDSISPERGEVSGREGQSVTLRCNYETSADRVLLYWYRHHSDLQAPQFILRKGEGAWKGQDHIPDKRYESQTTSSSTELTINSLTLADTGLYYCALE
Lates calcarifer V287 trav LLXD01000084.1 299422 NVLQPPGDVTVTEGEAGTLDCRYNSSSNNLNLYWYKQDGDHSPKFILQLIKLGGGNTADKFKERFSATLNSALRSVPLKIQKLQLSDSAVYYCALQ
Lates calcarifer V286 ighv LLXD01000084.1 302470 LTAGESISPERGEVSGTEGQSVTLRCDYKTTASHVLLYWYRHHSDLHAPQFILWKGARSYSSSEHIPDKRYESKTTSSSTELTIKRLTLADTGLYYCALE
Lates calcarifer V285 trav LLXD01000084.1 303372 QKDNVLQPTGDVTVTEGEAGTLDCRYNSSSTNNYLYWYKQDGDHSPKFILQLIKLGGGNTADEFKERFSATLNSALRSVPLEIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V284 trav LLXD01000084.1 306454 QDTVTQPTGDVTAAEGDTVTLNCTFDTSYQNSYLFWYKQEVNNSLKYMLRCFSKTVDHAPEIPKDRFHAAIKEKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V283 trdv LLXD01000084.1 308790 LTAGDSISPVGGEVNGREGQSVTLRCRYETTERYIRLYWYIHHSDLQAPQFILYKGEGELKDRDHIPDDRYESQTTDTSIYLTINRLTLADTGLYYCALR
Lates calcarifer V282 trav LLXD01000084.1 309693 MGSMNSIKLESAEEVVAEGTNINLTCKYDGAINNIQWYRQYQRSRPEFLLYITEGGLIHRILSDFSAHINKGEKRVDLEIISAKVTDSAVYYCALTPTVTG
Lates calcarifer V281 trav LLXD01000084.1 311526 TVTQPTGDVTAAEGDTVTLNCTFDTSYPNSYLFWNKQEVNNSLKYMLRCFSKTVDHAPEIQKDRFHAEIKEKSVPLKIQKLQLSDSAVYYCAL
Lates calcarifer V280 trdv LLXD01000084.1 314147 LTAGDSISPERGEVSGGEGQSIKLKCRYETTSTTVRLYWYRQHSNIQAPQFILWKEARSWTDEYIPDDRYESETTRSSTELTINRLTLADTGLYYCALE
Lates calcarifer V279 trav LLXD01000084.1 315046 QDTVTQPTGDVTAAEGDTVTLNCTFKTTALNSYLYWYKQEVRDFPRYVLQRDTYGTEENAPEFLKDRFHAEIKEKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V278 trdv LLXD01000084.1 320393 LTAGDSISPERGEASGTEGQSVTLRCDYKTSASGVNLYWYRHHSDLQAPQFILYKAAPPYSGEHNPDKRYRSETTRSSTRLIINSLTLADTGLYYCALR
Lates calcarifer V277 trav LLXD01000084.1 321293 MGSMNSIKPESAEEVVAEGTNINLTCKYDGAINNIQWYRQYQRSRPEFLLYITEGGLIHRILSDFPAHINKGEKRVDLEIISAKVTDSAVYYCALQPTVTG
Lates calcarifer V276 trav LLXD01000084.1 324678 QDTVTQPTGDVTAAEGDTVTLNCTFETNFTPTLFWYKQEENDFPKYMLRCLSQTVDHAREIQKDRFHAEIKEKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V275 trav LLXD01000084.1 326615 SSEVLVKPSKDVMMALEGDTVTLSCSYSQSVQNLYWYQQKSSSSPQLLITDYSETIPRLSLQHDKETKEFHLQISSAAVTDSAVYYCALQ
Lates calcarifer V274 trdv LLXD01000084.1 327987 LTAGDSIYPERGEVSGGEGQSVTLRCTYETSADRVLLYWYRHHSDLQAPQFILYKGEGAWKGYDHIPDKRYESRTTDTSTELTINRLTLADTGLYYCALE
Lates calcarifer V273 trav LLXD01000084.1 328904 TVTQPTGDVTAAEGDTVTLNCTFKTTDPSPYLYWYKQGVNDFPKHMLKCFSKTVDHAPEIQKDRFHAEIIEKSIPLKIQKLQLSDSAVYYCALR
Lates calcarifer V272 trdv LLXD01000084.1 336703 LTAGDSISPERGEVSGTEGQSVTLRCQTTSYVYNFYWYRHHSDLQAPQFILLKGAPSYSTDEHITDKRYESQTTDTSTELTINRLTLADTGLYYCALE
Lates calcarifer V270 trdv LLXD01000084.1 341913 LTAGDSISPVGGEVSEREGQSVTLRCRYESSYNDPNLYWYRHHSDLQAPQFILWKGAKTQQNIPDKRYESQTTDTSTELTINSLTLADTGLYYCALE
Lates calcarifer V269 trav LLXD01000084.1 342821 NVLQPPGDVTVTEGEAGTLDCQYNSSSTNPYLYWYKQDGDHSPKFILQLIKLGGGNTADEFKERFSATLNSALRSVPLKIQKLQLSDSAVYYCALQ
Lates calcarifer V268 trdv LLXD01000084.1 346532 LTAGDSIYPVEGEVSEREGQSIRLRCDYKTPYSGFYLYWYRHHSDLQAPQFILYKGEGTWKGDDHIPDKRYKSQTTDTLTELTINSLTLADTGLYYCALR
Lates calcarifer V267 trav LLXD01000084.1 347448 SSEDLVKQSKDVMMALEGDTVTLSCSYSQSGSYLYWYQQKSSSSPQLLMMEHSKVEGLSFNHDKKTKEFHLQISSAAVTDSAVYYCALQ
Lates calcarifer V266 trdv LLXD01000084.1 353390 LTAGDSISPERGEVSGTEGQSVRLRCDYKTSASGFNLYWYRHHSDLQAPQFILYKGEGTWKGDDHIPDDRYKSETTRSSTELTINRLTLADTGLYYCALE
Lates calcarifer V265 trav LLXD01000084.1 356498 QDTVTQPTGDVTAAEGDTVTLNCTFETTDTFPYLFWYKQEENDFPKYMLKCTSKTTENAPEFHKDRFNAEIKEKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V264 trav LLXD01000084.1 364172 QDTVTQPTGDVTAAEGDTVTINCTFDLSAYSNNYLYWYKQGVNDFPKYMLQRFTIGTENNAPEFPKDRFNAEIKDKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V263 trav LLXD01000084.1 367039 SSEDLVKQSKDVMMALEGDTVTLSCSYSQSGSYLYWYQQKSSSSPQLLMMEHSKVEGLSFNHDKKTKEFHLQISSAAVADSAVYYCALQ
Lates calcarifer V262 trav LLXD01000084.1 369265 MGSMNGLKPERSEEVVAEGTNINLTCKYDGAIRNIQWYRQYQRSRPEFVLSITEGGSIHPILSDFSAHINKGEKRVDLEIISAKVTDSAVYYCALT
Lates calcarifer V261 trav LLXD01000084.1 370850 NSLEDDITASRAEVFSSEGRTVTLSCKYSVKAQNLQWYRQDPGSAPQYLLLITNTKQPDVLKATPPNPRLTAELNEERNQVDLQISSAAVTDSAVYYCALQ
Lates calcarifer V260 ighv LLXD01000084.1 373587 LTAGNSISPVGGVVSGTEGQSVTLRCDYETSYDRFYLNWYRHHSDLQAPQFILYKGEGTWKGVDHIPDKRYESQTTDKSTELTITRLTLADTGLYYCALR
Lates calcarifer V259 trav LLXD01000084.1 374490 MGSMNSIKTQSAEEVVAEGTNINLTCKYDGAIYNIQWYRQYQRSRPEFVLSITEGGSIHPILSDFPAHINKGEKRVDLEIISAKVTDSAVYYCALQPTVTG
