WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Leuciscus waleckii FLSR00000000.1 (FLSR01) 78 7 0 11 46 10 2 2
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Leuciscus waleckii V15 trav FLSR01004872.1 8084888 GRFESLITSDQTEVFHEEGDIIVLSCSYSTAISLHWYRQYPKSAPEYILVILQTSGRDQRAENLDSRFSVRLNEKKNRVDLEISSAKVSDSALYYCALS
Leuciscus waleckii V14 trav FLSR01004872.1 8084888 GRFESLITSDQTEVFHEEGDIIVLSCSYSTAISLHWYRQYPKSAPEYILVILQTSGRDQRAENLDSRFSVRLNEKKNRVDLEISSAKVSDSALYYCALS
Leuciscus waleckii V13 trav FLSR01004872.1 8084888 GRFESLITSDQTEVFHEEGDIIVLSCSYSTAISLHWYRQYPKSAPEYILVILQTSGRDQRAENLDSRFSVRLNEKKNRVDLEISSAKVSDSALYYCALS
Leuciscus waleckii V12 trav FLSR01004872.1 8069178 DIFGNVIMPVQTEVYRTENEMISLSCNYSSAVSLYWYRQYPRSAPEFLFVILHATGKVLHKSKVVDLDTRFSGKLNKEKPHTYLEISSVKVTDSATYYCAME
Leuciscus waleckii V11 trav FLSR01004872.1 7851966 ECFAQTITPLQGRTQVTEGETVILSCKYDVSVQNLFWYRQYPGSGLEFLLLVVESSKKTVVYADPPIPRLDGNMNVGDKKVDLEISSAEVSDSALYYCALRPTVTE
Leuciscus waleckii V10 trav FLSR01004872.1 7829850 CDSLDSVEQKRRVQTALEGESVTITCTYSTTDSFPYLFWYQQEINGFPKYMLKKFPGSGEIDEQFKERFDANLNTSTTSVPLTIQDVCVSDSAVYYCALKPTVTQ
Leuciscus waleckii V9 igkv FLSR01004871.1 21090470 KYTVTQSPSILAVQPGKEVRINCKTSSEVYYGNRLAWYSQKPGEAPKLLIYYASTRNTGTPSRFSGSGSGSDFTLTISGVQTEDTGDYYCQSANSGA
Leuciscus waleckii V8 trav FLSR01004870.1 25324365 VSGVTVVTQSPLITVNKGETAKLDCNLGTVTDSSARWYKQTPGGVPQHVLRFYHGWSSVQYGSGFSAPKFTSTHSSKSDYSLIINNVDVGDSAVYYCETWDSSAKV
Leuciscus waleckii V7 trav FLSR01001211.1 37905 AVFGNVIEPNKTDVVYEEGSNVTVFCSLSPGGSDYLHWYRQYGRSKPEFLVLTFGSATEARVSDVDPRFTVEVEKKEQNHVYLKISSATVSDSAVYYCALQPT
Leuciscus waleckii V6 trav FLSR01001211.1 26527 DTVDQPDKHVTEAEGRSVTLQCKYKTDSVQEDLFWYIQRANDFPKYILRRSKYGGENGTEFQERFHSELSSNSVPLMIKDVCVSDSAVYYCALK
Leuciscus waleckii V5 igkv FLSR01001165.1 9441 SRGVTLTQPEVKTVQQSQTATIECNIDVGIYGSYLHWYQQKPGEAPKLLIKYINTRNTGTPSRFSGSGSGSDFTLTISGVQTEDTGDYYCQS
Leuciscus waleckii V4 trbv FLSR01000804.1 17059 CVVCSPVIQQSPKHLLQTVEEKEANLSCHHGDSSYQYLFWYQQKSNSGSLELIGMLNYGSASTEDKFKFKSRFTISGQATKEAFLLISSISAEDSAVYFCAAS
