WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Miichthys miiuy JXSJ00000000.1 (JXSJ01) 58 36 0 7 4 10 1 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Miichthys miiuy V22 igkv JXSJ01000754.1 41573 QVTVTQPGAVSSAVGGSVTINCRTSQNVYNGNYLAWYQQRDGETPKLLIYYASTRPSGIPARFTGSGSNSDFTLTISRLQAEDAAVYYCQS
Miichthys miiuy V21 trav JXSJ01000209.1 466905 VIQSAAVEQDTEVVSASVGDNVTLHCFYNSQVSMHFSWYQQTLGGRPELLSNFYKYDQPSKVFDWMEKNPRFSVQRKEGMNHLHITDVRFSDSATYFCGS
Miichthys miiuy V20 trav JXSJ01000193.1 485282 SSVGVKIDQPSFVFSREGDTAVTLQCKQDDEQYNYMYWYRQSSSMEMQLVAYSLGKDMSTIEAPFNSSKFTMSRPAVLKSSLQIQRAEAADSAVYYCASSR
Miichthys miiuy V19 trbv JXSJ01000193.1 489345 KVESVTFEQSSSQVVKEGSPLRINCSHDDSSLQTMLWYQYKQTSRSMSLIGYTVLTSPPKYEGEFKDRFQIKPDDALKGALIIQTVNLSDSAVYFCAA
Miichthys miiuy V18 trbv JXSJ01000193.1 494672 KSVTFQQSPPKIANQTTRVEIKCSHDDSSLNIMLWYQQKESRLMDLIGYSYMSNDPVYEKQFEHGFEITKQGTLTGALIIQSVNLSDSAVYFCAAS
Miichthys miiuy V17 trbv JXSJ01000193.1 495861 QVSAVTFQQSPPQIVKESSEVNIKCSHDDNSRPLMLWYQQTKDSRSMTLIGYGYQGSPNYEGQFEKEFKLTRESATRGTLIIHRANLSHSAVYFCAASTQ
Miichthys miiuy V16 trav JXSJ01000193.1 499337 GCLGVEVHQSPSDLITNHGDKVQIFCTHDKTDYRVMLWYQQSPGDTAMKLIGYLNYKAVTMEKLYEKQFNISGDLGGNTAKNGSLVFQTSGFEHSAVYYCAASR
Miichthys miiuy V15 trbv JXSJ01000193.1 500409 SSLNDQVHQTPADIYEKPGKAAKINCFHSIQYYDQIFWYKQSKNGEMQLLGYMNVNNGVPEKGVNVKIEGSANKGKICTLTTEEVSVSSSAVYFCAASYTVLQ
Miichthys miiuy V14 trbv JXSJ01000193.1 501595 SSDQVYQTPAHIYGKLEQTAKINCSHSIQNYNQILWYKQTNGQLQLLGYMYVRGANPEAEMKVKMEGDASKDQICTLIIEKLSLDRSAVYFCAAS
Miichthys miiuy V13 trbv JXSJ01000193.1 503588 LSKYSVHQTPTAVITHAGEDVLMNCSHSNADFDMIQWYKQSAGKNDMVLVSYVRFSLLVVESPFKDSYNVSGTGGSLSCLHIPKSRSENSAVYFCAASR
Miichthys miiuy V12 trbv JXSJ01000193.1 504314 CSLSTKVHQAPSSILGRPHGSATISCNHSVSSYNVILWYQQPIGDSELKLIGYLLYTSPTLEDSFKQHFNLTGDGSVKSQLHVLKLRQTEDSGVYYCAAS
Miichthys miiuy V11 trbv JXSJ01000193.1 505493 STGGTGVHQTPGLLIERGQSAQMYCSHDLGGSYFQMCWYQQLPGESMKLVVHTVPYNSEPDFGDFSQDKFSATKDEAESGSFTVKNVEPADNGVYFCAVST
Miichthys miiuy V10 trbv JXSJ01000193.1 506709 LIDGSDVTQTDMLWRHKGNSATINCSHTKDATHFQMYWYRQRPGEGMKQIVFTTSYSSPQYESGFSEDKFPAQKNDSQTGSLTVKKLLPEDSGVYFCSVS
Miichthys miiuy V9 trbv JXSJ01000193.1 507823 ASNTSKVLQTPDFIIKRTGDTVASGINCSHNIATYDVILWYKQDRQGALKLLGYQYAKMKTLEDDVKGKISFDGDGNTHSSLTISNLLLDDSSVYFCAAS