Lates calcarifer V258 trav LLXD01000084.1 375970 QDTVTQPTGDVTAAEGDTVTLNCTFETTDPSPSLYWYKQGVNDSPKYLVKCFSKTVDHSPEIQKDRFHAEIIEKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V257 trdv LLXD01000084.1 382650 LTAGDSIYPQRGEVSGTEGQSVTLRCTYETTASAVDLYWYRHHSDIQAPQFILYKGEGTWKGYDHIPDKRYKSQTTDTLTELTINRLTLADTGLYYCALR
Lates calcarifer V256 trav LLXD01000084.1 383568 SSEDLVKPSKDVMMALEGDTVTLSCSYSQSVQSLYWYQQKFSSSPQLLITDYSETIPRLSLKHDKETMEFHLQISSAAVTDSAVYYCAVK
Lates calcarifer V255 trav LLXD01000084.1 385808 SSEDLVKPSKDVMMALEGDTVTLSCSYSQSVQSLYWYQQKFSSSPQLLITDYSETIPRLSLKHDKETMEFHLQISSAAVTDSAVYYCAVK
Lates calcarifer V254 trav LLXD01000084.1 388106 QKDNVLQPTGDVTVTEGEAGTLDCQYNSSSTNPYLYWYKQDGDHSPKFILQRIKLGGGNTADEFKERFSATLNSALRSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V253 trdv LLXD01000084.1 391836 LTAGDSIYPVEGEVSEREGQSIRLRCDYKTSYSGFYLYWYRHHSDLQAPQFILYKGEGTWKGYDHIPDKRYKSQTTDTLTELTINSLTLADTGLYYCALR
Lates calcarifer V252 trav LLXD01000084.1 392739 MGSMNSIKPESAEEVVAEGTNINLTCKYDSDIYNIQWYRQYQRSRPEFLLYITEGGLIHPILSDFPAHINKGEKRVDLEIISAKVTDSAVYYCALTPTVTG
Lates calcarifer V309 trav LLXD01000133.1 1259298 KVLTQTPAVHTVSTGQEVVLNCNIQRDDGYNVYWYKQVPGKTPQYVLRFYHSHSSPSFGTGFSSDRFNSKSSSNIDYQFIIKRAEAGDSAVYYCQTWDDSAKENV
Lates calcarifer V308 igkv LLXD01000100.1 1573167 CSGQVTVTQPPVLTTTPGSTVTLTCKTSQAVAGCGAGQCMFWYQQKSGQTPKLLIRHVSTPVSGTPARFSGSGSGSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V307 igkv LLXD01000100.1 1573167 CSGQVTVTQPPVLTTTPGSTVTLTCKTSQAVAGCGAGQCMFWYQQKSGQTPKLLIRHVSTPVSGTPARFSGSGSGSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V306 igkv LLXD01000100.1 1575443 CSGQVTVTQPPVLTTTPGSTVTITCKTNPKVYTWSDRDSRVHWYQQKPGQGPKLVIKLGQNPTSEFSSRFSGRGDGVNAVMTISGVQTEDAAVYYCQSEHEINSAWV
Lates calcarifer V305 igkv LLXD01000100.1 1582783 CSGQVTVTQPPVLTTTPGSTVTITCKTSQDVYTDSDGDQAMFWYQQKSGQTPKLLITYVSSHESGTPARFSGSGSGSDFTLTISGVQAEDAAVYYCQSYHEISGADVL
Lates calcarifer V304 igkv LLXD01000100.1 1582783 CSGQVTVTQPPVLTTTPGSTVTITCKTSQDVYTDSDGDQAMFWYQQKSGQTPKLLITYVSSHESGTPARFSGSGSGSDFTLTISGVQAEDAAVYYCQSYHEISGADVL
Lates calcarifer V303 trav LLXD01000084.1 258712 QDTVTQPTGDVTATEGDTVTLNCTFETTYSGPTLFWYKQEENDFPKYMLKCFSKSVDHAPEIQKDRFHAEIKEKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V302 trav LLXD01000084.1 260804 MGSMNSIKPESAEEVVAEGTNINLTCKYDGAINNIQWYRQYQRSRPEFLLYITEGGSTHPVLSDFSAHINKGEKRVDLEIISAKVTDSAVYYCALMPTVTG
Lates calcarifer V301 trav LLXD01000084.1 265751 QDTVTQPTGDVTAAGDTVTLNCTFDLSAYSNNYLYWYKQGVNDFPKYMLQRFTIGTENNAPEFPKDRFNAEIKDKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V300 ighv LLXD01000084.1 268852 LTAGNSIYPVGGEVSGGEGQSVTLRCRYETTNTYIYLYWYRHHSDLQAPQFILYKGEGTQKGYDHIPDKRYESETTDKSTRLTITRLTLADTGLYYCALE
Lates calcarifer V299 trav LLXD01000084.1 269754 QDTVTQPTGDVTAAEGDTVTLNCTFETTYSGPTLFWYKQEENDFPKYMLKCLSQTVYHAPEIQKDRFNAEIKEKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V298 trav LLXD01000084.1 270677 NVLQPTGDVTVTEGEAGTLDCQYNSSSTNNYLYWYKQDGDHSPKFILNRIKLDDGNTADEFKERFSATLNSALKLVPLKIQKLQLSDSAVYYCAVR
Lates calcarifer V297 trav LLXD01000084.1 272367 SSEDLVKPFKDVMMALEGDTVTLSCSYSQSVQSLYWYQQKSSSSPQLLMMEHSKAEGLSFNHDKKTKEFHLQISSAAVTDSAVYYCAVR
Lates calcarifer V296 trdv LLXD01000084.1 273675 LTAGDSISPERGEVSGREGQSVTLRCRYETTNTYIYLYWYRHHSDLQAPRFILWKGARSYSSSEHNPDKRYRSETTDTSTELTINSLTLADTGLYYCALR
Lates calcarifer V295 trav LLXD01000084.1 274578 QDTVTQPTGDVTAAEGDTVTLNCTFETTALNSYLYWYKQGVRDFPRYVLRRDTYGTEENAPEFLKDRFDAKIKDKLFTLKIQKLQLSDSAVYYCALTPTVTG
Lates calcarifer V294 trav LLXD01000084.1 280327 QDTVTQPTGDVTAAEGDTVTLNCTFETTRASPTLFWYKQEENDFPKYVLRRGSYGEHNAPEIQKDRFNAAIKEKSVPLKIQKLQLSNSAVYYCALQPTVTG
Lates calcarifer V293 ighv LLXD01000084.1 286548 LTAGNSISPVGGEVSGTEGQSVTLRCNYKTSASGVNLYWYRHHSDILAPQFILRKGEGAWKGQDHIPDNQYESQTTDTSIYLTINRLTLADTGLYYCALE
Lates calcarifer V291 trav LLXD01000084.1 290796 MGSMNSIKPESSEEVVAEGTNINLTCKYDGAINNIQWYRQYQRSRPEFLLSITEGGSIHPILSDFSAHINKGEKRVDLEIISAKVTDSAVYYCALQPTVTG
Lates calcarifer V329 igkv LLXD01000252.1 191895 SRGQVTVTQPGAVRSALGGSVTIRCRISQTVINSDSVEWYQQKQGDSPKLLIYYASTRASGTPDRFTGSGSDSDFTLTISGVQAEDAAVYYCKG
Lates calcarifer V328 igkv LLXD01000252.1 198455 SRGQVTVTQSGAVSAALGGSVTIRCRTSQNVYSSNCLAWYQQRDGETPKLLIYLASTRASGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V327 igkv LLXD01000252.1 200762 SRGQVTVTQPGAVRSALGGSVTITCRTSQNVHNSNYLAWYQQRDGETPKLLIYLASTRASGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V326 igkv LLXD01000252.1 203057 SRGQVTVTQPGAVSAALGGSVTITCRTSQNVYGSNRLSWYQQRDGETLKLLIYVASTRASGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQG
Lates calcarifer V325 igkv LLXD01000252.1 204709 QVTVTQPGAVRSAVGGSVTITCRTSQNVYTWSSYHALAWYQQRDGETPKLLIYWATTRASGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V324 igkv LLXD01000252.1 206881 SRGQVTVTQPGAVRSALGGSVTIRCRTSQNVYYSSPNHFLAWYQQRDGETPKLLIYTATTRASGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V323 igkv LLXD01000252.1 209288 SRGQVTVTQPGAVRSALRGSVTITCRTSQNVYNSDFLAWYQQRDGETPKLLIYRATTQASGIPGRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V322 igkv LLXD01000252.1 213353 SSGDIILTQSPGAQSVVLGQTVSIRCKVSSHVGSEVDWYLLKPGEAPKLLIYYATNRQSGVSDRFSGSGSGTDFTLTISRVQTEDAGVYYCQQDYSTP
Lates calcarifer V321 igkv LLXD01000252.1 214691 SRGQVTVTQPGAVRSALGGSVTIKCRTSQNVYGSDHLAWYQQRDGETPKLLIYLATTRASGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V320 igkv LLXD01000252.1 217112 QVTVTQPGAVRSAVGGSVTITCRTSQNVYVYNNNYHYLAWYQQRDGETPKLLIYAATSRVSGIPGRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V319 igkv LLXD01000252.1 221820 SRGQVTVTQPGAVSAALGGSVTITCRTSQDVYVYSNNHCLAWYKQRNGETPKLLIYWATSRQSGIPDRFTSSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V318 igkv LLXD01000252.1 223184 SRGQVTVTQSGAVSAALGGSVSITCRTSQNVYGGSYLHWYQQRDGETPKLLIYYASTRASGIPGRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V317 igkv LLXD01000252.1 225325 QVTVTQPGAVRSAVGGSVSIRCRTSQNVYTWSSYHYLAWYQQRDGETPKLLIHTASTRESGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V316 igkv LLXD01000252.1 227067 SRGQVTVTQPGAVSAALGGSISIRCRTSQNVHVYNNNHYLSWYQQRDGETPKLLIYYATRRQSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V315 igkv LLXD01000252.1 229234 QVTVTQSGAVRSALGDSVTITCRTSQNVHVWNNYHLLAWYQQRDGETPKMLVYFATTRQSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V314 igkv LLXD01000252.1 235782 SSGDIILTQSPGAQSVVPGQTVSIRCKASRSIGDDMNWYLQKPGEPPKLLIYDTTYRQSGVSDRFSASYSGTDFTLTISRVQTEDAGVYYCQQDYSTP
Lates calcarifer V313 igkv LLXD01000252.1 237306 SRGQVTVTQPGAVRSALGGSVTIRCRTSQDVYSSNRLAWYQQRDGETPKLLIYYATTRVSGIPDHFTGSGSNSDFTLTISGVQAEDAAVYYCQG
Lates calcarifer V312 igkv LLXD01000252.1 239237 SRGQVTVTQPGAVRSALGGSVSITCRTSQDVYGGSFLHWYQQRDGETPKLLIYAATSRESGIPDRFTGSGSNSDFTLTIRGVQAEDAAVYYCQS
Lates calcarifer V311 igkv LLXD01000133.1 1255298 KVLTQTPAVHTVSTGQEVVLNCNIQRYDGNYVRWYKQVPGGAPQYVLSFYHGDSSLSFGTGFSSDRFNSKSSSNIDYQFIIKRAEAGDSAVYYCQTWDDSASAAV
Lates calcarifer V367 igkv LLXD01000567.1 94970 SVGQNVVLTQPAAKTVQLGQTVSIECRASSQIGSCCSPKKYYLAWYHQKTGEVPKLLIYYTSDRESGISSRFSGSGSGNGVDFTLTISGVQAEDSGVYYCSS
Lates calcarifer V366 igkv LLXD01000567.1 99923 SVGQNVVLTQPAAKTVQLGQTVSIECRASPKVAQYSGAQYFLSWYHQKTGEAPKLLIYYTSDRESGISSRFSGSGSGNGVDFTLTISRVQAEDSGDYYCQS
Lates calcarifer V365 igkv LLXD01000567.1 106885 SSGEITLTQIPGSQSVVPGQTVSIRCKASSSVSSYLHWYLQKPGEAPKLLIRYATTRQSGVSDRFSGSGSGTDFTLTISRVQTEDSGVYYCQQGNSFP
Lates calcarifer V364 igkv LLXD01000567.1 108801 TQPGAVRSAVGGSVTISCRVSPKDDGDCGSSQNLPCLSWYQQRNGESPKLLIYTGSQRPSGIPDRFTGSGSDFDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V363 igkv LLXD01000567.1 117071 SSGDKILTQSPGSQSVVLGQTVSIRCKASSSFSTSYLNWCFQRPGESPKILIYSTTTRYSGVSDRFSGSGSDTDFTLTISRVQAEDSGVYYCNG
Lates calcarifer V362 igkv LLXD01000567.1 126642 SSGYVPLTQSPGSQSVVLGQTVSIRCTTSSSVDYDGVKWLNWYFQKPGEAPKPLIYKATGRHVGVSDRFSGDRFSGTDFALTILRVQGEDSGVYYCQQSLNIP
Lates calcarifer V361 igkv LLXD01000567.1 132276 SSGEIILTQSPGSQSVVLGQTVSIRCTTSSSVDYDGVKWLNWYFQKPGEAPKPLIYKATGRHVGVSDRFSGDRFSGTDFALTILRVQGEDSGVYYCQQSLNIP
Lates calcarifer V360 igkv LLXD01000567.1 134528 SSGYVPLTQSPGSQSVVLGQTVSIRCKASTSVELNGYKWLHWYFHKPGEAPKLLIYRATGRHSGVSDRFSGIASSGTDYTLTISRVQAEDAGVYYCGQSA
Lates calcarifer V359 igkv LLXD01000567.1 135979 QVTVTQSGAVRSAVGGSITIRCTVSPQVSVGSSSGKELLSWYQQRNGETPKLLIRYISERASGIPGRGTKTDFTLTISGVQAEDSGDYYCQS
Lates calcarifer V358 igkv LLXD01000567.1 141611 SSGDIILTQSPGSQSVVLGQTVSIRCKASSSVTYDLQWYLQRSGEAPKLLIYDDTTRYSGVSDRFSGSGSGTDFTLTISRVQAEDAGVYYCQQGNSFP
Lates calcarifer V357 trav LLXD01000391.1 234204 LIQTAEVPQQISVNVVEVGGNVTLQCQISEKEGQFFNWYRQTPGYMIQTVAKGTYSKQTLTGQFDNSRFKVTEGEAEYLLTINNVTKEDEATYFCQSGAAY
Lates calcarifer V356 trav LLXD01000391.1 239414 LIQTAEVPQQISVNVVEVGGNVTLQCQISEKEGQFFNWYRQTPGYMVQTVAKGTYSKQTLTGQFDNSRFKVTEGEAEYLLTINNVTKEDEATYFCQSGAAY
Lates calcarifer V355 igkv LLXD01000252.1 124656 QVTVTQPGAVRSAVGGSVTITCRTSQNVYFGGTYHYLAWYQQRDGETPKLLISLATSRQSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V354 igkv LLXD01000252.1 127746 SRGQVTVTQPGAMSAAVGGSVTITCRTSQNVHYNSPYHYLAWYQQRDGETPKLLIYLASTRASGIPGRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V353 igkv LLXD01000252.1 130234 SSGDIILTQSPGAQSVVLGQTVSIRCKASSSMSSYLHWYLQKPGEPPKLLIADTTYRQSGVSDRFSASYSGTDFTLTISRVQTEDAGGYYCQQRNSYP