Leuciscus waleckii V3 trav FLSR01000646.1 104196 IESQDNVEQNIRVQTAYESGAVIINCTYQSQFSPTLFWYQQKANGVPKYMLNRVGKTGDQDKEFKDRFNAQIDTSSKSFPLMIQDVSVSDSAVYYCALQPTVTQ
Leuciscus waleckii V2 trav FLSR01000646.1 63572 CDSQDSVEQNRRFQTAVEGAAVTINCQYETTDVLRNIFWYQQKVNGFPECMLSKFGQLKERFSGDLNTISKSFPLTIQDVSVSDSAVYYCL
Leuciscus waleckii V1 trav FLSR01000580.1 116286 SSGQDRIEQSYREMPASEGDQVILMCNYTTTSDTPYLFWYKQLPNRSPTFILNKYTFGEGTTEPDFKGRFSATLDSTSRSVPLTIQDVCVSDSAVYYCALT
Leuciscus waleckii V0 trav FLSR01000171.1 664080 VSGVTVVTQSPLITVNKGETAKLNCNLGTINNYARWYKQTPGGVLQFVLVFRHGWNSAGYGSGFSSPKFTSTYSSTLHYSLIISNVDVGDSAVYF
Leuciscus waleckii V53 igkv FLSR01004866.1 1882379 SSGQITVTQTPVVHTVSSGENVVMRCTASTPLTGCSPPCLSWYSQKPGEAPKLLIYQTSTRYTGTPSRFSGSGSGSDFTLTISGVQTEDTGDYYCQS
Leuciscus waleckii V52 trdv FLSR01002543.1 1107 VFADSIVPKEEGTNKTRREGESVTLSCTYSRNNVYLYWYRQNPNGEPQYLLFKGARSSDEGDVSDSRYKLTISPTSTSLTINNVNLSDSALYYCALKKSCPVIQS
Leuciscus waleckii V51 trav FLSR01000566.1 165659 AVFGNTIKSDKTNVGADEGQTVKLSCSYSSTGGTDYLFWYRQNGRSKPEFLVSTHSAVKKPEVSNVDSRLSLKITKNEQIHVDLEISSATVSDSAVYYCALR
Leuciscus waleckii V50 trav FLSR01000490.1 32496 KARCVNVQQKVTSLFADKNDKTEMECSHDDSSMLIMLWYQQKNTAMALIGYSYGTSDPTREDGFEERFKLKRTDTLNGSLEISELSLSDSAVYYCAVS
Leuciscus waleckii V49 igkv FLSR01000443.1 65992 QITVTQSPSITAVQPGEEVRINCKTSSRVHGYASVYYLSWYSQKPGEAPKNLIHEATIRHTGTPSRFSGSGSRTDFTLTISGVQTEDTGDYYCQS
Leuciscus waleckii V48 igkv FLSR01000338.1 57114 QITVTQSPSITAVQPGEEVRINCKTSSDVHVWGGYQCLVWYSQKPVEAPKLLIYEATTRYTGTPSRFSGSGSGSDFTLTISGVQTEDTGDYYCQS
Leuciscus waleckii V47 igkv FLSR01000338.1 64044 SRGVTLTQPEVKTVQQSQTATIECNIDVGIYSTHLYWYQQKPGEAPKLLIYYINSLYTGTPSRFSGSGTASTGRDFTLTISGVQTEDTGDYYCQS
Leuciscus waleckii V46 trav FLSR01000069.1 231 SSGQDRVEQSYREMPASEGDQVILRCNYTTTSNNPYLFWYKQLPNRSPTFILNKYTFGEGTTEPDFEKRFSATLDSTSRSVPLTIQDVCVSDSAVYYCALQPTVTQ
Leuciscus waleckii V45 trav FLSR01000069.1 3614 TALADTIQPLSSEKHIVEGKNVTLSCNYSATTGTVQSLQWYRQYLGAKPEIRLSVTEYTNKSEPGLRLFSKATKEIKRVDLEISSAEVSDSAVYYCALE
Leuciscus waleckii V44 trav FLSR01000069.1 15365 TALADTIQPLSSEKHIVEGKNVTLSCNYSATTGTVQSLQWYRQYLGAKPEIRLSVTEYTNKSEPGLRLFSKATKEIKRVDLEISSAEVSDSAVYYCALR
