WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Monopterus albus AONE00000000.1 (AONE01) 56 34 2 7 10 3 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Monopterus albus V18 ighv AONE01051609.1 138 VDGQTLTESEPVVKRPGESHTLTCTASGFNFGSSWMAWIRQASGKGLEWVASIEYDSDRIFYSQSVQGRFTISRDNNRNQLYLQMNSLKTEDSAVYYCA
Monopterus albus V17 ighv AONE01051386.1 1714 VYSIDLIQPDSLVVQPGQSLTITCQVSGYSLSSHHTAWIRQPAGNGLEWIGDTHAGYDTYYEDSLKNKFSITLDSSRNTMTLNGQNVQPEDTAVYYCA
Monopterus albus V16 ighv AONE01051386.1 517 VKCEQLTQPASVTVQPGQSLTITCQVSYSMSSYYTAWIRQPAGKGLEWIGMKYTGGSHFKDSLKNKFSITLDSSSSTVTLNRQNVQPEDSAVYYCARY
Monopterus albus V15 ighv AONE01051385.1 1718 VYGQTLTESEPVVKRPGDSHKLTCSASGFNFGGSWMHWIRQAPGKGLEWIAIIHPDGSSHISYSQSVQGRFTISRDNSRNQLYLQMNSLKTEDSAVYYCARD
Monopterus albus V14 ighv AONE01051203.1 656 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYWTGWIRQPAGKGLEWIGYAASGSTPYYKDSLKNKFSISTDSASNTVTLIGQNVQPEDSAVYYCARY
Monopterus albus V13 ighv AONE01051161.1 359 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYWTAWIRQTAGKGLEWIGSASSGSTTHHKDSLKNKFSISTESSSKTVTLNGQNVQPEDTAVYYCARD
Monopterus albus V12 ighv AONE01050924.1 5173 QSMESIPSSSLVKKPGETLSLSCRGSGFTFNCCVMSWIRQPVGKGLEWIGSGYSDASRNYYASSVRGRVETSRDDSNSMVYLRLSNLKPEDSAVYYCARD
Monopterus albus V11 ighv AONE01050924.1 2296 VDGQTLTESEPVVKRPGESHRLTCTASGFNFDGYGMHWVRQAPGKGLEWVYISTASSPIHYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAMYYCVR
Monopterus albus V10 ighv AONE01048955.1 3134 VDGQTLTQSEPVVKRPGESHTLTCTASGFDFGGSYMAWIRQPPGKGLEWLAWQESGSGRNKQYSHSAQDRFTISRDNNRNQLYLQMNSLKTEDSAIYYCARE
Monopterus albus V9 igkv AONE01048550.1 2822 SRGQVTVTQPGAVSSALGASVTISCRVSQNVHNGNWLAWYRQRDGEAPKLLIYYVSTRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Monopterus albus V8 trbv AONE01044584.1 11198 TSPNKSKGVRQTPTDLLRDINDKVKLTCKHSIDSYDTVLWYHRSGRDTSLKLVGYTSYSSVQVVENPYQGHFNVSGNGDSEAFLHLLKLRHPEDSGHYFCAAYI
Monopterus albus V7 trav AONE01044584.1 9716 GYLGIEVHQTPPALIRRPGDKVQLVCTHNQTDYRVMFWYQQPPGQTDMKLIGYLSYTDVKMEKPYEQQFNIIGDLSRNDAKNVSLIFQLTAAEDSAVYYCAACY
Monopterus albus V6 trbv AONE01044584.1 7417 ASLSDQVHQTPADIYKPPGETAKLTCLHIISSYNQMLWYKRSESRQLQLLGYMVGSTAVPEARVPVDMDGSADANANSTLTIKNLSSNSSAVYFCAAR
