WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Monodelphis domestica AAFR00000000.3 (AAFR03) 205 26 20 77 48 21 7 6
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Monodelphis domestica V35 trdv AAFR03009584.1 10188 LQAQVVQVNDTVSGFIGTDVVLHCSFSNPLPMVRITQMTWQKATNGSKQNVAIYNPNMGVSVLAPYRERVTFLRPSFTDGTIRLSHLELEDEGVYICEFATF
Monodelphis domestica V56 ighv AAFR03013813.1 34763 VDSEVQLVETGGDVRQPGGSLRLTCTTSGFTFSNYYMHWIRQAPGKGLEWVAVIRNPANGLTAEYAEAVKGRFTISRDDASKMVYLQMNSLKTEDTAIYYCAK
Monodelphis domestica V57 ighv AAFR03013813.1 86516 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSNYWMSWVRQAPGKGLEWVSEIKYDGSSTYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCA
Monodelphis domestica V58 ighv AAFR03013813.1 95620 VHCDIQLVESGGDVRQPGGSLKLSCKASGFDFSSYWMNWVRQAPGKGLEWVSSINGDGSSTYYTDSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V59 ighv AAFR03013814.1 52189 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYDMNWVRQAPGKGLEWVSTIGTGSSTYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V60 ighv AAFR03013816.1 10273 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYDMSWVRQAPGKGLEWVSYISSGGSSTNYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V61 ighv AAFR03013817.1 18301 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSNYWMSWVRQAPGKGLEWLSNINGAGSSTNYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V62 ighv AAFR03013817.1 30797 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYYMYWIRQAPGKGLEWVSYINGAGSSTSYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V63 ighv AAFR03013817.1 55335 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYGMYWIRQAPGKGLEWVSAISNDGSSTYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V64 ighv AAFR03013820.1 12016 AHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYWMSWIRQAPGKGLEWVSYINGAGSSTSYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V65 ighv AAFR03013822.1 459 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYSMNWVRQAPGKGLEWVSRIDTGSGTYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCSR
Monodelphis domestica V66 ighv AAFR03013824.1 1599 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYEMNWVRQAPGKGLEWLSNINGPGSSTYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V67 ighv AAFR03013824.1 24901 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYYMSWVRQAPGKGLEWISEISNDGSSTYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V68 ighv AAFR03013826.1 25333 VHCDVQLVESGGDVRQPGGSLKLSCKASGFTFSSYYMSWVRQAPGKGLEWVSLIDTGSSTSYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAG
Monodelphis domestica V69 ighv AAFR03013829.1 2566 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYSMNWVRQAPGKGLEWVSRIDTGSGTYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAG
Monodelphis domestica V70 ighv AAFR03013834.1 36017 VHCDIQLVESGGDVRQPGGSLKISCKASGFTFSDYSMNWVRQAPGKGLEWVSYISYDGSSTGYADSVKGRFTISRDNGNSLLHLQMNSLKTEDTAMYYCAR
Monodelphis domestica V71 ighv AAFR03013834.1 60027 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYYMHWIRQAPGKGLEWLSRIDTAGSSTRYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V72 ighv AAFR03013834.1 78678 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYYMHWIRQAPGKGLEWVSYISNGAGSSTSYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V73 ighv AAFR03013834.1 111079 VHCDVQLVESGGDVRQPGGSLKLSCKASGFTFSSYYMHWFRQAPGKGLEWLSHIDTGSGTYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAG
Monodelphis domestica V74 ighv AAFR03013835.1 8818 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSNYWMSWIRQAPGKGLEWVSSINNGGSSAYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V75 ighv AAFR03013839.1 6057 VHCDIQLLESGGDVRQPGGSLKLSCKASGFTFSSYGMNWVRQAPGKGLEWVSYINTDGSSTNYADSVKGRFTTSRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V78 trbv AAFR03013989.1 7546 FLDAGVTQTPTQRVSGKGQNVTFECDPIKGHAYIYWYRQFLGEELKFLIYLQNEKIVDDAGMPKSRFSALCDSNLHCKFKIQTTEPIDSAVYFCASSV
Monodelphis domestica V79 trbv AAFR03013989.1 18367 SVHAGVTQTPKHLVKEKGQEAKLRCKQNLNHDYMYWYRQDDQQSLETMFIYNSRNLFGNFTNSSRFRPESPDKVHLNLQIESVQPKDTATYFCASS