Leuciscus waleckii V43 trav FLSR01000069.1 25994 DTVDQPDKHVTEAEGRSVTLQCKYKTDSVQEDLFWYIQRANDFPKYILRRSKYGGENGTEFQERFHSELSSNSVPLMIKDVCVSDSAVYYCALK
Leuciscus waleckii V42 trav FLSR01000069.1 28805 TVFGNVIKPGETNVVAEKGSNVTLSCSYSSTTTDNLYWYRQYGRSKPEYLVLTYSSATEARVSGVDPRFSVEVEKKEQIHVYLKISSATVSDSALYYCALQ
Leuciscus waleckii V41 ighv FLSR01004887.1 24231325 IDSQVVLTQSEQSVVVAPGGSHKLTCACSGFTLSGTSMHWIRQAPGKGLEWIIYYYSDSNKSSAQSVQGRFTATKDSSNFYLHMNQLKTEDTAVYYCAR
Leuciscus waleckii V40 ighv FLSR01004887.1 24069696 ISGDEILLDQSSAVIKRPGETVKISCKISGFTMTSYFMHWIRQKPGKALEWIGRVNSGSSSSSDYLIYADSGKNLFTMSEDVSQSTQYLEAKSLREEDTAVYYCARE
Leuciscus waleckii V39 ighv FLSR01004887.1 24069696 ISGDEILLDQSSAVIKRPGETVKISCKISGFTMTSYFMHWIRQKPGKALEWIGRVNSGSSSSSDYLIYADSGKNLFTMSEDVSQSTQYLEAKSLREEDTAVYYCARE
Leuciscus waleckii V38 ighv FLSR01004887.1 23933501 VSGQSLTSSDSVVKRPGESVTLSCGVSGFSMSSYYSWIRQKPGRGLEWIGRIDGGTGTSFAQSLQGQFSITKDTSKNMLYLEVKSLKTEDTAVYYCARD
Leuciscus waleckii V37 trav FLSR01004887.1 23854517 CVQFEQSPHLFANQNGNAEINCKHDDSTLAVMLWYRQQNMSLDLIGYGYSGSPANSEPGFTERFTQTRQDTVIGSLTISELTPSDSAVYYCAAS
Leuciscus waleckii V36 trav FLSR01004887.1 23848755 EMCEHSAEPDTILANKNNIAEIKCSHDDSNMLYMYWFQQKDTAMVLIALSYGATSDPDNEDGFKERFKVKRTGTLNGSLEISELSLSDSAVYYCAVS
Leuciscus waleckii V35 trbv FLSR01004887.1 23837723 LSMALKVTQTPIDLFLVIGASMNITCRHDDKSYDKIFWYQQTNGQSLEHLGLISFRQPLVDRKGFNITGDAEKEANLLVSSVKAEHSAVYLCAVSD
Leuciscus waleckii V34 trav FLSR01004887.1 23816265 LVQSQRVSQSPPDLMRIPTESAVLTCSHSDQGFELILWYKQSEDRGLIFLGYLNLNSPFPEDEFKNKIVLDGDGRSRATLTIHNLTSVDSAVYYCAAR
Leuciscus waleckii V33 trav FLSR01004887.1 23816265 LVQSQRVSQSPPDLMRIPTESAVLTCSHSDQGFELILWYKQSEDRGLIFLGYLNLNSPFPEDEFKNKIVLDGDGRSRATLTIHNLTSVDSAVYYCAAR
Leuciscus waleckii V32 trav FLSR01004887.1 23814844 LVQSQRVSQSPPDLMRIPTESAVLTCSHSDQGFERILWYKQSEDSRFIFLGYLNNNFKNPEEEFKNKIVLDGDGRSRATLTIHNLTLVDSAVYYCAAR
Leuciscus waleckii V31 trbv FLSR01004887.1 23802687 TVLGESVVQTPPDVLKKQDDFAEIKCSHKVQSYDVIQWYKQSQSIMDLQLMGYLNVQYENQETEFKDKIKLSGDGRNNVTLKINSLRLNDSAVYFCAAY