Monopterus albus V5 trav AONE01044584.1 6421 HSLSKKVHQVPSVILGHLHTSVTISCSHSISSYDTILWYQQSVSDSGLKLIGYAFYNQLTMENPFTNNSFKITGDGSKKAELHLLKLRHPEDSGIYYCAAITHSDS
Monopterus albus V4 trav AONE01043992.1 835 EDKVTQPGGDVTAAVGDTVTLDCTFETDYTGPTLFWYKQEVNSSPQYMLKCYSANVDKAPEFQEDRFNATMNKPSAPLTIQKLQLNDSAVYYCALR
Monopterus albus V3 trav AONE01042229.1 2794 EDKVTQPVGDITAAVGDTVTLNCTFETSYTPYLFWYKQEENDFPKYILRSDTFGSDNAPEFQKDRFNAIMNKPSVPLTIQKLQLNDSAVYYCALQPTVTG
Monopterus albus V2 iglv AONE01037943.1 1446 VSGVTVVTQKPPVMTVRKGETATMDCNLGTVTAHSAVWHKQIPGGVPQYVLKFHHSFSSPTYGSGFSSPKFTSNHQSQSDYRLIINNMEEGDSAVYY
Monopterus albus V1 iglv AONE01037942.1 344 VSGVTVVTQKPPVMTVRKGETATMDCNLGTVTAHSAVWHKQIPGGVPQYVLKFHHSFSSPTYGSGFSSPKFTSNHQSQSDYRLIINNVEEGDSAVYYC
Monopterus albus V0 trav AONE01017023.1 4232 FSLCVKVNQPPSVFSEQDKAVTLQCEQDDELFYYMYWYRQSSSGKIQLVTYSINKGLWSIEAPFNKSKYNMSRPAVLKSSLQIHSVEAGDSAVYYCASSR
Monopterus albus V54 ighv AONE01055564.1 519 VKCEQLTQPASVTVQPGQRLTITCQVSYSVVSSHTHWIRQPAGKGLEWIGGARVGYDTSYKDSLKNKFSITLDSSSNTVTLNGQNVQPEDSAVYYCARD
Monopterus albus V53 ighv AONE01053309.1 1855 VDGQTLTESEPVVKRPGESHRLTCGLTLSSYEMAWNRQAPGKGLEWVAYIHSGGGSTYYSQSVQGRFTISRDNNRNQLYLQMNSLKTEDSAVYYCA
Monopterus albus V52 ighv AONE01052943.1 307 CAGQSMESIPSSSVVKKPGETLSLSCRGSGFTYSCCTMSWVRKPAGKALEWIGVGFSDASRNTYASSVSGRVEISRDDSNSMVNLRLSNLKPEDSAVYYCAK
Monopterus albus V51 ighv AONE01052869.1 601 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGVAQVGQTTYYKDSLKNKFSIDLDSSSNTMTLHGQKVQPEDSAVYYCARY
Monopterus albus V50 trav AONE01052747.1 41 MASMNSIKPQSTEEAVAEGGNITLTCKYEGVINNIQWYQQYQRSRPEFLLYITEGEWIPPAQSDFSAHINSKEKRVDLQIVSAKLSDSAVYYCALQPTVTG
Monopterus albus V49 ighv AONE01052497.1 2612 VDGQTLTQSEPVVKRPGGSHRLTCSASGFTFSSYHMNWVRQAPGKGLEWVAIIHTGSTPIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCV
Monopterus albus V48 igkv AONE01052220.1 1285 SRGQVTVSQPGAASSALGASITIRCKTSQNVAVWNNIHLFAWYQQRNGQTPKLLIFSANTRASGTPSRFTGSGSNSDFTLTISGVQAEDSAVYYCQS
Monopterus albus V46 ighv AONE01052075.1 1049 VDGQTLTESEPAVKRPGESHRLTCSASGFTFSSYHMNWVRQAPGKRLEWVAFIHTQNSHIFYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCVR
Monopterus albus V45 ighv AONE01052036.1 2370 VKCEQLTQPASVTVQPGQRLTITCQVSYSVGSYYTAWIRQPAGKGLEWIGSRRHGGDTYYKDSLKNKFSIDLDSPSNTVTLNGQNVQPEDTAVYYCARD
Monopterus albus V44 trav AONE01051981.1 300 KVTQPEGDVTAAVRDTVTLNCIFETTDKFPTLFWYKQEENSFPQYMLKYYSNTVDKAPEFQEDRFNAMINKPSVPLTIQKLQLNDSAVYYCALQPTVTG
Monopterus albus V43 ighv AONE01051791.1 108 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWMSSDTTVKDSLKNKFSISTDSSSNTVTLNGQNVQPEDTAVYYCARD
Monopterus albus V42 ighv AONE01051790.1 167 VDGQTLTESEPMVKNPGDSHRLTCSASGFTFSSYWMGWIRQAPGKGLEWIALVHTSSSHIFYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCVR
Monopterus albus V41 ighv AONE01051721.1 445 VCSQTLTESEPVVKRPGESHKLTCTYAGISDDSADISWIRQAEGKGLEWVAFISAPSGGTKAYSTSVQNRFTISRDNDMDQVYLHMSSLTAEDSAVYYCARK
Monopterus albus V40 ighv AONE01051721.1 445 VCSQTLTESEPVVKRPGESHKLTCTYAGISDDSADISWIRQAEGKGLEWVAFISAPSGGTKAYSTSVQNRFTISRDNDMDQVYLHMSSLTAEDSAVYYCARK
Monopterus albus V39 ighv AONE01051674.1 4095 VDGQTLTESEPVDKKPGDSHKLTCSASGFTFSSYWMHWIRQAPGKGLEWVAAETGGSSNYYSQSVQGRFTTSRDNSRNQLYLQMNSLKTEDSAVYYCARD
Monopterus albus V38 ighv AONE01051255.1 1495 ADSQTLTESEPVVKSPGESHKLTCTASGFTFSSYKMAWVRQAPGKALEWVATIDVTSKYYSPSVQGRFTISRDNSRNQVYLQMNSLKTEDSAVYYCA
Monopterus albus V37 igkv AONE01051197.1 94 SRGQVTVTQPGAVSSALGASVTINCKTSQNVYNRNWLHWYQQKDGQTPKLLIYAASNQASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Monopterus albus V36 igkv AONE01051197.1 94 SRGQVTVTQPGAVSSALGASVTINCKTSQNVYNRNWLHWYQQKDGQTPKLLIYAASNQASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Monopterus albus V35 ighv AONE01051103.1 1820 VDGQTLTESEPVVKRPGRLTCSASGFTFSSYPMSWVRQAPGKALEWVAYIGTYSSPIYYSQSVQGRFTISRDDSSSKLYLQMNSLKTEDTAVYYCVR
Monopterus albus V34 ighv AONE01051103.1 10257 VDGQTLTESEPVVKRPGESHTLTCSASGFTFSSYHMNWIRQAPGKGLEWVAIIHTGSTLIYYSQSVQGRFTISRDDSSSKVYLQMNSLKTEDTAVYYCVR
Monopterus albus V33 igkv AONE01050985.1 2003 SRGQVTVTQPGAVSSALGASITIRCRVNQNVYNGNYLAWYQEKNGETPRLLFYYVNSRVSGTPSRFDDGGSNSDFTLTISGVQAEDAAVYYCQS
Monopterus albus V32 ighv AONE01050472.1 818 VKCEQLTQPASVTVQPGQYLTITCQVFYSLSSYRTHWIRQPAGKGLEWTGGARAGHPTYYKDSLKNKFSIDLYSSSITVTLNGQNVQPEDTAVYYCARE
Monopterus albus V31 ighv AONE01050472.1 4476 VDGQTLTESEPVVKRPGESHRLTCSASGFRFAGYGMHWVRQAPGKGLEWVAAINANGDSTYYSQSAQGRFTISRDNNRNQLYLQKNSLKTEDSAVYYCARD