Monodelphis domestica V80 trbv AAFR03013989.1 37778 LMDSGVTQTPRYVIKGREQKVVLKCDPIKGHRFIYWYQQILKEELKFLAFLQDNQVMENSGLFQNRSLLKWPRNLPCTLTIKSTEKGDSAVYFCASSA
Monodelphis domestica V81 trbv AAFR03013990.1 636 GQPDAGVTQHPDYLVARKGQSVTLGCDPISGHLSAFWYRQIKHQGPVMLFNYYNKKLSEKGNISDRFIAEQQNDLHFKLIISSLEQADSALYLCASSK
Monodelphis domestica V82 trbv AAFR03013990.1 4159 VQPDAGVTQRPSYLVSRKGQSVALGCDPISGHNGAFWYSQIQGQGPKMLFYYYYKQLNEKGNISDRFVAKQHENNHFTLNINYLELGDSANYLCASSK
Monodelphis domestica V83 trbv AAFR03013990.1 6224 VQPDAGVTQRPSYLVSRKGQSVTLGCDPISGHNGAFWYSQIQGQGPKMLFYYYLKQLNEKGNISDRFVAKQHENNHFTLNINYLELGDSANYLCASSK
Monodelphis domestica V84 trbv AAFR03013991.1 4694 PLDAGITQTPWHVITRAGQNTDLRCEQNLGHNTLYWYQQDSKMGLRMMFYYNNKALIEKANISNRFKPNSPENSRLNLHIESLQAEDTATYFCASSL
Monodelphis domestica V85 trbv AAFR03013991.1 8975 PLDAGVIQTPWHLITRIGQKANLRCEQYMGHDTRYWYRQNSKMRLQMMFFFSNTELIGNETASSRFKPETSANSLLDLYIESLQLEDTATYLCASSL
Monodelphis domestica V87 trbv AAFR03013992.1 34486 LTDGAVLQTPRYLVTGKGQVVTLRCDQDQNYDYMYWYQQKLGQEPKQLFYHFKIADGTREKGISENFQAHRSEMNFCLLTVKSLTISDSAIYLCAIS
Monodelphis domestica V88 trbv AAFR03013992.1 41238 LTDAEVTQTPKQLVTEIRQQVNLTCHPISGHTGLYWYQQVTGNGIELLVYLQNNKILDDTQFSKDRFSVIWPKSSPSILTIKTTELKDSAVYLCASSP
Monodelphis domestica V89 trbv AAFR03013993.1 10445 LTDGAVLQTPRYLVTGKGQVVTLRCDQDQNYDYMYWYQQKLGQEPKQLFYYYKIADGTREKGISENFQAHRSEMNFCLLTVKSLTISDSAIYFCAIS
Monodelphis domestica V90 trbv AAFR03013994.1 4413 LTDAGVTQVPKYLITETGQQVTLTCGPISGHVALYWYQQITGKGIEMLVNFQNNKALDDTRLPKERFIVEWLKESPSTLTIKSTEFGDSAVYLCASSS
Monodelphis domestica V91 trbv AAFR03013994.1 18461 ITNAGVTQIPKQLIAETRQQVNLTCHPISGHNALYWYRQVPGKGIEMLIGFQNNEDFDKTGLPDQFIVKWPKSLPSTLTIQSTELKDSAVYLCASSP
Monodelphis domestica V92 trbv AAFR03013994.1 21134 LGLGALISQQPSRVIWKKGSSVLIHCHQIDTQLTFMYWYHQLPQQSLVLIATANQGSTATYEKGFDEAKFPISRPDTKSSTLTVTDLGPKDSGIYFCSAS
Monodelphis domestica V93 trbv AAFR03013994.1 47155 PMDAGITQTPRYLVTKTGKKLTLRCEQNMKHDYMSWYREDPGLGLRLIHYSQDINLIAPGDIPEGFTVSRLKTDQFPLTLESTSPSHTSVYHCASAK
Monodelphis domestica V95 trbv AAFR03013994.1 60367 LRKAEITQTPRYLVTKVKQEVTLRCQQNWGHNYMYWYQQEPQKELKLMFYFSYQTMASNESVPQRFKAAPPKNGVLTLPIHTVEAEDSVTYFCSSSK
Monodelphis domestica V96 trbv AAFR03013994.1 76239 PMDAKDAGITQDPRHIVTGMGQTVTLGCEQTLGHDAMYWYRQDLAQGLQLIYYSLIEGDIQKGDIPEGYKVTREKKESFPLILQMPRPNQSSLYLCAS
Monodelphis domestica V97 trbv AAFR03013994.1 84666 SMDAKGASITQTPRNLITGIGKNVILTCEQNLGHETMYWYRQDQGQGLQLIYYSITKGDLQKGDISEGYSVTRDQKEFFRLVVQSTTNKQASSYLCASSK
Monodelphis domestica V99 trbv AAFR03013994.1 94110 PTDARITQNLRYLVTATGREVTLRCEQDMGHDSMYWYRQDPGLGLQVISFSLNVGFSETETPYGYSASRKEKPFFLLTLKSTSTNQTSGYFCASST
Monodelphis domestica V100 trbv AAFR03013994.1 112667 PTDSGVTQNFKYLVKEMGHKVTLRCDQDLRHDYMYWYRQDPGLGLKLIYYSMDVNIIDKGEISDDYRASRTKQQFFLLIMDSANRNQTSEYFCASSL
Monodelphis domestica V101 trbv AAFR03013994.1 117267 LINARVTQNPKHLITRTGQAVTLQCEPMPTYDVLYWYRQKSEQRPQFLYDFRDNKMVESKVDKSRFTAEWPKYSSSILKIGYTEVEDLAVYLCASYK
Monodelphis domestica V144 trdv AAFR03022237.1 179951 KSIRCNQVIQSPPVQEVALGREVTLFCEYKTNHGNPDLYWYRVKPDSSIQFVLYRDNSRFVNAPFAKDRFSVQRKTRTTFNLVISEVEPGDGGLYYCAL
Monodelphis domestica V243 igkv AAFR03048965.1 8869 VRGVIELIQTPTFLSVSPGEETAIICKASQSLLHTDNKDYLFWYQKKLGQHPQLIIKHATTLLPGVSSRFIGSGTQKDFTLIISSMEAEDVAEYYCLQTYRLP
Monodelphis domestica V244 igkv AAFR03048965.1 18573 WGDPISCLPVCISRRERVTINCRTSQSTSSYLHWYQQKPGQAPKFIIRSISTFQPGVPARFSSNGSGTDFSVRISSVETEDAAVYYCQQSASD
Monodelphis domestica V245 igkv AAFR03048965.1 58552 SRGAIGLTQSPSSLAVSLGETVTLSCRASQSIGTSIHWYQHPPGQALRQLIRYASTVQPGIPARFSGSGSGTDFSLTISAVEPEDIADYYCQQSNSYP
Monodelphis domestica V246 igkv AAFR03048965.1 75203 SRGAIGVTQSPASLAVSPGETVTLSCRVSQSIGNWLNWYQQHPGQRPRPLIYKASNLHSGVPARFSGSGSGTDFSLTISAVEPEDVADYYCLQLSSYP
Monodelphis domestica V247 igkv AAFR03048965.1 89187 SRGAVWLTQSPSSLAVSPGETVTLYCRASQSVSNYMSWYQQRPGQVPRPLIYYASSLHSGVPARFSGSGSGTDFSLTITGVEPEDFADYYCLQWGS
Monodelphis domestica V248 igkv AAFR03048965.1 108966 VRGAIGLTQSPSSVAVSLGETVTLSCRASQSISTSIHWYQHPPGQSPRPLIYLASTVQPGVPARFSGSGSGTDFSLTISAVEPEDIADYYCQQSYSYP