Leuciscus waleckii V30 trav FLSR01004887.1 23801899 TSDVSQSPGVLMAVKGSSAQMNCTHKKDITFNQMYWYRQRRGQTMTLLVFTSSVSKPDFGDSDQSKFDVSKSVPESGSLTVKNAQPEDSAVYFCSVS
Leuciscus waleckii V29 trav FLSR01004887.1 23801899 TSDVSQSPGVLMAVKGSSAQMNCTHKKDITFNQMYWYRQRRGQTMTLLVFTSSVSKPDFGDSDQSKFDVSKSVPESGSLTVKNAQPEDSAVYFCSVS
Leuciscus waleckii V28 igkv FLSR01004887.1 10397982 SRGVTLTQPEVKTVQQSQTATIECNMDVGLTSNDLAWYQQKPGEAPKLLIYYIRNLYTGTPSRFSGSGSNYGSDFTLTISGVQTEDTGDYYCLS
Leuciscus waleckii V26 trav FLSR01004887.1 9425235 DIFGNVITPVQTEVYRTENEMISLSCNYSSAVSLYWYRQYPRSAPEFLFVILHATGKVLQKSKVVDLDTRFSGKLNKEKPHTHLEISSAKVTDSAMYYCAME
Leuciscus waleckii V25 ighv FLSR01004886.1 10080155 ISGQSLTSSDSVVKRPGESVTLSCGVSGFSMSSYWMHWIRQKPGRGLEWVGRIHGSTVYYAQSLKGQFSITTDTSKNMLYLEVKSLKTEDTAVYYCARD
Leuciscus waleckii V24 trbv FLSR01004881.1 392970 DFSDSVLITQWPKYISSLPGSSVEMHCYQNDADYDYKYWYRQIQGEGPVLVGSIVGTADSLEKGFETGFNVSGTEKKKWTLTVDVKEGIDAVYLCAAS
Leuciscus waleckii V23 igkv FLSR01004880.1 12706661 SVGEPTVTQTPAVKSVQLRDTFTISCKTSPEVYQGWGNQPLHWYLQKPGEAPKLLIYLANTLQSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Leuciscus waleckii V22 trbv FLSR01004878.1 1604433 SVVTQTPILWASQGKSAQMNCSHTMGSSYFYMYWFGQRQGETMRLIAFTMTNSNPDFGEFSADKYSADKTVAERGSFTVSKLEPDDSGVYFCAVS
Leuciscus waleckii V21 trav FLSR01004874.1 8228110 GRFESLITSDQTEVFHEEGDIIVLSCSYSTAISLHWYRQYPKSAPEYILVILQTSGRDQRAENLDSRFSVRLNEKKNRVDLEISSAKVSDSALYYCALE
Leuciscus waleckii V20 trdv FLSR01004872.1 8142626 VFADSIVPKEEGTNKTRREGESVTLSCTYSRNNVYLYWYRQNPNGEPQYLLFKGARSSDEGDVSDSRYKLTISPTSTSLTINNVNLSDSALYYCALKSRSPVIQS
Leuciscus waleckii V19 trav FLSR01004872.1 8134578 VSFGNDITPVKTHMSGTEGEIISLSCSYSSARSLFWYRQYLGSTPEFLFIILHGTGEVLQKSKILDQDHRFSAKLNEKKTHVDLEISSAKVTDSAMYYCALE
Leuciscus waleckii V18 trav FLSR01004872.1 8123822 CQSEDTVDQPLKHVTGFEGELITLDCKYTTTSTSQELFWYIQRLDESPKLVLQRNSYGGGVNGTENQERFLSEQKASKSVPLIMQRLRVSDSAVYYCALR
Leuciscus waleckii V17 trav FLSR01004872.1 8114413 RVEQPSRKLTANEEDQILLMCNYTTRATNADVYLFWYKQLPNKSPTFILNKYTFGEGTTEDEFKGRFSATLDSTSRSVPLTIQDVCVSDSAVYYCALKPTVTQ