Monopterus albus V30 trav AONE01050468.1 4267 EISISVSILIYMMFLCLSCVKNPGDSHKLTCTAFGFTFSDYAMNWVRQAPGKGLEWVATIQVTSTYYSQSVQGRFTISRDNNRNQLYLQMNSLKTEDSAVYYCARE
Monopterus albus V29 ighv AONE01050466.1 2175 VYSIDLIQPDSLVVQPGQSLTITCQVSGYSLTDNSYATGWIRQFEGKPMDWICNRWGGGDFYQKIALKNKFLYHTQTSTSYVTLTGKNLQPEDTAVYYCVRSVWWSW
Monopterus albus V28 igkv AONE01048552.1 1933 SRGQVTVTQPGAVSSALGASITINCKTSQNVYSGNRLHWYQQRDGQTPKLLIYNANTRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQS
Monopterus albus V27 igkv AONE01046964.1 21407 TVTQPPVATTSPGSTVTLTCKTNPKVHTWSSGASNVHWYQQKSGQVPKLLIYNGIHKPSGGGVPARFCGRGDGVNAALTISGVQAEDAAVYYCQSEHEINSADV
Monopterus albus V26 trbv AONE01059358.1 54 ASEAKGVVQTPPFIIKQIGESVASEISCSHSITGYDNILWYKQDKHKALKLLGYLNLNYPYIENDVKEKISFSGDGRQQSGLNISNLLLNDSAVYFCAAR
Monopterus albus V25 ighv AONE01055901.1 411 VDGQILTESEPVIKRPGESHRLTCSASGFTFSSSRLCWVRQAPGKGLEWIAFIHTGSSEIYYSQSVEGRFTISRDDSSSKLYLQMNSLKTEYTAVYYCAK
Monopterus albus V24 ighv AONE01053444.1 30 VDGQTLTESEPVVKRPGESHTLTCTASGLDFGYWMGWNRQAPGKGLEWVALINSDSSGKYYSQSVQGRFTISRDNSRNQLYLQMNSLKTEDSAVYYCARQ
Monopterus albus V23 ighv AONE01052668.1 1367 VDGQTLTESEAVVKMPGESHKLTCSASGFNFGGSWMGWIRQVPGKGLEWIAVTHPDGSSHIYYSQSVQGRFTISRDNSRNQLYLQMNSLKTEDSAVYYCAQE
Monopterus albus V22 ighv AONE01051980.1 2810 VDGQTLTESEPVVKRPGESHRLTCSASGFTFGDYWMGWVRQAPGKGLEWIARISSGSGSSKYYSQSVQGRFTISRDNSRNQLYLQMNSLKTEDSAVYYCARE
Monopterus albus V21 ighv AONE01051890.1 103 VAAQTLTESESVAKNPGDSHKLTCTASGFTFSDYGMNWVRQAPGKGLEWLAYIYIDGGSTYIYYSHSVRFTISRDNNRNQLYMQMNSLKTEDSAVYYCGRD
Monopterus albus V20 ighv AONE01051868.1 2766 VYSIDLIQPDSLVVQPGQSLTITCQVSGYSLTDSSYATGWVRHCEGKPMDWIFDQWGSGEFYQNEALKNKFSYSRDTSAGSVTIKGQNLQPEDTAVYYCVRR
Monopterus albus V19 ighv AONE01051868.1 1331 VKCEQLTQPASVTVQPGQRLTITCQVSYSVSSYYTAWIRQPAGKGLEWIGMKHTGSSYFKDLLKNKFSIGLDSSRNTATLNGQNVEPEDTAVYYCA
Monopterus albus V55 trav AONE01056117.1 95 QRENVLQPGGDVTAAEGQEAMLHCLYNSSSTGPNLYWYRQDGHSRPTFILSRVILDEGNTPDEFKERFSSTLNSTTRSVPLTIQKLQLNDSAVYYCALQPTVTG
Monopterus albus V47 trav AONE01052169.1 86 VDGQTLTESEPVIKQPGESHRLTCSASGFNFGGYSMHWVRQAPGKGLEWVAYIRYDGSSTYYSQSFQGRFTISRDNNRNQMYLQMNSLKTEDSAVHYCARE