Monodelphis domestica V249 igkv AAFR03048965.1 117645 SRGAVGLTQSPASLAVSLGESVSLSCRASQSVSNHINWYQQPPGQSPRLLIYYASNLHSGVPARFSGSGSGTDFSLTISAVEPEDVADYYCQQVNSWP
Monodelphis domestica V250 igkv AAFR03048965.1 132709 SRGAIGVTQSPASLAVSPGETVTLSCKTSQKVNTWLAWYQQRPGQSPRPLIYYASTLQPGVPARFSGSGSGTDYSLTISSVEPEDIGDYYCQQGRTWP
Monodelphis domestica V251 igkv AAFR03048965.1 155508 SRGAIELTQSPSSLAVSPGERVTLSCRASQSVSNYIDWYQQRPGQSPRLLIYKASNLHSGVPARFSGSGSGTDFSLTISAVEPEDIADYYCLQWDNWP
Monodelphis domestica V252 igkv AAFR03048965.1 167417 SRGAIELTQSPSSLAVSPGERVTLSCRASQSVSNHINWYQQRPGQSPRLLIYGASTLHSGVPARFSGSGSGTDYSLTISAVEPEDIADYYCLQWQSWT
Monodelphis domestica V253 igkv AAFR03048965.1 183164 SRGAVEVTQNPSSLAVSLGERVTLSCRASQSIGNALDWYQHPPGKSPRLLIYWASNLHSGVPARFSGSGSGTDFSLTISGVEPEDVGHYYCLQKNSYP
Monodelphis domestica V254 igkv AAFR03048965.1 208375 SRGAIGLTQSPSSLAVSPGERVTLSCRATQSISNNIHWYQKPPGQSPRLLIYWASNLHSGVPARFSGSGYGTDFSLTISAVEPEDIGHYYCQQSNNWP
Monodelphis domestica V255 igkv AAFR03048965.1 215084 SRGAIGVTQSPSSLAVSLGETVSLSCRASQSIGNYMSWYQHPPGQSPRLLIYGASSLQPGVPARFSGSGSGTDFSLTISAVEPEDVGLYYCLQSYSSP
Monodelphis domestica V256 igkv AAFR03048966.1 10729 SRGDIEVTQSPSSLAVSLGETVTLSCRASQSVSNHINWYQQHPDEAPRTLIYQATKLPSGVTARFSGSGSGTDFFLTISPVEPEDITDYYCLQ
Monodelphis domestica V257 igkv AAFR03048972.1 15127 SRGAVEVTQSPASLAVSLGERVTLSCRASQSIGQYMSWYQHPPGQSPRPLIYRASSLHSGVPTRFKGSGSGTDFSLTISGVEPEDIADYYCQQNYNWP
Monodelphis domestica V258 igkv AAFR03048972.1 22202 SRGAIGVTQSPSSLAVSLGERVTLSCRASQSISNWLHWYQHPPGQSPRLLIYKASTVQPGVPARFSGSGSGTDFSLTISAVEPEDIGDYYCQQGY
Monodelphis domestica V259 igkv AAFR03048972.1 45929 SRGAIGVTQSPSSVAVSPGERVSLSCRASQNVGKYMSWYQQHPGQSPRLLIYLASTLQPGVPARFSGSGSGTDFSLTISAVEPEDIVVYYCQQGSNLS
Monodelphis domestica V260 igkv AAFR03048975.1 2433 SRGAIGLTQSPSSLAVSLGERVTLSCRASQSISKYMNWFQQPPGQPPRLLIHGASTLHSGVPARFSGSGSGTDFSLTISAVEPEDIAVYYCLQVNSSP
Monodelphis domestica V261 igkv AAFR03048975.1 6943 SRGAIGVTQSRSSLAVSLGETVTLSCRASQRVGNYMTWYKHPPGQSPRPLIYYASTLHSGVPARFSGSGSGTHFSLTISAMEPEDIGDYYCQQRNSWP
Monodelphis domestica V262 igkv AAFR03048975.1 17478 SRGAIGVTQSPSSLAVSLGETVTLYCRASQNIGSNLNWFQQPPGQPPRLLIYWASNLHSGVPARFSGSGSGTDYSLTISAVEPEDIADYYCLQRNSYP
Monodelphis domestica V263 igkv AAFR03048999.1 34462 SRTATVMTQTPASLSVALGETVTISCRASEDISSILAWYQQPPGKPPKVLIYDADKLESGVPARFSGSRSGTDFTLTISGVQAEDGAHYYCQQYDEFP
Monodelphis domestica V269 ighv AAFR03049276.1 174427 SWAQVKLLESGGKVTHEGQSVTLTCKASGFNFKDYDMSWHWNPSGNNRQLVASISSKTGSKTEYKPRIQGRAYITRNNEANTVSLTLIQLRKEDSGIYYCAK
Monodelphis domestica V287 iglv AAFR03052916.1 51194 SLFAGSLSQSVVTQPPSASASLGSKVSLSCTLSSGSSHYPVHWHQQSPGKPPRYLLYVDSDGDTGRGDGIPERFSGSGSGTNRFLSISNVEPEDEADYYCGGGY
Monodelphis domestica V288 iglv AAFR03052916.1 79681 SLFAGSLSQPVVTQPPSVSAALGSSARLSCTLSSQHSSYTIGWHQQSPRKAPRYLMWVKSDGSIGRGDGIPERFSGSSSGADRFLSISNVQAEDEADYYCGAGH
Monodelphis domestica V289 iglv AAFR03052917.1 50040 SLFAGSLSQAVVTQPPSASAALGSSARLSCTLSSGNSGNNVGWHQQSPGKPPRYLLYVTSSGGTGRGDGIPERFSGSGSGTNRFLSISNVQPEDEADYFCQS
Monodelphis domestica V290 iglv AAFR03052919.1 4393 SLFAGSLSQDVVTQPPSVSASLGSSARLSCTLSSASSSYDVGWHQQSPGKPPRSLLYVTSSGGTGRADGIPERFSGSGSGTNRFLSISKVEPEDEADYFCQS
Monodelphis domestica V291 iglv AAFR03052923.1 33988 SLFAGSLSQDVVTQPPSASAALGTTVSLSCTLSSGSSGRDVYWHQQSPGKAPRYLLYVTSSGSTGRGDGIPERFSGSGSGTNRFLSISNVEPEDEADYYCQS
Monodelphis domestica V292 iglv AAFR03052925.1 20682 SLFAGSLSQPVVTQPPSASAALGSPVSLSCTLSSELSGRTVAWHQQSPGKPPRYLLYVGSDGGTSRGDGIPERFSGSGSGTHRFLSISNVEPEDEADYFCQS
Monodelphis domestica V293 iglv AAFR03052930.1 47262 SLFAGSLSQDVVTQPPSVSAALGSSARLSCTLSSASSGNTVGWHQQSPGKPPRYLLYVYSDGGTGRADGIPVRFSGSGSGTNRFLSISNVQPEDEADYFCQS
Monodelphis domestica V355 ighv AAFR03066069.1 356 VHCDIPLVESGGDLRQPGGSLKLSCKASGFTFTSYGMNWIRQAPGKGLEWVSYINGAGSSTSYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTAMYYCAR
Monodelphis domestica V356 ighv AAFR03066073.1 19662 VHCDIPLVESGGDLRQPGGSLKLSCKASGFTFSSYYMYWIRQAPGKGLEWVSYINGAGSSTSYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V357 ighv AAFR03066076.1 9808 VHCDIPLVESGGVVRQPGGSLKLSCKASGFTFSSYDMHWVRQAPGKGLEWVSAISNDGSGTYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR
Monodelphis domestica V358 ighv AAFR03066079.1 7784 VHCDIQLVESGGDVRQPGGSLKLSCKASGFDFSSYYMSWVRQAPGKGLEWVSYIDGAGSGTSYADSVKGRFTISRDNGNSLLHLKMNSLKAEDTATYYCSR
Monodelphis domestica V456 trav AAFR03022240.1 70983 HLCRAEFTQPSDKGVEEGADVELQCQHDIPGGNYDSIYWYLQKANKKLTYIYHGFQGTTEIGRYQINVDRKKCSSKLIIRNVHLSDIAVYYCALQG
Monodelphis domestica V457 trdv AAFR03022240.1 59967 VLADIQLEQPDQRLTVYIGRAITLRCTLKGGDLRSYQMNWYKKNWDNSLTFIYQHSDKYGPGFQRNFLGKIDPVNNFFILEILEAAVKDTGTYYCGLV
Monodelphis domestica V458 trdv AAFR03022240.1 36471 VISKIALEQQEKAVSVLIGESTTFKCSITGGRMDDYYMSWYRKTQDNTLIFICQENEVCGSGFQENFQVTIDQDNNKFTLEIIKASMRDRGIYYCTAE
Monodelphis domestica V459 trav AAFR03022243.1 24854 VNCLQEVEQPSRFLEIRERENIIFNCSYTEATSGGLQWFRQDPGKGLTSLFYLTSGMKDRGRLTCVMNSKERISSLHITDAQPEDSSTYFCAVG
Monodelphis domestica V460 trav AAFR03022244.1 27029 VSCQQKVEQNPPFWSVHEGENITINCTYSEQNSQGINWFRQDPGKGPTLLFYIIAGTKESGRLRSMMSLKDRYSSLHITASQSGDSATYFCSVE
Monodelphis domestica V462 trav AAFR03022244.1 15326 VSCQQKVEQNPPFWTVHEGESITINCTFSSQTSQGLQWFRQDPGKGLTLLFYVVSGTKKSGRLSSTTSLKDRHSSLYITASQAGDSATYFCAME
Monodelphis domestica V464 trav AAFR03022245.1 39428 VSCQQKVEQSPPTQTVQEGENTTFSCHYSDSGSRAVQWFKQDPGKGLISLFYIASEGKQKGRLRSTINRKELLSSLYITDSQPEDSGIYLCAVE
Monodelphis domestica V465 trav AAFR03022245.1 33814 VSCQQKVEQSPPTQSVQEGENTTFSCHYSDSASKGLQWFKKHHEKGLISLFYIASEGKQKGRLRSTINRKELLSSLYITDSQPEDSGTYLCAVE
Monodelphis domestica V467 trav AAFR03022245.1 6270 VSCQQKVEQKPSFWTVHEGESITINCTYSDPNTQGLQWLRQDPGKGPTLLFYLASGTKERGRLRSMMSLKDKRSSLHITASQSGDSATYFCAVE
Monodelphis domestica V469 trav AAFR03022246.1 63244 GSCLQKVEQSPQALRVQEGEDTTINCSFTEFSQSLQWFRQDPGKGLISLFYLTSEMKEKGRFRSTIILKERHSSLYIDASQPSDSATYLCAVR
Monodelphis domestica V470 trav AAFR03022246.1 55209 VSGQQEVKQSPQTLKVQEGGNATMNCTYSSTAFTNLQWFRQDPGKGLILLFYIASEGKQKGRLRATMNRKDLLSSLHIIDTQLEDSGTYLCAG
Monodelphis domestica V471 trav AAFR03022246.1 28833 VSCLQVEQSPQVLRVQEGEDTTINCSFTESSQSLQWFRQDPGKGLISLFYLTSEMKEKGRFRSTIILKERHSSLHIDASQPSDSATYLCAVSAQ
Monodelphis domestica V472 trav AAFR03022246.1 25199 VSCQQKVEQSPPTQTVQEGENTTFSCHYSDSTSRGVQWFRQDPGKGLISLFYIASEGKQKGRLRSTINRKELLSSLYITDSQPEDSGTYLCAVE
Monodelphis domestica V473 trav AAFR03022246.1 20968 VSCQQKVEQSPPTQTVQEGENTTFSCRYSDSASSGVQWFRQDPGKGLISLFYIASEGKQKGRLRSTINRKELLSSLYITDSQPEDSGTYLCAVE
Monodelphis domestica V474 trav AAFR03022246.1 4168 VSCQQKVEQSPPTQIVQEGENTTFSCHYSDSTSTRLQWFRQDTGKGLILLFNIVSEGKQKGRLRSTINKKELLSSLYITDSQPEDSSTYLCAVE
Monodelphis domestica V475 trav AAFR03022247.1 181690 ASSQDKIEQSPLSLSIQEGENISMICNYKVGNFRSLQWYRQHPGKDPRNLFTMFSKGEEKQQERFRAKLENDRSFLYIITSQLGDSGTYLCAVE
Monodelphis domestica V476 trav AAFR03022247.1 156249 ESSQAQVKQVPLLMNIQEGENVSISCNYSSSLSMYLFWYRQDRGKSLELISALRANGALKIAGRFTTTLNTQTRHSSLLITATQTQDSATYFCTA
Monodelphis domestica V477 trav AAFR03022247.1 148030 DTYGDSVTQTEGRIILTEGASLTLNCSYQTSGSPFLSWYIQHPNEGLKLLVNEAKRKDQEKDNNGFWTKKIKEKSFFSLEKTSVQVKDSAVYYCVLS
Monodelphis domestica V478 trav AAFR03022247.1 145080 GSYGDSVTQAEGHITLPEGAPFTLNCSYQASRVPYLFWYIQYPNEALKLLLRETSGKDQENNNNGFWAKKIKEKSSFHLEKNSVQMGDSAVYYCALS
Monodelphis domestica V479 trav AAFR03022247.1 131951 GTYGDSVTQTEQHITLPEGASLTLNCSYQTSVTPYLFWYVQYPNDALKLLLRETARKDQEKDNNGFWTKKIKEKSSFHLEKTSVQMGDSAVYYCVLS
Monodelphis domestica V480 trdv AAFR03022247.1 119780 WSMADSVTQSPRAITVQDGESVSLNCAYDTNEAYYALYWYKQSPNGELIYIIHQYSESNSGRSGRYSVTFRKSDRTITLNVLSSHLKDSGIYFCGLRRM
Monodelphis domestica V481 trav AAFR03022247.1 110774 GSYGDSVMQTEGHVTLPEGAPFTLNCSYQTSGVPYLFWYIQYPNEALKLLLRETSGKDQEKDNNGFWAKKIKEKSSFHLEKNSVQMGDSAVYYCVLS
Monodelphis domestica V482 trav AAFR03022247.1 102505 VSGQQLNQSPQSMNIQEGKSFTMNCTSSSSLYGLQWYKQKPGERPSFILLLLSGGEKKSQEKFTAWFDEKKQLSSLSISAAQAEDSGTYLCAA
Monodelphis domestica V483 trav AAFR03022247.1 91763 LGSAQTVTQSPPVVSVQEGQTATLNCKYSTSDSTYFLFWYKQSPGGELIFLIRQDSYGAQNVSEGRYSVNFQKAAASIRLMISASQLGDAAVYFCVLRE
Monodelphis domestica V484 trav AAFR03022247.1 85283 VWGQMKVDQSPSVLNLQEGESAMLECNWSSSTTNLQWLTQNPGEGPVSLFFIASGVKQKGRFIAKMNLKDRRSSLHINNLQRGDSTTYLCAVE
Monodelphis domestica V485 trav AAFR03022247.1 72787 VSVKGNLDQSPPTLTVQEGKSCLLHCNYSRGSFDRIFWYRQEVGKSLKLMFALFSNGAVKKEERLTATFSTDTSHSTLSIKGSQPEDSGTYLCAA