Leuciscus waleckii V16 trav FLSR01004872.1 8114413 RVEQPSRKLTANEEDQILLMCNYTTRATNADVYLFWYKQLPNKSPTFILNKYTFGEGTTEDEFKGRFSATLDSTSRSVPLTIQDVCVSDSAVYYCALKPTVTQ
Leuciscus waleckii V77 trbv FLSR01004887.1 24416093 SVVNGSVQQSPSNLIKTERDSAELVCTHKITSYNIILWYKQTRGHELTLLGYIWNTNYYPEDDLKGKIRLNGDGTKTGSFKIEALALNDSAMYFCAAS
Leuciscus waleckii V76 trbv FLSR01004887.1 24418492 VCLGETGLQSPGNLIKNHDDSAVIICEHNILNYDRILWYKKDMGFKLMGYLNLKSDYPESEFKDKITLSGDGRNNGTLTIKNLRLNDSAVYFCAAYYTVFT
Leuciscus waleckii V75 trbv FLSR01004887.1 24426513 ACLGETVDQTPANLFKKQDESAVIICAHNIKNYDQIYWYKQSQDTSGLKLMGYLYYSENKEPEFENKIELEGDAKKNGTLTIENLRLNDSAVYFCAAYYTQCSQ
Leuciscus waleckii V74 trbv FLSR01004887.1 24427945 ACLGETVDQTPANLFKKQDESAVIICTHNIPRYDQMYWYKQSQDTSGLKLMGYLYYSEKKEPEFENKIKLHGDAEKNATLTIENLRLNDSAVYFCAAYYTQCSQ
Leuciscus waleckii V73 trbv FLSR01004887.1 24427945 ACLGETVDQTPANLFKKQDESAVIICTHNIPRYDQMYWYKQSQDTSGLKLMGYLYYSEKKEPEFENKIKLHGDAEKNATLTIENLRLNDSAVYFCAAYYTQCSQ
Leuciscus waleckii V72 trav FLSR01004883.1 2345700 KVDQHKQIQYAVEGDDVTINCTYQTANANPTLFWYQQKVNEIPKFMLYKFTQTGQNEDEFKERFQANLSKTSVPLTIQDVCVSDSAVYYCALKPTVTQ
Leuciscus waleckii V71 trav FLSR01004883.1 22775009 CDSQDSVEQNTRFQTAVEGAAVTINCRYDTTAVLQNIFWYQQKVNGFPEHMLNKFKYHFKERFSGDLNTISKLFPLTIQDVSVSDSAVYYCALMTTVTE
Leuciscus waleckii V70 trav FLSR01004883.1 22778557 SSGQDRVEQSYREMPASEGDQVILRCNYTTTSNTPYLFWYKQLPNRSPTFILNKYTFGEGTTEPEFKKRFSATLDSTSRSVPLTIQDVCVSDSAVYYCALRPTVTQ
Leuciscus waleckii V69 trav FLSR01004883.1 22781000 ASNGDTITPDKTQEFAAEGSSVKLSCSYSSAWSLLWYRQYPGSAPEFLVLISDTAKDVKPSDVDQRFTTKIRKDNQNRVDLEISSAEVSDSAVYYCALT
Leuciscus waleckii V68 trav FLSR01004883.1 22781594 TSLADTIQPFTSEKHVVEGRNVTLSCNYSTTGVTVNSLQWYRQNIRTKPEILLLVTEYLSKSEPGLRLYSKATKEIKRVDLEISSAEVSDSAVYYCALE
Leuciscus waleckii V67 ighv FLSR01004876.1 1473278 VSGQSLTSSDSVVKRPGESVTLSCGVSGISMGSYYSWIRQKPGRGLEWIGRIDGGTGTSFAQSLQGQFSITKDTSKNMLYLEVKSLKTEDTAVYYCARD
Leuciscus waleckii V66 igkv FLSR01004876.1 12630134 TVTQTPQVQPTQHDETVKINCKTNQPVADCSLWRNCVSWFQHKPGHAPKLLIYNIRDRHSNVPSRFSGIGAHTDFNLTISGVQKEDEAQYYCMT
Leuciscus waleckii V65 trav FLSR01004875.1 21592384 VSGVTVVTQNPPLMSVNKGQTVSLVCNTGSSTDGGRWYKQVAGGTPQFVLNSHHSWSSTPTYGSGFSSPKFTVSYPTESDCHLSINNVDVGDSAVYY
Leuciscus waleckii V64 trav FLSR01004875.1 21598805 VSGVTVVTQSPLITVNKGETAKLDCNLGTETDSEARWYKQTPGGVPQYVLIFYHGWSSVTYGSGFSAPKFTSTHSSKSDYSLIITNVDVGDSAVYY
Leuciscus waleckii V63 trgv FLSR01004872.1 25379176 VEGLSLDQNQKVLVKLKGKTVSFRCEVTGLGTSNSVHWYPKKDGETFKRLLYISASGTATIEAKDFVSEKIGNSYGIKLKETKEEHAGMYYCACWDG
Leuciscus waleckii V62 trgv FLSR01004872.1 25379176 VEGLSLDQNQKVLVKLKGKTVSFRCEVTGLGTSNSVHWYPKKDGETFKRLLYISASGTATIEAKDFVSEKIGNSYGIKLKETKEEHAGMYYCACWDG
Leuciscus waleckii V61 trav FLSR01004872.1 25380254 DVLGVTLEQGQPTLFKAVGKTSYLPCKVTDLQSWNYIHWYQKREGEAPSRLLYINAGGSFTHDTNNPQANDFTVDRTQLFNLKLSNTKPIHAAVYYCA
Leuciscus waleckii V60 trav FLSR01004872.1 25380254 DVLGVTLEQGQPTLFKAVGKTSYLPCKVTDLQSWNYIHWYQKREGEAPSRLLYINAGGSFTHDTNNPQANDFTVDRTQLFNLKLSNTKPIHAAVYYCA
Leuciscus waleckii V59 trav FLSR01004872.1 25380254 DVLGVTLEQGQPTLFKAVGKTSYLPCKVTDLQSWNYIHWYQKREGEAPSRLLYINAGGSFTHDTNNPQANDFTVDRTQLFNLKLSNTKPIHAAVYYCA
Leuciscus waleckii V58 trav FLSR01004872.1 26250217 STAQDSVIQSKQVMTAFEDGTATLDCTYKATSTQYPNLFWYQQKTKGSPKYMLMRLSGSSDNDEEFKQRFNAVLNTSALTVPLTIKDVHVSDSAVYYCALK
Leuciscus waleckii V57 trav FLSR01004872.1 26250217 STAQDSVIQSKQVMTAFEDGTATLDCTYKATSTQYPNLFWYQQKTKGSPKYMLMRLSGSSDNDEEFKQRFNAVLNTSALTVPLTIKDVHVSDSAVYYCALK
Leuciscus waleckii V56 ighv FLSR01004867.1 17977662 GVYCVELTQPPSLVVKPQESFSISCRISESSYCIHWIRQPTGKALEWLGVMCNGGGTETKESLKNKISFTQDTSKNTVFLRGKNFQAEDTAVYYCARYTVIKQ
Leuciscus waleckii V55 igkv FLSR01004866.1 1456908 SVGEPTVTQTPAVKSVQLRDTFTISCKTSPEVYQGWSFHPLSWYLQKPGEAPKLLIYYANRLQSGTPSRFSGSGSNSDFTLTISGVQTEDAGHYYCQS
Leuciscus waleckii V54 igkv FLSR01004866.1 1866866 CRGQITVTQSPSIPALQPGEEVRINCKTSSDVRYGYRLAWYSQKPGEAPKLLIYDATSRYISSGTPSRFSGSGSGSDFTLTISGVQTEDTGDYYCQEL
Leuciscus waleckii V27 trav FLSR01004887.1 9425235 DIFGNVITPVQTEVYRTENEMISLSCNYSSAVSLYWYRQYPRSAPEFLFVILHATGKVLQKSKVVDLDTRFSGKLNKEKPHTHLEISSAKVTDSAMYYCAME