Lates calcarifer V352 igkv LLXD01000252.1 130745 SRGQVTVTQPGAVSAALGDSVTITCRTSQDVYVYSNNHCLAWYKQRNGETPKLLIYWATSRQSGIPGRFTGRGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V351 igkv LLXD01000252.1 136467 QVTVTQSGAVRSALGGSVTITCRTSQDVYVYNNNHLLAWYKQKDGETPKLLIYRASTRASGSPGRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V350 igkv LLXD01000252.1 139305 SRGQVTVTQPGAVSAALGGSVTITCRTSQNVYSSNRLAWYQQRDGETPKLLIYYATTRVSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V349 igkv LLXD01000252.1 140961 SRGQVTVTQPGAVRSALGGSVSIRCRTSQDVYYSSPYHYLAWYQQRDGETPKLLIYVATDRVSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V348 igkv LLXD01000252.1 143193 QVTVTQPGAVRSALGDSVTITCRTSQDVYVSNRLSWYQQRDGETPKLLIYAATSQVSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V347 igkv LLXD01000252.1 146571 QVTVTQPGAVRSAVGGSITITCRTSQNVNFWNNNHLLAWYQQKDGESPKLLVYFANRRESGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V346 igkv LLXD01000252.1 147675 QVTVTQPGAVRSAVGGSVSIRCRTSQNVHLHYNSHCLAWYQQRDGETPKMLIYLASSRASGIPDRFTGRGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V345 igkv LLXD01000252.1 151870 SSGDIILTQSPGAQSVVPGQTVSIRCKASRSIGDDMNWYLQKPGEPPKLLIADTTYRQSGVSDRFSASYSGTDFTLTISRVQTEDAGVYYCQQRNSYP
Lates calcarifer V344 igkv LLXD01000252.1 153269 SRGQVTVTQPGAVSAALGGSITIRCRTSQNVYGSDRLSWYQQRDGETPKLLIYAATTRESGIPGRFTGSGSNSDFTLTISGVQAEDAAVYYCQSYHEINSQYL
Lates calcarifer V343 igkv LLXD01000252.1 158337 QVTVTQSGAVRSALGGSVSITCRTSQNVYVYNNYHYLAWYQQRDGETPKLLISYATTRQSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V342 igkv LLXD01000252.1 160825 SSGDIILTQSPGAQSVVLGQTVSIRCKASSSMGSYLHWYLQKPGEPPKLLIADTTNRQSGVSDRFSASYSGTDFTLTISRVQTEDAGVYYCQQRNSYP
Lates calcarifer V341 igkv LLXD01000252.1 161346 SRGQVTVTQPGAVSAALGDSVTITCRTSQDVYVYSNNHCLAWYKQRNGETPKLLIYWATSRQSGIPGRFTGRGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V340 igkv LLXD01000252.1 164712 SRGQVTVTQSGAVSAALGGSVTIRCRTSQDVYYSSPYHYLAWYQQRDGETPKLLIYWATSRQSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V339 igkv LLXD01000252.1 169282 SRGQVTVTQPGAVRSALGGSVTITCRTSQNVHVWNNYHLLAWYQQRDGETPKLLIYYATTRASGIPGRFTGSGSNSDFTLTISGVQAEDAAVYYCQG
Lates calcarifer V338 igkv LLXD01000252.1 171030 SRGQVTVTQPGAVRSALGGSISITCRTSQNVYYNSPNHYLAWYQQKDGETPKLLIYYATTRASGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V337 igkv LLXD01000252.1 173915 QVTVTQSGAVRSAVGGSITIRCRTSQNVYGSDRLSWYQQRDGETPKLLIYYASTRESGIPDRFTGSGSDSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V336 igkv LLXD01000252.1 176290 SRGQVTVTQPGAVRSALGGSVTITCRTSQNVYGSNCLAWYQQRDGETPKLLIYAASSRVSGIPGRFTGSGSNSDFTLTISGVQAEDAAVYYCQG
Lates calcarifer V335 igkv LLXD01000252.1 177385 QVTVTQSGAVRSALGGSVTITCRTSQNVHVYNNNHYLSWYQQRDGETPKLLIYAATYRASGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V334 igkv LLXD01000252.1 181963 TDLTQQLHRQTVSAALGGSVTITCSTSQNVYLHYNSHCLAWYQQRDGETPKLLIYAATSRKSGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQSYHEINSQWV
Lates calcarifer V333 igkv LLXD01000252.1 183736 SRGQVTVTQPGAVSAALGGSVTIRCRTSQNVYSSNYLHWYQQKDGETPKLIINYATNRQSGIPGRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V332 igkv LLXD01000252.1 186135 SRGQVTVTQSGAVSAALGGSVTITCRTSQNVYTWSSNHALAWYQQRDGETPKLLIYRATSRESGIPGRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V331 igkv LLXD01000252.1 188005 SRGQVTVTQPGAVRSALGGSVSIRCRTSQDVYVHNSNHRLAWYKQRDGETPKRFIHSATSRESGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V330 igkv LLXD01000252.1 189706 QVTVTQPGAVRSALGDSVTITCRTSQNVYVYNNYHYLAWYQQRDGETPKLLIYAATSRESGIPDRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V401 ighv LLXD01000993.1 7380 VDGQTLTQSEPVVKKPAESHRLTCTASGLSFSGYWMHWIRQAPGKGLEWIASHYDSSNIYYSQSFQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V400 ighv LLXD01000993.1 8498 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTDNSYATGWIRQREGKPMDWIMHRWGGGDFYQNNALKNKFLYHTYTSTSSVTLTGQNLQPEDTAVYYCVR
Lates calcarifer V399 ighv LLXD01000993.1 9838 VKCEQLTQPASVTVQPGQRLTITCQVSYSLSSYYTAWIRQPAGKELEWMSDDSSVKDSLKNKFSVDLDSSSKTVTLNGQNMQPEDTAVYYCA
Lates calcarifer V398 ighv LLXD01000993.1 10998 VKCEQLTQPASLTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWMSSDSSVKDSLKNKFSVDLDSSSNTVTLNGQNVQPEDTAVYYCAR
Lates calcarifer V397 ighv LLXD01000993.1 15185 VDGQTLTESEPVVKRPGQSHRLTCTGSGFDFSSAWMAWIRQAPGKGLEWVATIEYDSDRIFYSQSVQGRFTISRDNSKQQLYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V396 ighv LLXD01000993.1 17794 VWSEIKLDQSPSEVKRPGETVKVSCIISGYSMANNFIHWIRQRPGEALEWIGRISPYRNTASYASSFQSRFSFTQDVSSSTQYLQVNSLTAEDSAVYFCAR
Lates calcarifer V395 ighv LLXD01000993.1 19464 VYSIDLIQPESKVVQPGQSLTITCQVSGYSMTDNDYATGWIRQREGKPMDWIFHQWGGSSGSLYQNNALKNRFSYNRDMSAGTVTITGQNLQPEDTAVYYCARN