Monodelphis domestica V486 trav AAFR03022247.1 52261 TRCDSQVTQPISQEVAEGQGANVPCSHSDISTNMNIFWYRQFPNQGPQFLIQTYKTNTTNEVASLTISPDRKSSILSLPPVTLRDAAVYYCILQS
Monodelphis domestica V487 trav AAFR03022247.1 22319 VRGQVKVDQSPGVLNLQEGKSSVLKCSYSSTMTTLQWFKQKPGEGLIFLFFLTGETQQKGNLRATLNTKERQSSLYITASQPGDSATYLCAIQ
Monodelphis domestica V488 trav AAFR03022247.1 19928 VSGQKKVEQSPQSLSLHEGENVTMKCNYSFTENSLQWFKQDPQKGIVSLFVLTREMKKKGRLGASITSKERYSFLHITNFKPEDSGIYLCAVE
Monodelphis domestica V489 trav AAFR03022248.1 87262 VNSEDEVTQSPQTLSIQEGAASTIYCNYSSSSSDYLHWYRQDMRKNLVNLFSLVSNGAVKHNGRLRATLNTKDRHSSLNIRASQPGDSAIYFCA
Monodelphis domestica V490 trav AAFR03022248.1 58828 ESGAQSVTQPEDQITVSEGDPLEVKCTYSYGATPYLFWYIQYPNQGLQLLLKYVSGNPLVKGINGFEAKFNKTQNSFHLRKFSAQRSDSAEYFCAVN
Monodelphis domestica V491 trav AAFR03022248.1 55820 ESGAQSVTQPEDQITVSEGDPLEVKCTYSYGATPYLFWYIQYPNQGLQLLLKYVPGNSLVKGINGFEAEFNKIQNSFHLRKLSAQRSDSAEYFCAVS
Monodelphis domestica V492 trav AAFR03022248.1 47341 ESGAQSVTQPEDQITVSEGDPLEVKCTYSYGGSLYLFWYIQYPNQGLQLLLKYVSGNPLVKGINGFEAELNKTQSSFHLKKLSAQRSDSAEYFCALD
Monodelphis domestica V493 trav AAFR03022248.1 43793 ESGAQSVTQPEDQITVSEGDPLEVKCTYSYGATPYLFWYIQYPNQGLQLLLKYMSGNPLVKGINGFEAEFNKTQSSFHLKKLSAQGSDSAEYFCALD
Monodelphis domestica V494 trav AAFR03022248.1 18243 VTGQSKVQQSPQFLRVQMGGTAIINCSYTDSSFDYFLWYRQDPGKGPTLLIAIRLNKDLVGEGRFTVHLNKDAKYFFLNFKVLQPEDAGTYLCAAS
Monodelphis domestica V495 trav AAFR03022248.1 13676 EIGADLVTQKEGHLTLPEGAPLNLDCIYKSSGLYSTFLAWYVQYPNEGLNLLLRGTDKTEERPIQGFQAHHNKNESSFHLKKAAVQMRDSAVYYCVLS
Monodelphis domestica V497 trdv AAFR03022249.1 42697 ISTAQKVTQPQPAMFGKEGDALTLTCTYETSDSNYGLFWYKQPSSGELILLIRQDGYSQKNARAGRYSVNFQKSNKSISLTISASQLGDSAIYFCAYIS
Monodelphis domestica V498 trav AAFR03022249.1 30772 VIGQQLEQSPQSTSVQQGQKVTMSCNSSSTLTSLQWYRQEPGKQPVFLMILIKGKEVKSQGKFIAQFDEKRKNSFLILEAAQPQDSATYLCAG
Monodelphis domestica V499 trav AAFR03022249.1 21431 ASGDVRVEQNSPLLITQEGKNCTIFCNYSSGGLNYIHWYKQIPGQGPVNIFILLSNGAVTQDGRLTATLNIKDRHSILHIQDSQPEDSATYFCAI
Monodelphis domestica V500 trav AAFR03022251.1 61945 TTKAQSVTQPEDQISVFEGSPVELKCTYSYSGAVYLFWYVRYPNQGLQVLLRHTSGESNKGFQATHNKAETSYHLTKLHVQEEDSAVYFCVLS
Monodelphis domestica V501 trav AAFR03022251.1 29380 GVKSQEEVTQSPQFLIVQEGDHVSMNCSYTNNAYTYFLWYKQDSGKGPDFQMDIRSNMDKKGNRRMTILLDKGAKLLSLNIMDAQPGDSSTYLCVAS
Monodelphis domestica V502 trav AAFR03022251.1 826 STEAQSVTQPEDLVSVSEGYPVELKCTYSYSGSPILFWYVQYPNQGLQVLLKHTSGGSNKGFQATLSKTETSYHLRKSHVQEEDSAVYFCALS
Monodelphis domestica V503 trav AAFR03022252.1 19236 VTSQKKVEQSPLSFEVQEGGNVTVNCTYTDTAFVYLFWYYQYPGKGPQLLMRMLSNMVTDHQGRFTIHLNKGAQLFSLHISASQSEDSGTYFCAA
Monodelphis domestica V504 trav AAFR03022252.1 15577 VTSQQKVEQSPLFLAVQEGANIIVNCTYTDTTFDYFYWYHQYSGKGPQLLIKMFSNVVTNHQGRFTIHLDKGAQLFSLLISASQSEDSSTYFCAAS
Monodelphis domestica V505 trav AAFR03022254.1 141731 GTRTQSLTQPEVLITVSEGAPLDLNCTYSYSGFIYLYWYVQYPNQEPQFLLKSATGSKLVKGFRGFEAEFNKNKTSFHLKKLSVQESDSAEYFCALN
Monodelphis domestica V506 trav AAFR03022254.1 82803 VSSQMVEQSIQSMTVQEDERCSLSCSYTGGIFTLQWFRQDPGKSLVFLILIRPNERQKVSKRFIATIDSTTRNSSLHLLPCKLEDSAIYFCAVD
Monodelphis domestica V507 trav AAFR03022254.1 58011 VSGQDKVEQSLSPLNIKEGENVTLNCNYSVGYFNGLQWYRQYPGESLTFLFLMFSNEDKKSEGRTKATLDRTKGHSSLYIIASQPKDSATYFCAVK
Monodelphis domestica V508 trav AAFR03022254.1 43836 GTDGDKVIQAEDNISLSEGALLTLNCTYKTNYARFPFWYVQYPNEAPKLLLKSVGENQGRVSKGFQVSHIKSENFFQLKKASIEVGDSAVYYCALG
Monodelphis domestica V509 trav AAFR03022254.1 38810 ISTAQKVSQEQSTMTGQEGETVTLNCKYETSATSYTLFWYKQLLLGEMIFLIRQDSYGQVNTRKDRYLVNLQKTEKFINLTILASQLGDSAMYFCALRE
Monodelphis domestica V510 trav AAFR03022254.1 29017 VICQQKVEQRLPFLRVQERENASLECTYTDGAARYFAWYQQYPGEGLVLRIATFSNGDIKGGRFIARVNKGAKEFSLYISVSQPSDSGTYFCAVV
Monodelphis domestica V511 trav AAFR03022254.1 5416 ASGQERVEQSSPSLDIQEGESITLTCNYSVGTFNGLVWYRQNPEEGPAFLFSLFSDREEKRKGRVKATLEKTNSHSSLRIIASQPRDSATYLCAVQ
Monodelphis domestica V512 trav AAFR03022257.1 7256 VFGKNIEQPALLMVTEGASIKINCTYQTDGFNGLYWYRQCEGGALMYASYRVLNGLKNHGWLDSFLSQADTYSYLLLKHSQMTDSASYLCAVI