Miichthys miiuy V8 ighv JXSJ01000107.1 3990 VKCEQLTQPASVTVQPGQHLTITCQVSYSISSYLTAWIRQPAGKGLEWIGVRNTGASFYKDSLKNKFSIDLDTFSKTVTLNGQNVQPEDTAVYYCARE
Miichthys miiuy V7 ighv JXSJ01000107.1 8354 NSWHSGSVTVQPGQCLTITCQVSYSVGSHYTAWIRQHAGKQLEWIGMRNTGASFYKDSLKNKFSIDLDSSSNTVTLNGQNVQPEDTAVYYCARE
Miichthys miiuy V6 ighv JXSJ01000107.1 15687 IDGQTLTESEPVIKRPGESHRLTCTASGFTFRSYAMSWIRQAPGKRLEWIAYIGTSSTPIFYSQSVKGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARR
Miichthys miiuy V5 ighv JXSJ01002480.1 8341 VKCQQLTQPASVTVQPGQRLTITCQVSYSLSSYYTAWIRQPAGKGLEWIGMRANGYTSYYKDSLKNKFSIDLDTSSNTVTLNGQNVQPEDTAVYYCAKE
Miichthys miiuy V4 ighv JXSJ01002480.1 5937 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSNHWMAWVRQAPGKGLEWIATEAGSSGKYYSQSVQGRFIVSRDNGRQQVYLQMNSLKTEDSAVYYCA
Miichthys miiuy V3 ighv JXSJ01002480.1 4214 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSSYHMGWIRQAPGKGLEWIAFIYTDSSGMFYSQSVQGRFTISRDNSRQQLYLQMNSLKTEDSAVYYCARE
Miichthys miiuy V2 igkv JXSJ01001649.1 28897 IVLTQTPAVHTVSTGQEVVLKCNIQRFDGNYVSWHKQVPGKAPQYVLRFYHSHSSPDFGTGFSSDRFNSKASSNIDYQFIIKRAEAGDPAVYYCTTWDSSASAAV
Miichthys miiuy V1 igkv JXSJ01000804.1 14008 LDLQVATLPASTVQVRLGQDATLHCPLLASNASTLSWYRKAAGCSPELVLSVRTSHSPPVSFGPGLGPEKVSAAADGSLVLLGSQRSDSAVYYCGVSNGGPDQDRK
Miichthys miiuy V0 igkv JXSJ01000048.1 2378505 IVLTQTPAVHTVSTGQEVVLKCNIQRFDGNYVSWHKQVPGKAPQYVLRFHRSDSSPTFGTGFSSDRFNSKASSNIDYQFIIKRAEAGDSAVYYCTTWDDSASAAV
Miichthys miiuy V56 trav JXSJ01001402.1 35341 SRGQVTVTQPGAVSSAVGGSVTITCRTSQNVRVWNNYHLLAWYQQRDGETPKLLIYYASTRLSGIPDRFTGSGSNSDFTLTISGVQTEDAAVYHCQS
Miichthys miiuy V55 ighv JXSJ01001364.1 43219 VDGQTLTESEPVVKRPGESHRLTCTASGFSFSSYSMVWNRQAPGKGLEWVAYINSASSSISYSQSVKGRFTISRDNSREQVYLQMNSLKTEDSAVYYCA
Miichthys miiuy V54 ighv JXSJ01001364.1 43743 VKCQQLTKLAPVTVKPGQRLTITCQVSYSVSSFFTAWIRQPAGKGLECIGMRNTGGSFYKDSLKNKFSIDLDSSSNTVTLNGQNMQPEDTAVYYCTRE
Miichthys miiuy V53 ighv JXSJ01001364.1 45199 VDGQTLTESEPVIKRPGESHKLSCTASGLTLSSYHMAWIRQAPGKGLEWVAWIHTGSSSKYYSQSVQGRFTISRDDGRQQVYLQMNSLKTEDSAVYYCARD
Miichthys miiuy V52 ighv JXSJ01001364.1 51538 VDGQTLTESEPVIKRPGESHRLTCTTSGLTFSSSHMAWIRQAPGKGLEWVAWIAYNDDRKFYSQSVQGQFTISTDNSRQQVYLQMNSLKTEDSAVYYCARD
Miichthys miiuy V51 ighv JXSJ01001364.1 53118 VDGQTLTESEPVIKKPGESHRLTCTASGFTFSSYPMSWVRQAPGKGLEWIAYISTASTPIYYSQSVKGRFTISRDDSRSKLYLQMNSLKAEDTAVYYCARR