Lates calcarifer V394 ighv LLXD01000993.1 20962 VDGQTLTESEPVVKRPGESHTLTCTGSGFTFSDYAMNWVRQAPGKGLEWVAFVSQPSGSKQYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V393 ighv LLXD01000993.1 23168 VDGQTESEPVVKRPGESHRLTCTTSGFTFSDYSMHWARQAPGKGLEWIASISNSGGSYEYYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCAQ
Lates calcarifer V392 ighv LLXD01000993.1 24134 VKCVQLTQPASVTVQPGQHLTITCQVSYSVSSYYTAWIRQPAGKEMEWIGYAAGSNAYYKDSLKNKFSISTDSSRNTVTLNGQNLQPEDTAVYYCARDTQ
Lates calcarifer V391 ighv LLXD01000993.1 25632 VDGQTLTQSEPVVKRPGESHRLTCTVSGFSLSSYWMSWIRQAPGKGLEWIAADGGSSSKYYSQSVQGRFTTSRDNSRQQLYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V390 ighv LLXD01000993.1 28350 VYSIDLIQPESKVVQPGQSLTITCQVSGYFLTSSSYGTGWIRQREGKPMDWIFHQWGGSGSSFWQNDALKNKFSYNRDMSAGTVTITGQNLQPEDTAVYYCVRL
Lates calcarifer V389 ighv LLXD01000993.1 29490 VDGQTLTESEPVVKRPGESHTLTCTTAGFTFSSYEMNWVRQAPGKGLEWIAYISSGGSTTYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V388 ighv LLXD01000993.1 30746 VKCVQLTQPASVAVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKEMEWIGSAAAGYTTYYKDSLKNKFSISTDSSRNTYTAVYYCARESQ
Lates calcarifer V387 ighv LLXD01000993.1 32381 VDGQTLTQSEPVVKRPGESHRLTCTVSGFSLSSYWMSWIRQAPGKGLEWIATDTSGSNYYSQSVQGRFTTSRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V385 igkv LLXD01000770.1 26449 VDAVIVLTQTPAVHTVSTGQEVVLNCNIQRYDSNGVQWYKQVPGGAPQYVLRYHHSGSSLSFGTGFSSNRFNAKSSSNIDYQFIIKRAEAGDSAAYYC
Lates calcarifer V384 igkv LLXD01000770.1 26449 VDAVIVLTQTPAVHTVSTGQEVVLNCNIQRYDSNGVQWYKQVPGGAPQYVLRYHHSGSSLSFGTGFSSNRFNAKSSSNIDYQFIIKRAEAGDSAAYYC
Lates calcarifer V383 trav LLXD01000770.1 28929 VDAAKVLTQTPAVHTVSTGQEVVLNCNIQRDDNADIYWYKQVPGKAPQYVVRFYHSYSSPNFGTGFSSDRFNSKSSSNIDYQFIIKRAEAGDSAVYYC
Lates calcarifer V382 trav LLXD01000770.1 28929 VDAAKVLTQTPAVHTVSTGQEVVLNCNIQRDDNADIYWYKQVPGKAPQYVVRFYHSYSSPNFGTGFSSDRFNSKSSSNIDYQFIIKRAEAGDSAVYYC
Lates calcarifer V381 iglv LLXD01000770.1 33975 VSGVTVVTQKPPIVTVRKGETVTMDCNLGTVTRSAARWYKQIPGGVPQFVLVYYHGWWSVTYGTGFSSSKHTSNYKDESSYHMIISNVEEGDSAVYYC
Lates calcarifer V380 iglv LLXD01000770.1 33975 VSGVTVVTQKPPIVTVRKGETVTMDCNLGTVTRSAARWYKQIPGGVPQFVLVYYHGWWSVTYGTGFSSSKHTSNYKDESSYHMIISNVEEGDSAVYYC
Lates calcarifer V379 iglv LLXD01000770.1 35105 VSGVTVVTQKPPVVTVTKGETVTMDCNLGTVTNYEAVWYKQILGGVPQYVLKSHHSWSSVRYGSGFSSPKFTSNHQSTSDYRLIINTVEEGDSAVYYCKTK
Lates calcarifer V378 iglv LLXD01000770.1 35105 VSGVTVVTQKPPVVTVTKGETVTMDCNLGTVTNYEAVWYKQILGGVPQYVLKSHHSWSSVRYGSGFSSPKFTSNHQSTSDYRLIINTVEEGDSAVYYCKTK
Lates calcarifer V377 iglv LLXD01000770.1 36858 VSGVTVVTQKPPVVTVTKGETVTMDCDVFTDDGSRWYKQIPGVVPQFVLRNHYSYSSPKYGAGFSSPKFTSSHLSGTMYRLIINNVEEGDSAVYYCETWNDSVKENI
Lates calcarifer V376 igkv LLXD01000567.1 63185 QVTVTQPGVLRSAVGGSVTITCTVSPQVSVGSSSGKELLSWYQQRNGETPKLLISYISERASGIPVRFTGSGTKTDFTLTISGVQAEDSGDYYCQS
Lates calcarifer V375 igkv LLXD01000567.1 63185 QVTVTQPGVLRSAVGGSVTITCTVSPQVSVGSSSGKELLSWYQQRNGETPKLLISYISERASGIPVRFTGSGTKTDFTLTISGVQAEDSGDYYCQS
Lates calcarifer V374 igkv LLXD01000567.1 65909 SSGEIILTQSPGSQSVVLGQTVSIRCKASSSVSSYLNWYLQKPGEAPKLLIRYATTRHSGVSDRFSGSGSDPDFTLTISRVQAEDAGVYYCQQSYSG
Lates calcarifer V373 igkv LLXD01000567.1 65909 SSGEIILTQSPGSQSVVLGQTVSIRCKASSSVSSYLNWYLQKPGEAPKLLIRYATTRHSGVSDRFSGSGSDPDFTLTISRVQAEDAGVYYCQQSYSG
Lates calcarifer V372 igkv LLXD01000567.1 68937 SVGQNVVLTQPAAKTVQLGQTVSIDCRASSQVYHYSGAQYYLSWYHHKTGEAPKLLIYLTSTRLLGISSRFSGSGSGNGVDFTLTISGVQAEDSGDYYCQS
Lates calcarifer V371 igkv LLXD01000567.1 74005 SSGDIILTQSPGSQSVVLGQTVSIRCKASSSVDYDLQWYLQRPGETPKLLVRDDTIRHTGVSDRFTGSKSSNTDFTLTISRVQAEDSGVYYCQQSESFP
Lates calcarifer V370 igkv LLXD01000567.1 75841 SIGQNVVLTQPAAKTVQLGQTVSIECRASSQIGSCCSPKKYYLAWYHQKTGEVPKLLIYYTSDRESGISSRFSGSGSGNGVDFTLTISGVQAEDSGVYYCSS
Lates calcarifer V369 igkv LLXD01000567.1 79065 SSGDKILTQSPGSQSVVLGQTVSIRCKASSSFSTSYLNWCFQRPGESPKILIYSTTTRYSGVSDRFSGSGSDTDFTLTISGVQAEDSGVYYCNG
Lates calcarifer V310 trav LLXD01000133.1 1259298 KVLTQTPAVHTVSTGQEVVLNCNIQRDDGYNVYWYKQVPGKTPQYVLRFYHSHSSPSFGTGFSSDRFNSKSSSNIDYQFIIKRAEAGDSAVYYCQTWDDSAKENV
Lates calcarifer V292 trdv LLXD01000084.1 289893 LTAGDSISPDRGEVSGTDGHSVTLRCTYETNSDYPDLFWYRHHSDLQAPQFILRKGAKKETYQYNSNQNRYESQTTDTSTELTINRLTLADTGLYYCALR
Lates calcarifer V290 trav LLXD01000084.1 292422 MGSMNSIKPESSEEVVTEGTNINLTCKYDGAIDNIQWYRQYQRSRPEFLLYITEGGSIHPILSDFSAHINKGEKRVDLEIISAKVTDSAVYYCALQPIVTG
Lates calcarifer V271 trav LLXD01000084.1 338265 QDTVTQPTRDVTAAEGDTVTLNCTFETSVTPTLFWYKQEENDFPKYLLKFLSSTVYHAPEIQKDRFDAERKDNVFSLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V251 trav LLXD01000084.1 394758 QDTVTQPTGDVTAAEGDTVTLNCTFKTTYSGPTLFWYKQEENDFPKYMLRCLSQTVDHAPEIQKDRFHAEIKEKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V213 ighv LLXD01000042.1 2538407 VDGQTLTQSEPVVKRPGESHTLTCTTSGFTFSDYSMHWIRQAPGKGLEWIAYIRYDGGSTYYSQSFQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V175 ighv LLXD01000042.1 2609777 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSSYEMNWVRQAPGKGLEWVAWHDDGSSSKSYSQSVQGRFTISRDDSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V137 trbv LLXD01002491.1 4606 VSLGLEVRQSHSDLIKKPGDKVQIFCSYDKTDYRMMLWYQRSPGDTALKLIGYLNYKDVKMEELYDEDFNISGDLSVNTVKNGSLILEHAKQEHSAVYYCAASK
Lates calcarifer V99 trbv LLXD01000801.1 35154 SSLSDKVKQSPAHMFTKPQEKAKITCSHSIQDYNRIYWYKQAKNKELQLLGYMNVNNGYPEDGLDVKIEGSALKNEVCNLTTEGLQLNDNAVYFCAA
Lates calcarifer V97 trbv LLXD01000801.1 31773 SSLSDKVKQTPADIYKKPKEEAIINCSHSIDNYYRILWYKQLKDKQLQFLGYMNLKDGVPEAGAGVKIEGDANKGQTCTLIIDGLSLNNSAVYFCAASYHSAT
Lates calcarifer V60 ighv LLXD01000758.1 2422 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSGYYTGWIRQPAGKGLEWIGSAAGSTTYYKDSLKNKFSITTDSSSNTVTLNGQNVQPEDTAVYYCARD
Lates calcarifer V402 trbv LLXD01002430.1 16723 KVKSVTFEQSPSQIVKKGTKELRINCSHDGSNLQRMLWYQHKPSSQSMSLIGYTVLTSDPVFEDQFKDRFQLKREDILRGSLIILTVDPSDSAVYFCAASTH
Lates calcarifer V386 ighv LLXD01000993.1 34537 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTDGSYATGWIRHREGKLMDWIFHQWGGSSGSFWQNDALKNRFSYSRDMSAGTVTITGQNLQPEDTAVYYCVRC
Lates calcarifer V368 igkv LLXD01000567.1 91160 SSGDIILTQSPGSQSVVLGQTVSIKCKASTDIDDDLHWYLQKPGEAPKLLIRYATTRQSGVSDRFSGSGSGTDYTLTISRVQTEDSGVYYCQQSNSG
Lates calcarifer V4 ighv LBLR01004980.1 1725 VDGQTLTQSEPVVKRPGESHTLTCTGSGFTFSSYYMAWVRQAPGKGLEWVASISSSGSSKYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V3 ighv LBLR01004830.1 6023 WTITESEPAVKRPGESHRLTCTTSGLSFSSSWMAWMRQAPGKGLEWIATDTNGGSNRYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V2 ighv LBLR01004830.1 3188 VKCEQLTQPASVTVQPGQHLTITCQLSYSVSSYRTAWIRQPAGKELEWIGHASAGYTTYYKDSLKNKFSISTDSSSNTVTLNGQNVQPEDTAVYYCARD
Lates calcarifer V1 ighv LBLR01004830.1 164 VDGQTLTQSEPVVKRPGESHRLTCTASGFTFSSQYLAWIRQSPGKGLEWIAYISSGGGSSTYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCAR
Lates calcarifer V0 trav LBLR01000467.1 123 QDTVTQPTGDVTAAEGDTVTLNCTFDTSYPNSYLFWYKQEVNNSPKYMLMCFSKTVDHAPEIQKDRFHAAIKEKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V41 ighv LBLR01006036.1 12628 VYSIDLIQPESKIVQPGQSLTITCQVSGYSMTSSSYATGWIRQREGKPMDWIMHRWGGGTLEQNDALKNKFLYHTYTSTSSVTLTGKNLQPEDTAVYYCVR
Lates calcarifer V40 igkv LBLR01005886.1 876 SVGQNVVLTQPAAKTVQLGQTVSIDCRASSQVYHYSGAQYYLSWYHHKTGEAPKLLIYLTSTRLLGISSRFSGSGSGNGVDFTLTISGVQAEDSGDYYCQS
Lates calcarifer V39 ighv LBLR01005833.1 2928 VDGQTLTQSEPVVKRPGESHTLTCTASGYTFSDYPMVWVRQAPGKGLEWIAWHEWKSSTSKSYSQSVQGRFTISKDNSRQQLYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V38 ighv LBLR01005186.1 1752 VDGQTESEPVVKRPGESHRLTCTTSGFTFSDYGMHWARQAPGKGLEWIASISNSGGSYEYYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCAQ
Lates calcarifer V37 ighv LBLR01005186.1 2755 VKCEQLTQPASVTVQPGQHLTITCQVSYSVSSYYTAWIRQPAGKEMEWIGYAAGSNAYYKDSLKSKFSISTDSSRNTVTLNGQNLQPEDTAVYYCARDTQ
Lates calcarifer V36 trav LBLR01004751.1 802 QDTVTQPTGDVTAAEGDTVTLNCTFETTTYSYLFWYKQKPNDIPKYILQRYSGTKARADSQKDRFDTEIKDKLFPLKIQKLQLSDSAVYYCALTPTVTG
Lates calcarifer V35 trdv LBLR01002174.1 10 LTAGDSISPERGEVSGGEGQSVTLRCTYETSADRVLLYWYRHHSDLQAPQFILYKGEGAWKGQDHIPDKQYESQTTDTSTELTINRLTLADTGLYYCALE
Lates calcarifer V34 trav LBLR01001813.1 2116 QDTVTQPTGDVTAAEGDTVTLNCTFETSSPSRTLFWYKQEVNDFPKYVLRRGSYGEHNAPEIQKDRFNAEIKEKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V33 igkv LBLR01022107.1 1541 SSGENILTQSPGSQSVVLGQTVSIRCKASSSTSYLNWYLQKPGEALKLLIYEVTTRQSGVSDRFSGSRSGTDYTLTISRLQAEDSGVYYCGQSGSTP
Lates calcarifer V32 trbv LBLR01014289.1 1978 ASVSDKVYQTPTDIHKKQEETAKIYCSHNDNSYNQILWYKQLKDKKLQLLGYMYVTPTLEPGVNVIDGGANKGQNCTFTIEGLSLNNSAVYFCAASYHSAT
Lates calcarifer V31 trav LBLR01013814.1 28462 FSLCVKINQPPFAFIREGDPSVTLQCEQDDNQFYYMFWYRQSNSGKMDLVTYSTSKDNTNTEAPFNKSKYTMSRPAVLSSSLQIKPVEAEDSAVYYCASSR
Lates calcarifer V30 trbv LBLR01013814.1 25997 KVKSVTFEQSPSQIVKKGTKELRINCSHDGSNLQTMLWYQHKPSSQSMSLIGYTVLTSDPVFEDQFKDRFQLKREDILRGSLIILTVDSSDSAVYFCAASTH
Lates calcarifer V29 trbv LBLR01013814.1 23048 HVSAVTFQQSPLQIVKENSEVHINCTHDDSTLLLMLWYQQREDSLSMTLITYGYAKTNPNYEGQFDKQFKLTREDATSGTLTIQRANLSHSAVYFCAASTQ
Lates calcarifer V28 trbv LBLR01013814.1 20476 FSLGVQVHQSPSALFRKVGDNVQLFCTHGQTDYRVMLWYQQSPGDKALKLLGYGYTQFNDDSVEEPFRKHFKLAGDLKGDQKNGSLSITDLKAPEHTAVYFCAASK
Lates calcarifer V27 trgv LBLR01013814.1 19615 VSLGLEVRQSHSDLIKKPGDKVQIFCSHDKTDYRVMLWYQRSPGDTALKLIGYLNFKDVKMEELYDEDFKISGDLSGNTAKNGSRILNLAEKEHSAVYYCAARE
Lates calcarifer V26 trav LBLR01013814.1 18874 VSLGLEVHQSHSDLIKKPGDKVPIFCSHDKTDYTLMLWYQRSPGDTALKLIGYLYNQAVKMEKEYEEHFHISGDLRGVAAKNGSLIVQITGHEQSAVYYCAASY
Lates calcarifer V25 trav LBLR01013814.1 18222 RCQDVTQHPAISWNYESKSAEMNCSHNKDIYHTQMYWYRQRPEETMTLIVYTVYEGKSDYGRLPQTKYETIKDTVQTGALTVKNLQPEDSGVYFCAVS
Lates calcarifer V24 trbv LBLR01013814.1 17231 SSLSDKVKQSPAHMFTKPQEKAKITCSHSIQDYNRIYWYKQAKNKELQLLGYMNVNNGYPEDGLDVKIEGSALKNEVCNLTTEGLQLNDNAVYFCAA
Lates calcarifer V23 trbv LBLR01013814.1 12960 SSLSDKVEQTPADIYKKQKEEARINCSHSIDNYYRILWYKQLKDKQLQFLGYMNLKDGVPEAGANVKIEGDANKGQTCTLIIEELTWNNSAVYFCAASYHSAT
Lates calcarifer V22 trbv LBLR01013814.1 11772 SSLSDQVHQTPADMYKKPGENATISCSHSIQSYDQILWYKQSEGQLQLLGYVYFNTGYPEAGANAKMEGDANKGQTATLTVEALSLSSSAVYFCAAS
Lates calcarifer V21 trdv LBLR01013814.1 7980 RSLSNKVDQAPTSILGGPHDSATISCSHSVSSYNIILWYHQPVGDSALKLIGHILYTNPTLEEKFKQHFNVTGDGSSKSLLHVLKFRQPEDSGMYYCAAS
Lates calcarifer V20 trbv LBLR01013814.1 4748 LSDGSDVTQTPLLWKNEGQSATIDCSHTKDASYFQMYWYRQLPGEMMKQIVFTTTTPPHKYESGFSEDKFPAKKNDAQTGSLTVEKLLHNDSGVYFCAVS
Lates calcarifer V19 trbv LBLR01013767.1 76575 APDTKRVDQTPPVIIKKTGESVTSEIKCSHSIQNHDVILWYKQDEHGLKLLGYLNLDSPYPEDDVKGKISFDGDGRKQSSLTISNLLSSDGGVYFCAAR
Lates calcarifer V18 trbv LBLR01013767.1 75150 LIAGTDVTQTPILWIKRGENAEMNCSHTKGDLYSQMYWYRQLPGETMKLIVFTRTGNSNHDFGDFSKDKFSATKPNAETGTFTVKNVELGDKGSYFCAVSEHSDT
Lates calcarifer V17 ighv LBLR01013471.1 1102 VDGQTLTQSESAIKRPGQSHTLTCTASGFSFSDYWMLWFRKSPGKGLEWIASIIYHSGSTKNYAPSVQGRFIINRDNSKQQLYLQMNSLKTQDSAVYYCARD
Lates calcarifer V16 igkv LBLR01012207.1 3040 SSGDIILTQSPGSLSVVLGQTVSFSCKASSTPSYLHWYLQKPGEAPKLLIYYATTRHTGVSDRFSGSGSGTDYTLTISRVQAEDSGDYYCQS
Lates calcarifer V15 ighv LBLR01009750.1 2661 AEGQSLTSSEPVVSRAGESVTLSCKVEGLALAWLHWIRQKPGKGLEWIGRIDSGTGTIFAQSLQGQFSITKDTSRNIVYLEVKSLKQEDSGVYYCARE
Lates calcarifer V14 ighv LBLR01009750.1 1373 VDGQTLTQSEPVVKRPGESHTLTCTASGFTFSDYNMNWVRQSPGKGLEWIAYISSLSSYIYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V13 ighv LBLR01009062.1 31 VDGQTLTQCEPVVKRPGESHRLTCTASGFTFSDYGMHWIRQAPGKGLEWIAYISSGGSYIYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V12 iglv LBLR01009040.1 2124 VSGVTVVTQKPPVVTVTKGETVTMDCNLGTVTNSSARWYKQIPGGVPQYVLRWYHSWSSVEYGSGFSSPKFTSNHQSTSDYHLIINTVEERDSAVYYCQTW
Lates calcarifer V11 ighv LBLR01008678.1 7277 VMCEQLTQPASVTVQPGQHLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGYAAAGSTTYYKDSLKNKFSINTDSSSSTVTLNGQNVQPEDTAVYYCAR
Lates calcarifer V10 ighv LBLR01008678.1 5422 VDGQTLTESEPVVKRPGESHRLTCTTSGFTFSSYAMAWVRQAPGKGLEWIAWHDSGSGSTTYYSQSVRGRFTISKDNSRQQLYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V9 ighv LBLR01008678.1 3782 VDGQTLTESEPVVKRPGESHTLTCTVSGFTLSSYPMNWVRQAPGKGLEWIAFIHTGSSHIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCA
Lates calcarifer V8 ighv LBLR01008678.1 2059 VDGQTLTQSEPVVKRSGESHRLTCTASGFSFSGYWMGWIRQAPGKGLEWIASISDDSSSTYYSQSVQGRFTISRDDSRQQLYLQMKSLKTEDSAVYYCARE
Lates calcarifer V7 trbv LBLR01008654.1 3399 LSDGSDVQQVSILWEKRGNNATIQCRHTKDASYTQMYWYRQLPGETMKQVVFTRLGNNYHDFGNFSKEKFSATKPDSYSGTFTVKNLVPEDKGLYFCAVS
Lates calcarifer V6 trbv LBLR01008654.1 1827 LSDGNDVNQTPLLWSTESQSATMNCSHTKGSTYRQMYWYRQLPGETMKQIVYTTAYSPHEYQSGFSEDKFPAKKNDAETGSLTVKKLLHNDSGVYFCAVS
Lates calcarifer V5 trbv LBLR01008654.1 115 LSDESDVNQTPLLWSTEGQSATMNCSHTKGSTYWLMYWYRQLPGETMKQIVFTTTATPNHDFGDFSKDKFSATKPNAETGTFTVKNVEPGDKGLYFCAVS
Lates calcarifer V78 ighv LBLR01022425.1 4187 VDGQTLTESEPVVKRPGAYHTLTCTTAGFTFSSYEMDWVRQAPGKGLEWIAYINSGGSTTYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V77 ighv LBLR01022425.1 5445 VKCVQLTQPASVTVQPGQRLTITCQVSYSVSSHYTAWIRQPAGKELEWIGSAAAGYPTYYKDSLKNKFSISTDSSRNTYTAVYYCARESQ
Lates calcarifer V76 trdv LBLR01021989.1 302 LTAGDSISPEEGEVSGREGQSVTLRCRYETNYDYPDLFWYRHHSELQAPQFILRKGAKKSAAQHIPDKRYESRTTDKSTVLTINSLTLANTGLYYCALR
Lates calcarifer V74 trav LBLR01016672.1 9 TVTQPTGDVTAAEGDTVTLNCTFKTTYSGPTLFWYKQEENDFPKYMLRCLSQTVDHAPEIQKDRFHAEIKEKSVPLKIQKLQLSDSAVYYCALQ
Lates calcarifer V73 trbv LBLR01015160.1 534 ASVSDKVQQTPADIHKKQGQTAKIYCSHNDDNYDQILWYKKSDRELQFLGYMLTISGKPADGVNVKIEGGASKGQNCTLTIEGLSLNNSAVYFCAAS
Lates calcarifer V72 igkv LBLR01014544.1 30164 CSGQVTVTQPPVLTTTPGSTVTITCKTSQDVYTYSDGDQAMFWYQQKSGQTPKLLIRYVSSPVSGTPARFSGSGSGSDFTLTISGVQAEDAAVYYCQS
Lates calcarifer V71 trav LBLR01014309.1 3356 VIHSATVKQDTGVVSASVGDNVTLRCFYDSQVAMHFSWYRQTLGGRPELMSTIYKYDQPSKVFHWLEKNPRFSVHREQGMNHLHIADIHLSDSATYFCGS
Lates calcarifer V70 trav LBLR01014026.1 2383 QDTVTQPTGDVTAAEGDTVTLNCTFKTTNPSPYLYWYKQGVHDFPKYMLRCFSKSVDHSPEIHKDRFHAEIIKKSVPLKIQKLQLSDSAVYYCALQPTVTG
Lates calcarifer V69 trav LBLR01013396.1 7508 QTTAVKFSSSVHQQSDFLSVEAGGSVTLHCFYKDDGTAWLYWYKQTLGQKPRLVSTFFVYDERGTFYHEFKNNPRFTLETKNGRNHLTISNLRTSDSATYYCARDY
Lates calcarifer V68 trav LBLR01013396.1 11874 QMTGLELSSAVHQKRRFISVNVGDSVTLRCFYGDDDSAWLFWYKQTPGQKPRLISTFYVYDVRTTFYHGFKNSPRFTLDTENGSHHLMISNLHLSDSATYYCAYS
Lates calcarifer V67 trav LBLR01012343.1 4914 PIKNACFNVQAFIPLAVPPQEALSLSCRGTGFTFSQHGMHWIRQPAGKALEWMGLIYYDASKTVYASSEQGRIEITRDNSNSMVNLRLSNLKPEDSAVYYCAR
Lates calcarifer V66 ighv LBLR01011429.1 1082 VDGQTLTESEPVVKRPGESHTLTCTYSGFGGNYNKAWIRQVPGKGLEWITYISGSGSSKHYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V65 ighv LBLR01011429.1 2540 VNCEQLTQPASVTVQPGQHLTITCQVSYSLSSYWTGWIRQPAGKGLEWIGIKYTGGSYYKDSLKNKFSIDLDSSSNTVTLNGQNLQPEDTAVYYCARDTQ
Lates calcarifer V64 ighv LBLR01011429.1 6637 VDGQTLTESEPVVKRPGESHTLTCTASGFSFSSYDMAWVRQAPGKGLEWVAWIYSSGSSKSYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCA
Lates calcarifer V63 ighv LBLR01011429.1 9381 VDGQTLTESEPVVKRPGESHTLTCTASGFTFSSYGMAWIRQAPGKRLEWIAYISTDSSPIYYSQSVQGRFTISRDDSSSKLYLQKNSLKTEDTAVYYCAR
Lates calcarifer V62 ighv LBLR01011429.1 13206 VDGWTLTESEPVVKRPGESHTLTCTVSGFTFSDYSMHWVRQAPGKGLEWVAYIRYDFSGTTFYSQSVQGRFTISRDDSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V61 ighv LBLR01011429.1 16669 VKCEQLTQPASVTVQPGQRLIITCQVSYSVGSYHTAWIRQPAGKTLEWIGSRRDGGSSYYKDSLKNKFSIDLDSSSKTVTLNGQNLQPEDTAVYYCARDTQ
Lates calcarifer V60 ighv LBLR01011429.1 17940 VDGQTLTESEPVVKRPGESHTLTCTGSGFTFSDYSMHWIRQAPGKGLEWVAFISNSGGSYIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V59 ighv LBLR01010678.1 25855 VDGQTLTQSEPVVKKPAESHRLTCTASGFNLGSYHMKWIRQAPGKGLESIASHYDSSNIYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V58 ighv LBLR01009609.1 557162 VDGQTLTESEPVVKRPGQSHRLTCTGSGFDFSSAWMAWIRQAPGKGLEWVATIEYDSDRIFYSQSVQGRFTTSRDNSREQVYLQMNSLKTEDSAVYYCARQ
Lates calcarifer V57 trav LBLR01009579.1 4 QDTVTQPTGDVTAAEGDTVTLNCTFETTALNSYLYWYKQGVRDFPRYVLRRDTYGTEENAPEFLKDRFDAKIKDKLFTLKIQKLQLSDSAVYYCALTPTVTG
Lates calcarifer V56 ighv LBLR01008798.1 1880 VDGQTLTQSEPVVKRPGESHTLTCTASGFTLSSYHMAWVRQAPGKGLEWVAWLDSSGSSKRYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARE
Lates calcarifer V55 ighv LBLR01008798.1 3469 VKCVQLTQPASVTVQPGQRLTITCQVSYSVSRFRTSWVRQPAGKKMEWIGSRHVGYDTYYKNSLKNKFSISLDSSRNKMTLNGQNVQPEDTAVYYCAR
Lates calcarifer V54 ighv LBLR01008798.1 12206 VDGQTLTESEPVVKRPGESHRLTCTGSGFIFSSLYLAWIRQAPGKGLEWIAYINTGGGYKSYSQSVLGRFAISKDHSREQLYLQMNSLKTEDSAVYYCA
Lates calcarifer V53 trbv LBLR01008666.1 4664 QTESTTFQPSHPRIVKERARVEIKCSHDNNDLNIMLWYQQTKSGLMNLIGYNYIGSDPNYEKQFEHQFEITRENIRTGALIIHSVNVSDSAVYFCAASTQ
Lates calcarifer V52 trbv LBLR01008666.1 5277 QASAVTFLQSPPQIVKENSEVHINCSHDDSTLVIMLWYQQSKDSLSMTLIGYGYESSQNYEGLFEEQFTMTRQNTVKGTLIIHRASLSHSAVYFCAASTQ
Lates calcarifer V51 trbv LBLR01008666.1 6228 VSQSVTITQWPHYISRPPGGLAEIHCYQNDTDYEYLYWYKQLRGKDIQLVVVLVVGTPNFEEGFKSGFQAVKVNEKQWSLTISSVQEKDEAFYLCAAS
Lates calcarifer V50 trbv LBLR01008666.1 10109 VSLGLEVRQSHSDLIIKPGDKVQIFCSHDKTDYRMMLWYQRSPGDTALKLIGYLNYKDVKMEELYDEDFNISGDLSVNTVKNGSLILEHAKQEHSAVYYCAASK
Lates calcarifer V49 ighv LBLR01006160.1 766 QNTSSSQIQPASVTVQSGQHLTITCQVSYSVSDYFTAWIRQPAGKEMEWIGMRYTGDSHYKESLKNKFSIDLDSSSKTVTLNGQNLQPEDTAVYYCAR
Lates calcarifer V48 ighv LBLR01006160.1 1644 TVPLSLLNLNTQSEPVVKRPGESHTLTCTASGLSFSSYTMNWVRQAPGKGLEWIALVHTSSTPISYSQSVQGRFTISRDDSSSKVYLQMKRLKSEDTAVYYCA
Lates calcarifer V47 ighv LBLR01006160.1 2627 VDGQTLTESGPVVKRPGGSHTLTCTGSGFTFSSYYMAWIRQAPGKGLEWIAWVQSSGGSEKYYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Lates calcarifer V46 ighv LBLR01006160.1 5882 VKCEQLTQPASVTVQPGQHLTITCQVSYSVGSHHTVWIRQPAGKELEWIIGGRVGHTTFYKDSLKNKFSISLDSSSNTVTLNGQNVQPEDTAVYYCAR
Lates calcarifer V45 ighv LBLR01006160.1 7524 VKCEQLTQPVSVTVQPGQRLTITCQVSYSVSSLYTDWIRQPAGKELEWIGRAHTGGSYYKDSLKSKFSISADSSSKTVTLNGQNMQPEDTAVYYCA
Lates calcarifer V44 trbv LBLR01006036.1 1654 VWSEIKLDQSPSEVKRPGETVKVSCIISGYSMADNFIHWIRQRPGEALEWIGRISPYRNTASYASSFQSRFSFTQDVSSSTQYLQVKSLTAEDSAVYLCAR
Lates calcarifer V43 ighv LBLR01006036.1 6267 QTITESEPAVKRPGESHRLTCTTSGFDFRNSRWSWNRQAPGKGLEWIAYISTASTPIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCAR
Lates calcarifer V75 igkv LBLR01021589.1 1332 SVGQNVVLTQPAAKTVQLGQTVSIECRASSQIGSCCSPKKYYLAWYHHKTGEVPKLLIYRTSDRESGISSRFSGSGSGNGVDFTLTISGVQAEDSGVYYCSS
Lates calcarifer V42 ighv LBLR01006036.1 7616 VYSIDLIQPESKVVQPGQSLTITCQVSGYSLTDDSYATGWIRQREGKLMDWISHQWGGGTLRQNDALKNKFSYNRDTSARTVTITGQNLQPEDTAVYYCVRY