Monodelphis domestica V634 igkv AAFR03048969.1 3299 SRGDIEVTQSPYSLAVSLGETVTLSCRASQSVSNQINWYQQHPDEAPRTLIYQATKLPSGVPARFSGSGFGTDFFLTISPVEPEDIAVYYCLQVNSLP
Monodelphis domestica V635 igkv AAFR03048975.1 22476 SRGAIEVTQSPSSLSVSPGERVTLSCRASQSINNHIFWFQKYPGQAPGVLIRYASTLHSGVPARFSGSGSGTDFSLTISAVEPEDVADYYCLQVNSWP
Monodelphis domestica V636 igkv AAFR03048976.1 8010 SRGATGVTQSPSSLAMSLGERVTLSCRASQSISNYINWYQQPPGQSPRLLIHGASTLHSGVPDGFTGSGSGTDFSLTISAVEPEDIADYYCLQVNYWP
Monodelphis domestica V638 igkv AAFR03048987.1 109423 AWGIVDLTQSPLTLSVNLGQTVTITCRTNIIIDQWLGWLQKIPGQPFRMLIYDATKRNHWTPDRFVGSWSGKDFNLTINGVEAEDTGYYYCYHHDTRKLP
Monodelphis domestica V639 igkv AAFR03048987.1 104301 THGQVSVTQSPAFLSVLPGESITITCKTSRSVIESQGTSSIHWYQQKPGQIPRLLIYHASMVASGVPARFSGTGSGTDFTFVISSVKAEDVADYYCQQGYNV
Monodelphis domestica V640 igkv AAFR03048988.1 324988 SRTATVMTQTPASVSVALGETVSLSCRASEDISGYLAWYQKPPGKPPKPLIYAADQRESGVPARFRGSGSGTDYTLTISGVVTDDGANYYCQQ
Monodelphis domestica V641 igkv AAFR03048988.1 315827 SRTATVMTQTPASVSVALGETLTISCRASEDISSALNWYQKPPGKPPKLLIYAADELESGVPARFSGSGSGTDYTLTISSVEAEDAADYFCQQGYLP
Monodelphis domestica V642 igkv AAFR03048988.1 306201 SRTAIVMTQTPASMSVALGETLTISCRASEDISSALNWYQQPPGKPPKLLIYGAKNLESGVPARFSGSGSGTDYTLTISSVEAEDAADYYCQQGYLP
Monodelphis domestica V643 igkv AAFR03048988.1 238957 SQGKIVLTQSPSSLSARPGERVTINCKASESITDRDGDDPLSWYQHKPGQAPRLLISWATNLASGVPARFSGSRSGTDFTLSISSMKPEDAAVYYCQQGYKEP
Monodelphis domestica V644 igkv AAFR03048988.1 226490 SRGGVVLTQSPASVSVSPGERVTISCQASQSVKHSDGKTYLYWFQQKPGQSPRLLIYLVSTLNSGIPARFGGSGADRDFTLTISSVSAEDGADYYCFQGSFTP
Monodelphis domestica V645 igkv AAFR03048988.1 211992 SQGKIVLTQSPSSLSASPGERVTINCKASESITDSFGDDLLYWFQHKPGQAPRRLIYWATNLASGVPARFSGSRSGTDFTLSISSMKPEDAAIYYCQQGYDIP
Monodelphis domestica V646 igkv AAFR03048988.1 196940 SQGKIVLTQSPSSLSASPGERVTINCKASESITYSDGDDLLYWYQHKPGQAPRCLIYWATNLASGVPARFSGSRSGTDFTLSISSMEPEDAAVYYCQQDYKEP
Monodelphis domestica V647 igkv AAFR03048988.1 190000 SRGEVVLTQSPASVSVSPGERVTISCQASESVKDSDGNTYLNWFQQKPGQSPRLLIYQISKLDSGIPARFGGSGADRNFTFTISSVSAEDGADYYCFQ
Monodelphis domestica V648 igkv AAFR03048988.1 183612 SQGKIVMTQSPSSLSASPGERVTINCKASESITYSDGDDLLYWYQHKPGQAPRTLIYWATNLESGVPARFSGSRSGTDFTLSISSMEPEDAAIYYCLQTYNVP
Monodelphis domestica V649 igkv AAFR03048988.1 179846 SRGEIVLTQSLASVSVSPGKRVTISCQASQSVKYSDGKTYLCWFQQKPGQSPRLLIYLVSKLESGIPARFGGSGADRDFTFTISSVNAEDGADYYCGQESFSP
Monodelphis domestica V650 igkv AAFR03048988.1 164384 SQGKIVMTQSPSSLSASPGERVTINCKASESITDRDGDDPLSWYQHKSGQAPRHLIYWATNLASGVPARFSGSRSGTDFTLSISSMKPEDAAIYYCQQGYDIP
Monodelphis domestica V652 igkv AAFR03049008.1 559461 SQGEVVLTQSPASVSVSLGERVTIKCKASQSLLHSDGKTYLHWFQQKLGKSIKRTIYQVSNLDSGVPPRFSGSGSGTDFTLTISSLEPEDAAMYYCG
Monodelphis domestica V653 igkv AAFR03049008.1 541355 SQGEVVLTQSPASVSVSLGERVTIKCKASQSLLHSDGNIYLHWLQQKVGKSIKSMIYRVSNLYSGVPPRFSGSGSGTDFTLTISSVEPEDVAMYYCSQ
Monodelphis domestica V654 igkv AAFR03049008.1 530609 SQGEVVLTQSPASVSVSLGERVTIKCKASQSLLHSNGKTYLQWFQQKRGKSIESLIYLVSNLYSGVPSRFSGSGSGTDFTLTISSLEPEDVAIYYCFQ
Monodelphis domestica V655 igkv AAFR03049008.1 523850 SQEEIILTQSPTSLPVSLGERVTIKCKASQSLLHSNGYTYLYWFQQKQREPIKTLIYTVSNLHSGVPSRFSGSGSGMDFTLTISSLESEDVADYFCGQATSLP
Monodelphis domestica V656 igkv AAFR03049008.1 519126 SQGEVVLTQSPASVSVSMGERVTIKCKASQSLLHSNGNTYLHWFQQKQGKSIKALIYRVSNLYSGVPPRFSGSGSGTDFTLTISSLEPEDAAIYYCFQ
Monodelphis domestica V657 igkv AAFR03049008.1 505088 SQGEVVLTQSPSPVSVSLGERVTIKCKASQSLLHSNGNTYLEWIQQKQGKSIKSLIYKVSNLHSGVPSRFSGSGSGTDFTLTISSLEPEDVAIYYCFQG
Monodelphis domestica V658 igkv AAFR03049008.1 490411 SQGEVVLTQSPASVSVSLGERVTIKCKASQSLLHSNGNTYLQWFQQKVGKPINALIYGVSNLYSGIPPRFSGSGSGTDFTLTISSLEPEDAAIYYCF
Monodelphis domestica V659 igkv AAFR03049008.1 460568 SQGEVVLTQSPASVSVSLGERVTIKCKASQSLLYSDGKTYLYWFQQKQGKSIKSLIYLVSNLYSGVPPRFSGSGSGTDFTLTISNLEPEDAAIYYCFQ
Monodelphis domestica V660 igkv AAFR03049008.1 454285 SQEEVILTQSPASVSVSLGERVTIKCKASQSLLHSDGNTYLYWYQHKKGELIKALIYRVSNLHSGVPSRFSGSGSGTDFTLTISRVEPEDIAEYICGSWIS
Monodelphis domestica V661 igkv AAFR03049008.1 432685 KIVLTQSPTSLPVSLGGRVTIKCKAGQSLLNRDGNTYLNWFQQKQGKPIKALIYRVSNLHSGIPSRFSGSGSGTDFTFTISNLEFEDAVEYFCGQGTSFP