Miichthys miiuy V50 ighv JXSJ01001364.1 55040 VDGQTLTESEPVIKRPGESHRLTCTASGFSFSSYTMHWIRQAPGKGLEWIAFINSASSDISYSQSFKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCGRE
Miichthys miiuy V49 ighv JXSJ01001364.1 56812 ADGQTLTESEPVIKRPGESHRLTCTTSGLSFSSYSMGWNRQAPGKGLEWVAYVRYDSGSISYSQSVQGRFTISRDNSREQVYLQMNSLKTEDSAVYYCTRL
Miichthys miiuy V48 igkv JXSJ01000904.1 58643 QVTVTQPGAVSSAVGGSVTINCRTSQNVYNGNYLAWYQQRDGETPKLLIYYASTRPSGIPARFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Miichthys miiuy V47 igkv JXSJ01000904.1 60314 QVTVTQPGAVSSAVGGSVTINCRTSQNVYNGNYLAWYQQRDGETPKLLIYYASTRPSGIPARFTGSGSNSDFTLTISGVQTEDAAVYYCQS
Miichthys miiuy V45 ighv JXSJ01000796.1 50325 VWSEIKLDQSPSEVKRPGETVKMSCVISGFDMTSYFIHWIRQKPGKALEWIGRMDTGSNSAIYASSFQSRFIMTEDVSSSTQYLEVKSLTAEDSAVYFCARQ
Miichthys miiuy V44 ighv JXSJ01000796.1 53014 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSDYWMAWIRQAPGKGLVWVASISQPSGSSKYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Miichthys miiuy V43 ighv JXSJ01000796.1 56092 VCSQTLTESEPAMKRPGESHKLTCTYAGISDSSAHIGWIRQAEGKGLEWVAYISAGGTKAYSTSVKNRFTISRDANVDQVYLQMNSLATEDSAVYYCARE
Miichthys miiuy V42 ighv JXSJ01000796.1 57556 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSDYSMHWIRQAPGKGLEWLAYIRYDSSYIYYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCA
Miichthys miiuy V41 ighv JXSJ01000796.1 58834 VWSEIKLDQSPSEVKRPGETVKMSCVISGFQMTSHYMHWIRQKPGKALKWIGRMDTGSNSAIYASSFQSRFIMTEDVSSSTQYLEVKSLTAEDSAVYFCARQ
Miichthys miiuy V40 ighv JXSJ01000796.1 61306 TEGQTLTESEPVVKRPGESHRLTCTYSGFSSTPDNAWIRQAAGKGLEWLAYISSGSSYIYYSQSVKGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARD
Miichthys miiuy V39 ighv JXSJ01000796.1 62383 KCEQLTQPASVTVQPGQRLTITCQVSYSVDSYYTAWIRQPAGKGLEWVSRDTDVKDSLKNKFSINLDSSSNTVTLNGQNVQPEDTAVYYCARE
Miichthys miiuy V38 ighv JXSJ01000796.1 68091 VNSINLVQPEPMVVQPGQSLTITCQVSGYSVTDNSYATGWIRHCEGKPIDWIFHQWGGGDFYQNNALKNKFSYSRDTSAATVTLKGQNVQPEDTAVYYCARR
Miichthys miiuy V37 ighv JXSJ01000796.1 69230 CTGQSMESIPSSSVVKKPGETLSLSCRGSGFTFSCCVMSWIRQPAGKALEWIGVGWSDASKNTYASSLQGRVEISRDDSNSMVNLRLSNLKPEDSAVYYCAR
Miichthys miiuy V36 ighv JXSJ01000796.1 74095 TEGQTLTESEPVVKRPGESHRLTCTYSGFSSTPDNAWIRQAPGKGLEWLAWIHSGSSDIHYSQSVKGRLTISRDNGREQLFLQMNSLKTEDSAVYYCARE
Miichthys miiuy V35 ighv JXSJ01000796.1 75716 VDGQTLTESEPVIKRPGESHRLTCTVSGFTVSSNNMGWIRQAPGKGLEWLAWIHSGGSTDYSQSVKGRFTISRDNNRQQVYLQMNSLKTEDSAVYYCARD
Miichthys miiuy V34 ighv JXSJ01000796.1 101306 VDGQTLTESEPVIKRPGESHRLTCTTSGLSFSASWVNWVRQAPGKGLEWIAIIESGSVSSKYYSQSVQGRFIISRDNSRQQLYLQMNSLKTEDSAVYYCARD
Miichthys miiuy V33 ighv JXSJ01000796.1 104091 VKCEQLTQPASVTVEPGQRLTITCQVSYSLGSYYTAWIRQPAGKGLEWIGSRYTGAAYYKDSLKNKFSIDLDTSSKTVTLNGQNVQPEDTAVYYCARE
Miichthys miiuy V32 ighv JXSJ01000796.1 106312 VDSQTLTESEPVIKRPGESHKLTCTASGFTFSSYHMAWIRQAPGKGLEWIAWVENDNDRKYYSQSVQGRFTISKDNSRQQVFLQMNSLKTEDSAVYYCARE
Miichthys miiuy V31 ighv JXSJ01000796.1 109728 VDGQTLTESEPVTKRPGESHRLTCTASGFSLSSYTMHWIRQAPGKGLEWIAYISGGGSTYYSQSVKGRFTISKDNSRQQLYLQMNSLKTEDSAVYYCARD
Miichthys miiuy V30 ighv JXSJ01000796.1 110954 VDGQTLTESEPVIKRPGESHRLTCTTSGLSFSSYSMVWNRQAPGKGLEWIAYINSASSSISYSQSVQGRFTISRDNSREQVYLQMNSLKTEDSAVYYCARL
Miichthys miiuy V29 ighv JXSJ01000796.1 111911 TEGQTLTESEPVVKRPGESHRLTCTYSGFDSNYANVWIRQAPGKGLEWLAYISSASSSIFYSQSVQGRFTISRDNSRQQVYLQMNSLKTEDSAVYYCARQ
Miichthys miiuy V28 ighv JXSJ01000796.1 114505 VDGQTLTESVPAIKRPGESHRLTCTTSGLSFSSKWMGWIRQAPGKRLEWIALINSASSSIYYSQSVQGRFTISRDNSREQLFLQMNSLKTEDSAVYYCARE
Miichthys miiuy V27 ighv JXSJ01000796.1 116353 VDGQTLTESVPAIKRPGESHRLTCTTSGFTFSSYWMNWVRQAPGKGLEWIAFIYGDSSGTFYSQSVKGRFTISRDNGRQQVYLQMNSLKTEDSAVYYCARD
Miichthys miiuy V26 ighv JXSJ01000796.1 118415 CTGQSMESIPSSSVVKKPGESLNLSCRGSGFTFTCCVMSWIRQPAGKALEWIGVGWSDASKNTYASSLQGRVEISRDDSNSMVNLRLSNLKPEDSAVYYCAR
Miichthys miiuy V25 ighv JXSJ01000796.1 121762 VDGQTLTESEPVIKRPGESHRLTCTASGFTFSSSEMAWIRQAPGKGLEWIAFISTVSTPIYYSQSVKGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCARR
Miichthys miiuy V24 ighv JXSJ01000796.1 126687 VKCEQLTQPASVTVQPGQRLTITCQVSYSLSSYYTAWIRQPAGKGLEWIGMRYTGNSYYKDSLKNKFSIDLDTSSKTVTLNGQNVQPEDTAVYYCATE
Miichthys miiuy V23 igkv JXSJ01000754.1 38101 SRGQVTVTQPGAVSSAVGGSVTINCRTSQNVHVHEQKHCLSWYQQRDGERPKLLIYLASTRQSGIPDRFTGSGSNSDFTLSISGVQTEDAAVYYCQSYHAINSQGV
Miichthys miiuy V57 trgv JXSJ01001585.1 14035 ELIQDDLTLTRRVDEEVSFSCGRTDQCDYNDYIFWYQKKDTETFRVILDINRKNGKLDYSYNHPQKNDFSAVNKQNGCELKIQKVKLSHSATYYCNCWKRD
Miichthys miiuy V46 ighv JXSJ01000796.1 48110 VCSQTLTESEPAMKRPGESHKLTCTYAGISDSSAHISWIRQAEGKGLEWVAFISAPSGATKEYSTSVKNRFTISRDNNVDQVYLQMNSLTTEDSAVYYCARE