WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Mola mola MBDK00000000.1 (MBDK01) 25 11 0 3 2 8 0 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Mola mola V3 trbv MBDK01046470.1 469 QVSAVSFRQSPQQIVTESSEVRINCTHDDSSLSVMFWYQQRKDSPSLTLIGYGYVTSQNYEAEFEKQFKLTRQNTVSGTLVVLRANPSHSAAYFCAASTQ
Mola mola V2 ighv MBDK01046361.1 2705 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSGYWTHWIRESAGKGLEWIGMKYTGGSYYKDSLKNKFSISVDSSSKTVTLNGQNVQPEDTAVYYCARDTQ
Mola mola V1 igkv MBDK01034576.1 21556 ASPSVTQSPVSKSVAVGETASLSCTASRGVDDDLSWYQQKPGQPPKLLFYKISERESDTPSRFSSSGSEPEFTLTISGVQAEDAGDYYCLGVYSGPM
Mola mola V0 igkv MBDK01004535.1 11308 SRGQVTVTQPGAVSSAPGGSVSISCRTSQNVYVNSGNHYLAWYQQRDGEAPKLLIYLASTRASGIPDRFTGSGSNSAFTLTISGVQTEDAAVYYCQS
Mola mola V23 ighv MBDK01047556.1 250 VDGQTLTESESVVKRPGESHKLTCTPSGFTFSSYYMAWIRQAPGNGLEWIATISDTSSSIFYSESVKGRFTISRDNNRQQVYLQMNSLKTEDSSVYYCARD
Mola mola V22 trbv MBDK01046897.1 158 RVQSYTFEQTSSQVVREGTEELRIDCSHDGSDLQTMLWYQHKQSSRAMSLIGYSVIQSQPSYEGQFQDRFKIQRDDTKKGSLVIHTVQLSDSAVYFCAASTQ
Mola mola V21 ighv MBDK01046426.1 175 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMKYTGGSYYKDSLKNKFSIDVDSSSNTVTLKGQNLQPEDTAVYYCARD
Mola mola V19 trbv MBDK01046379.1 4157 SSLSDKVHQSPAEMLHNREETAKINCSHSIQDYNYIYWYKLTEDRQMQLLGYMYNNDGNPEAGSGVKIEGGARKDQTCTLTIEGLGLNSSAVYFCAAS
Mola mola V18 trbv MBDK01046379.1 6203 SSLSDKVNQSPAEMLHNREETAKINCSHSIQDYDYIYWYKLTEDRQMQLLGYMSYNSGNPEVGSGVMIEGGARKDQTCTLTIKGLGLNSSAVYFCAAS
Mola mola V17 ighv MBDK01046365.1 110 VDGQTLTESESVVKRPGESHKLTCTASGFTFSSSWMAWIRQAPGKGLEWVATISSSSSYIYYSESVKGRFTISRDNNRQQVYLQMNSLKTEDSAVYYCARD
Mola mola V16 ighv MBDK01046306.1 510 VDGQTLTESESVVKRPGESHKLTCTASGFTFSSYGMNWVRQAPGKRLEWIASVYTSSYIYYPESVKGRFTISRDNNKQQVYLQMNSLKTEDSAVYYCARD
Mola mola V15 ighv MBDK01046305.1 174 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYNTAWIRQPAGKGLEWIGMNCAGCTPYYKDSLKNKFSISVDSSSKTVTLNGQNVQPEDTAVYYCARDTQ
Mola mola V14 ighv MBDK01043962.1 9254 LRAEDKISPVGDGVSGREGESVTLTCRYETTDTTPVLFWYRQHSDLQAPQFILWKGARGNTGENIPDKRYESSTSQSETQLTIKSVTLADTALYYCALE
Mola mola V13 ighv MBDK01034579.1 1336 VDGQTLTESESVVKRSGESHKLTCTASGFTFSDYWMAWIRQAPGKGLEWIAYVYYSSNIYYSESVKGRFTISKDNNRQQVYLQMNSLKTEDSAVYYCARH
Mola mola V12 ighv MBDK01034579.1 6710 VNCIDLIQPDSVVVQPGQSLTITCQVSGYSLTDNSYATGWIRQREGKSMEWIFHQWGGGDFYQNNALKNKFSYSRDTSARTVTLKGQHLQPEDTAVYYCARQ
Mola mola V11 ighv MBDK01034579.1 7872 LKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWISSDSNVKNSLQSKFSVDLDSSSNTVTLNGQNLQPEDTAVYYCAR
Mola mola V10 trav MBDK01034315.1 1659 DCQGVTQHPEIVWSYVSKSAEMNCSHNKDITYTQMDWYRQRPGGTMSLVVYTVFGGQPDYRGAPPNKYSAIKDKTESGALTVKDLQLEDSGVYFCAVS
Mola mola V9 trdv MBDK01034315.1 2553 SSRSDQVYQTPSDIYSVQGESAKIECSHSIDIYDRILWYKKSNRQLQFLGYMFYENRNPEMGLNVKIDGSATKDRTCRLTLEALRLNSSAEYYCAAS
Mola mola V8 trbv MBDK01034315.1 5084 ASQTNSVLQKPPFIIKRADESVVSGIYCSHKMTGHDRILWYKQDEHKALKLLGYLNVNFPNPEDHVKGKISFDGDGRTHSSLSISNLSLSDSGVYFCAASHHSAAD
Mola mola V7 trbv MBDK01034315.1 8004 ASQTNSVLQKPPFIIKRADESVVSGIYCSHKMTGHDRILWYKQDEHKALKLLGYLNVNFPNPEDHVKGKISFDGDGRTHSSLSISNLSLSDSGVYFCAASHHSAAD
Mola mola V6 trbv MBDK01034315.1 9857 VISGSDVTQDPILWKRRGDSATISCRQSKGPTYFQMYWFRQLPGEAMKLIVFTTTGSQNHDFGNFSKEKFSATKPDAESGTFTVKDLEPQDKGLYFCAAS
Mola mola V5 ighv MBDK01047391.1 118 VDGQTLTESESVFKRPGESHRLTCTGSGFTFSSYGMSWVRQAPGKGLEWNAYVYSSYIYYSESVKGRFTISRDDNRQQVYLQMNSLKTEDSAVYYCARD
Mola mola V4 trav MBDK01046629.1 1805 APDTNGIVQEPPFIIKRSAESVDRGIHCSHGIRNYDVILWYKREGRGALKLLGHLNVNFVNLEDDVKGKILFDGHGSSKSGLTIYNLTLSDSGVYFCAVR
Mola mola V24 igkv MBDK01047756.1 37 ASPSVTQSPVSKSVAVGETASLSCTASRGVDDDLSWYQQKPGQPPKLLFYKISERESDTPSRFSSSGSEPEFTLTISGVQAEDAGDYYCLGVYSGPM
Mola mola V20 trbv MBDK01046379.1 1319 VCLGVEVRQSASDIIIKPGEKVQIFCSHEKTNYRVMLWYQQPPGDTAMKLIGYLSYSDATIEDQFKEHFDMSGDLGGDKSKNASLTFKVTERGHSAVYYCAARE