Monodelphis domestica V662 igkv AAFR03049008.1 427211 SQGEVVLTQSPASVSVSLGERVTIKCKASQSLLHSNGNNYLYWFQQKQGKSIKALIYRVSNLHSGVPPRFSGSGSGTDFTLTISSVEPEDAAMYYCF
Monodelphis domestica V663 igkv AAFR03049008.1 410707 SEGEIVLTQSPTSLPVSLGERVTIKCKASQSLLHSDGNTYLQWFQQKPGKSIKALIYRVSNLYSGVPPRFSGSGSGTDFTLTISSLEPEDAAMYYCHQN
Monodelphis domestica V664 igkv AAFR03049008.1 392180 SQGEVVLTQSPASVSVSLGERVTIKCKASQSLLNSDGNTYLEWIQQKQGNSIKSLIYRVSNLDSGVPPRFSGSGSGTDFTLTISSLEPEDAAIYYCFQSSNWPP
Monodelphis domestica V665 igkv AAFR03049008.1 364330 SQGEVVLTQSPASVSVSLGESVTIKCKASQSLLHSNGNTYLEWFQQKRGKFIKSLIYRVSNLHSGVPPRFSGSGSGTDFTLTISSLEAEDVAIYYCF
Monodelphis domestica V666 igkv AAFR03049008.1 322246 SQGEVVLTQSPASVSVSLGERVTIKCKASQSLLHSSGNTYLHWFQQKPGKSIKRMIYQVSNLDSGVPSRFSGSGSGTDFTLTISSLEPEDVAIYYCY
Monodelphis domestica V667 igkv AAFR03049008.1 284512 SQGEVVLTQSSPSVSVSLGDRVTIKCKASQSLLYSDGNTYLQWIQQKQGKSIKSLIYKASNLDSGVPPQFSGSGSGTDFTLTISSVESEDVAIYYCLQR
Monodelphis domestica V668 igkv AAFR03049008.1 275446 SQGEVVLTQSPASVSVSLGDRVTIKCKASQSLLHSDGNTYLHWFQQKVGKPIKSLIYRVSNLHSGVPPRFSGSGSGTDFTLTISSLEPEDAAIYYCFQ
Monodelphis domestica V669 igkv AAFR03049008.1 263229 AIVLSQSPASLSRSAGETVTISCRATERLTESIEGTDIELLHWYQQKPGQAPRLLIYGATNLASGVPSRFSGSGSGTDFTLTISNMKPEDAANYYCQQSMSFPL
Monodelphis domestica V670 igkv AAFR03049008.1 256998 AIMLTQSPASLSRSAGETVTISCRATESLTESILGITLQNLHWYQQKPGQAPRLLIYDATNLASGVPGRFRGSGSGTDFTLTISSLEPEDAGEYYCQQSNSFPL
Monodelphis domestica V671 igkv AAFR03049008.1 250734 AIVLTQSPASLSRSAGETVTISCRATESLTESILVTTLQYLHWYQQKPGQAPRLLIYEATNLASGVPSRFSGSGSGTDFTLTISSLEPEDAGEYYCQQSKSSPL
Monodelphis domestica V672 igkv AAFR03049008.1 243268 AIVLTQSPASLSGSPGERVTISCRASESLTTYGYTFLNWYQQKPGQAPRLLVYGATSLASGVPARFRGSGSGTDFTLTISSLEPEDAGEYYCQQSMSVPL
Monodelphis domestica V673 igkv AAFR03049008.1 231969 SSTAIVMAQTPASLPVTLRETVTISCRASQGITNDIAWYQKSSGKPPKLLIYEASSRSSEVPARFSGSGYGTDFTLTISPVEAEDVAEYYCQQYNQFPL
Monodelphis domestica V674 igkv AAFR03049008.1 201438 FSTATVMTQTPASLSVTLGETVTISCRASNDIDDDLAWYQLSPGKTPKLLIYNANSLSSGVPARFSGSGYGTDFTLKISPVEAEDVASYYCHQYDVYPL
Monodelphis domestica V675 igkv AAFR03049008.1 195366 SSTAIVMTQTPAALPVTLGETVTISCRASQGITNDIAWYQKSPGKPPKLLIYNANSLPSGIPARFSGSGYGTDFTLKVSPVEAEDVADYFCQHYYNLPL
Monodelphis domestica V676 igkv AAFR03049008.1 189332 SSTAIVMTQTPASLPVTLGETVTISCRASQGITNDIDWHQKSPGKPPKLLIYEASSRSSGVPARFSGSGYGTDFTLTISGVEAEDVADYYCLQYNQYPL
Monodelphis domestica V677 igkv AAFR03049008.1 185821 SRGEVLTQSAASVSVSPGERVTISCQASQSVKHSNGKTYFDWIQHKPGQSPRPLIYQVSKLESGIPARFSGSGSDRDFTLTISDVSAEDGADYYCGQRSFTP
Monodelphis domestica V678 igkv AAFR03049008.1 182365 SSTATVMTQTPASLSVTLGETVTISCRASQSISNYLAWYQLSPGKPPKSLIYAATYLPSGIPARFSGSGYGTDFTLKISPVEAEDVADYYCLQYNQYPL
Monodelphis domestica V679 igkv AAFR03049008.1 168294 SRTAIVMTQTPASLSVALGETLTISCRASEDISDYLAWYQQPPGNSPKLLIYGAKYRESGVPARFSGSGSGTDYTLTIRSVEAEDGASYFCQQYHNS
Monodelphis domestica V680 igkv AAFR03049008.1 147272 SRGEVVLTQSAASVSVSPGERVTISCQASQSVKHSDGRTYLDWIQQKPGQSPRLLIYQVSNLDSGIPARFSGSGADRDFTLTINSVSAEDGADYYCAQRSFYP
Monodelphis domestica V681 igkv AAFR03049008.1 128361 SRTAIVMTQTPASVSVALGETVTISCRASQDISDYLAWYQQPPGKPPKLLIYDAKNLESGVPARFSGSGSGTDFTLTISSVEAEDAASYFCQQGYLP
Monodelphis domestica V683 igkv AAFR03049008.1 15983 SRTATVMTQTPASLSVALGETLTISCRASEDISDYLTWYQQPPGKPPKSLIYDADLLESGVPARFRGRGSGTDFNPTIHSVEAEDGAHYFCQQGYDS
Monodelphis domestica V684 igkv AAFR03049009.1 31838 SQGEVVLTQSPASVSVSLGERVSIKCKASQSLLYSDGYTYLYWFQQKKDHIKALIYRVSNLYPGVPSRFSGRGSGTDFTLTISSLEPEDAAIYYCFQ
Monodelphis domestica V685 igkv AAFR03049009.1 14247 SQGEVVLTQSPASVSVSLGESVTIKCKASQSLLYSDGKTYLRWFQQKQGKSIKQLIYQVSNLDSGVPPRFSGSGSGTDFTLTISSLEPEDVAIYYCF
Monodelphis domestica V686 igkv AAFR03049009.1 7459 SQGEIILTQSPNSLPVSLGERVTIKCKASQSLLHSNGYTYLYWFQQKQREPLKALIYGVSNLHSGIPSRFSGSGSGTDFTFTISNLESEDVAEYFCGQAISFP
Monodelphis domestica V687 igkv AAFR03049009.1 2488 SQGEVVLTQSPASVSVSLGERVTIKCKASQSLLHSNGNTYLHWFQQKQGKSIKSLIYKVSNLHSGVPPRFSGSGSGTDFTLTISSLEPEDAAMYYCSQ
Monodelphis domestica V688 igkv AAFR03049011.1 25785 SQGEIVLTQSPTSLPVSLGERVTIKCKASQSLLHSNGNTYLNWFQQKQGEPIKALIYRVSNLNSGVPSRFSGSGSGTDFTLTINNLESEDVADYFCGQGTSWP
Monodelphis domestica V689 igkv AAFR03049011.1 20494 EIVLTHSPASVSVSLGERVTIKCKASQSLLHSDGNNYLYWFQQKQDRIKALIYRVSNLHSGIPPRFSGSGSGTDFTLTISSLEAEDAAIYYCGQ
Monodelphis domestica V690 igkv AAFR03049011.1 8372 SEGEIVLTQSPTSLPVSLGERVTIKCKASQSLLHSNGYTYLYWFQQKQREPIKALIYRVSNLHSGVPSRFSGSGSGTDFTLTISNLEPEDIADYFCAQAISLP
Monodelphis domestica V691 igkv AAFR03049011.1 3191 SQGEVVLTQSPASVSVSLGERVTIKCKASQSLLHSNGNTYLHWFQQKRGKSIKLLIYKVSNLHSGVPSRFSGSGSGTDFTLTISSLEPEDAAIYYCFQ
Monodelphis domestica V692 igkv AAFR03049018.1 43173 AKGDISMTQTPGSLSLSPGERVTITCRASANVNKEVSWYQVKFGQPVRLIIYNAEKLASGVPARFLGRGSGTDYSLVISSVEPEDIGDYYCAHDYGWP
Monodelphis domestica V706 trgv AAFR03052748.1 86624 HLSCAHMKQEVSVTSIQGSSAPISCQVSNAASSWIHWYRFQDGKPPQRLLYLSWESGELRFDEGFGSNKFHAFKDQFNGEKFILLIKKLEVRDSGMYYCAIWD
Monodelphis domestica V707 trgv AAFR03052748.1 59324 GHAALKQPQSSITAYVGTTARVICEVSSSNFANEYIHWYQQKPNQPLEHLLYVVSTRVPTQKSLDDQKNKFVGEKNNAQSTSVLAINSITHKDEATYYCAIWE
Monodelphis domestica V708 trgv AAFR03052748.1 55561 ASAEPMLAQLMPSNTKRRGNTAFLECQVTVNPFEYVYIHWYRQKPGERLERILYLSSNDNVIHEDGVSEERYEAKKRESDSSASLRIHQVTEADGGLYYCACWD
Monodelphis domestica V709 trgv AAFR03052748.1 50618 GHAALKQPQSSITAYVGTTARVICEVSSSNFADTYIHWYQQKPNQPLEHLLYVVLTRVPTKKSLDDQKNKFVGEKNDAQSTSVLAINSITHKDEATYYCAIWE
Monodelphis domestica V710 trgv AAFR03052749.1 21689 HLSCAYMKQQVSVTGIQGDSARITCQVSNAVSYWIHWYRFQDGKPPQRLLILEPKSGNVRFDEGFGSNKFHSSLDRFKGEKIILFIINLYLRDSGTYYCAIWD
Monodelphis domestica V711 trgv AAFR03052749.1 14271 HLSCAHMKQEVSVTGIQGSSAPISCQVSNAASSWIHWYRFQDGKPPQRLLYLSLKSGNLHFDEGFGSNKFHAFKDQFNGEKFILLIKNLEVRDSGMYYCAIWD
Monodelphis domestica V712 trgv AAFR03052749.1 7802 GRTAVALEQRPISLTRNAKQSASLNCKILNPVSDYVHWYRSQEGRAPERLLVYSRSKSESVPDPGFSADKVRAYKGKDDTCRLIVSDLQVSDSGVYHCASWDG
Monodelphis domestica V713 iglv AAFR03052906.1 15821 SLFAGSLSQAVVTQPPSVSASLGSKVSLSCTLSSASSRYAVGWHQQSPGKPPRSLLYVGSRGSVIRADGIPERFSGSGSGTNRFLSISNVEPEDEADYYCQS
Monodelphis domestica V714 iglv AAFR03052932.1 134396 SLFAGSLSQAVVTQPPSASAALGSSARLSCTLSSENSGNYVYWHQQSPGKPPRYLMWVKSDGSIGRGDGIPERFSGSGSGSNRFLSISNVEPEDEADYFCQS
Monodelphis domestica V715 iglv AAFR03052948.1 103731 SMAAYVVTQPPSVSMSLGERVSLSCDGDGIGSSYVSWYQQKPGQAIKLLIYEDSYRPEGIPERFSGSNSGNTATLSISGLQAEDEADYYCFASGSSG
Monodelphis domestica V716 iglv AAFR03052948.1 96454 SMAAYVVTQPPSVSMSLGERVSLSCDGDGIGNHLVSWYQLKPGQAILPLIYEDSYRPEGIPERFSGSNSGNTATLSISGLQAEDEADYYCFASGSNG
Monodelphis domestica V717 iglv AAFR03052948.1 80036 SMAAYVVTQPPSVSMSLGEQVSLSCDGDGIGSYAVSWYQQKPGQAILPLIYGDSYRPEGIPERFSGSNSGNTATLSISGLQAEDEADYFCMAYHGSSG
Monodelphis domestica V718 iglv AAFR03052948.1 68858 SMAAYVVTQPPSVSMSLGEQVSLSCDGDGIGNKFVSWYQQKPGQAIKPLIYEDSYRPEGIPERFSGSNSGNTATLSISGLQAEDEADYYCFTVI
Monodelphis domestica V719 iglv AAFR03052948.1 59271 SMAAYVVTQPPSVSMSLGERVSLSCDGDGIGSYAVSWYQQKPGQAILLLIYGDSNRPEGIPERFSGSNSGNTATLSISGLQAEDEADYYCLASGSSG
Monodelphis domestica V720 iglv AAFR03052948.1 44465 SMAAYVVTQPPSVSMSLGEQVSLSCDGDGIGNNYVSWYQQKPGQAILPLIYGDSNRPEGIPERFSGSNSGNTATLSISGLQAEDEADYYCLASGSSG
Monodelphis domestica V721 iglv AAFR03052948.1 39193 SMAAYVVTQPPSVSMSLGEQVSLSCDGDGIGNHLVSWYQQKPGQAILPLIYDDSYRPEGIPERFSGSNSGNTATLSISGLQAEDEADYFCMAYHGSDG
Monodelphis domestica V722 iglv AAFR03052949.1 5614 ASSQAVVLSQESSLSMSPGGSVTMTCGSSTGPVTTSHYSVWVQQKSGHVPLGLIGGTTTRYPGIPARFSGSILGNKAALTITGAQPEDEAEYYCALWFSSV
Monodelphis domestica V723 iglv AAFR03052974.1 123272 SLASYVLTQIPSMSVALGQTVTITCAGDQLDDRYAHWYQQKRSQTPPELVIYKDKERPEVISDRFSGSSSNKVATLTISGVQAEDESDYYCLSFDDNTK
Monodelphis domestica V724 iglv AAFR03052974.1 100919 SLASYVLTQIPSMSVALGQTVTITCAGDQLDDKYAHWYQQKRSQTPPKLVIYEDKERPEGISDRFSGSSSNKVATLTISGVQAEDESDYYCLSVDGNTK
Monodelphis domestica V769 iglv AAFR03066662.1 17403 SLFAGSLSQAVVTQPPSASAALGSSVSLSCTLSSGNSGRTVYWHQQSPGKPPRYLLYVDSDGDTGRGDGIPECFSGSGSGTNRFLSISNVEPEDEADYYCQS
Monodelphis domestica V772 ighv AAFR03068997.1 3649 VHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYYMSWVRQAPGKGLEWVSRIDTAGSSTSYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAR