WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Nothobranchius furzeri CCSH00000000.1 (CCSH01) 40 16 0 4 8 10 2 0
Nothobranchius furzeri JNBZ00000000.1 (JNBZ01) 44 19 0 6 8 9 2 0
Nothobranchius furzeri ABLO00000000.2 (ABLO02) 3 0 0 1 0 2 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Nothobranchius furzeri V0 trbv CCSH01002072.1 82009 CSFSNQVYQTPSMIYRASGESANIFCSHNIISHNQILWFKQAGKQLIYLGYVYYGDTFPEAGMDVTMGGNADRNQNCTLTVERLNMSSSAVYLCAARYHS
Nothobranchius furzeri V38 ighv CCSH01061833.1 8209 ARGQSLTSSEPVVHRAGEPASLSCQVQGLPLAWLHWIRQKPGKGLEWIGRIDGGTGTIFALSVQHQFSITKDTSQNVVYLSVKSLKQEDSAVYYCARE
Nothobranchius furzeri V37 ighv CCSH01061833.1 9378 VKCEQLTQPASVTVQPGQRLTISCQVFYDFRIYIYATFWIRQPAGKGLEWIGWKSIRDSDYEESLKNKFSIELDPSGKTVTLIGQNMQPDDSAVYYCARE
Nothobranchius furzeri V36 ighv CCSH01061833.1 15332 VKCEQLTQPASVTVQPGQRLTISCQVSYSLTSFRTHWIRQPAGKTLEYICSALIGLFTYLKDSLKNKFSINLDSSSKTVTLNGQNLQLEDSAVYYCARE
Nothobranchius furzeri V35 ighv CCSH01061109.1 163 VKCEQLTQPASVTVQPAQRLTISCQVSYDVRRYATAWIRQPAGKGLEWIGWKSAGDSRHKESLKNKFNIDLDSSSKTVNLIGQNMQPEDSAVYYCARE
Nothobranchius furzeri V34 ighv CCSH01061107.1 1366 WSIIESEPAVINPGESHRLTCTTSGFVFRGSVWVWFRQAPGKGLEWISLVHISSPPIHYSDSVRGRFTISRDDSSSKVFLRMNNVRTEDSVVYYCARETQ
Nothobranchius furzeri V33 ighv CCSH01061107.1 2524 VSGQTLTESEPAVRRPGESHRLTCTTSGIFFSSCWMAWIRQAPGKGLEWVATDANGGTNYYSESVRGRFTVSRDNSREQLFLQMNSLKTEDSAVYYCARE
Nothobranchius furzeri V32 ighv CCSH01061106.1 1113 VKSEQLTQPASVNVQPGQRLTISCQVSYSLSDYWTAWIRQPAGKGLEWIGMKYTGNSHYKESLKNKFSIDLDSSSKTVTLIGQNMQPEDSAVYYCARE
Nothobranchius furzeri V31 ighv CCSH01061104.1 13273 VSGQTLTESEPAVKRPGESHRLTCTTSGISFSSYWMAWIRQAPGKGLEWIAIIENDSDRIFYSESVRGRFTISRDNSREQLFLQMNSLKTEDSAVYYCARE
Nothobranchius furzeri V30 trav CCSH01058429.1 738 AKSLEAEITASRAEVVSSEGSKLHLSCNYSVKAHNLQWYRQDPGSAPRVLLLITDTKEPTVVEGEHPNPRLTAELNEERNRLDLLISSAAATDSAVYYCALQ
Nothobranchius furzeri V29 trav CCSH01058429.1 3269 IRAQTDSVLQEKPEVVAGQGGSVSLSCLYNTSSSNHYLYWYRQEGNNRPQFILSRFKIGEGKNADKEKYSSTLNHEVKSVPLRIQKLHVTDSAVYYCALQ
Nothobranchius furzeri V28 trav CCSH01058427.1 6733 MGSTNKIIQEQSGVVAEGTGISLSCEYDGSIYSIQWYRHQQKSRPEFLLYITEGGSIHPIRSDFSARINKTQKRVDLLISSAAATDSAVYYCAVR
Nothobranchius furzeri V27 trav CCSH01058426.1 2582 AKSLEAEITASRAEVVSSEGSKLHLSCNYSVKAHNLQWYRQDPGSAPRVLLLITDTKEPTVVEGEPPNPRLTAELNEERNRVDLLISSAAATDSAVYYCALQ
Nothobranchius furzeri V26 trbv CCSH01057552.1 5649 QVRSVTFQPSHPKIISIMDNVNIECIHDDSNLVVMLWYQQTEQMSLIGYGYVGSEALTEKDFGSRFTITRKDTLTGSLTISSVNVSDSAVYFCAV
Nothobranchius furzeri V25 trgv CCSH01057552.1 14428 ISLCLEVRQSHSDLITKPGKKVEIFCSHDKTDFWIMLWYQRSPGDTAMNLVGCIYNKAVTLEYKTDFNISGDLSGNTAKNASLIINAAEQKHSAVYYCA
Nothobranchius furzeri V24 trbv CCSH01057552.1 19020 ISLGLEVRQSPSDLFTNPDGKVQVFCTHDKTDFRLMLWYQRSPGDTALKLIGYLYHKAVSMEDQYKDGFDLTGDLGGDATKNGSLLIKHVKPGQSAVYFCAASR
Nothobranchius furzeri V23 trav CCSH01057552.1 28434 HCQDVIQIPEVSWTDVTKSAEMNCSHNRDKSYNQMYWYRQRPGETMTLIVFTVFGGKPDYGQSSQSKYSAVKDSIETGALTVKNVQPDDRGLYFCAVS
Nothobranchius furzeri V22 trbv CCSH01057548.1 939 CVGGGDVEQIPMLWEHHGQDATTECSHTKDGTYYQMYWYQQLPGKTMKQIVFTTPSPPHQYETGFSQDKFPAEKKDAQTGSLTVKNLQPEDSGVYFCAVS
Nothobranchius furzeri V21 trbv CCSH01057548.1 939 CVGGGDVEQIPMLWEHHGQDATTECSHTKDGTYYQMYWYQQLPGKTMKQIVFTTPSPPHQYETGFSQDKFPAEKKDAQTGSLTVKNLQPEDSGVYFCAVS
Nothobranchius furzeri V20 igkv CCSH01055360.1 2452 VIQSEAVKQDAGVRPSTVGENVTLHCFYNSQSAMHFSWYQQMLGGKPKLLSTVYKYDVPSKTLRRLEKTPRFSVQTREGINHLHISDVHLSDAATYYCGS
Nothobranchius furzeri V19 igkv CCSH01034546.1 2938 SDGQHVVTQPAARSVQLGQTVSVDCKVSPPAASDFRLKHDLSWYHQTPGEAPKLLIYSTTIRKSEYPNQFSGRGSGNGADFTLTISAVQAEDAGVYYCQS
Nothobranchius furzeri V18 igkv CCSH01034544.1 1141 SDGQHVVTQPAARSVQLGQTVSVDCKVSPPAALYIPLQNHLSWYHQTPGEAPKLLIYLTSRRFSGISSRFSGSGSRNGADFTLTISGVQAEDAGIYYCQS
Nothobranchius furzeri V17 ighv CCSH01014853.1 6216 TEGQTLTESEPVVKRPGEPHRLTCTGSGFTLSSYGMAWIRQAAGKGLEWIAIIYSSGSVFYSQSVQGRFSISRGNSRNQVYLQMNTLTSEDSAVYYCARE
Nothobranchius furzeri V16 ighv CCSH01014853.1 8783 VKCEQLTQPASVTVQPGQRLTISCQVSYSLSGYWTHWIRQPAGKGLEWIGEGCCGSSTNYKDSFRNKFSISMETSSNTVTLNGQNMQPEDSAVYYCTRR
Nothobranchius furzeri V15 ighv CCSH01014853.1 10899 VKCEQLTQPASVTVQPGQRLTISCQVSYSLSSYGTSWIRQPEGKGLEWIGWKYTGDSSYKESLKNKFSIDLDPSSKTVTLNGQNMQPEDSAVYYCARE
Nothobranchius furzeri V14 ighv CCSH01014852.1 1594 VSGQTLTQSEPVVKRPGESHKLTCTGSGYTFSSYAMVWVRQARGKGLEWITYISRSGDTQFYSQSVKGRFTISRDNNQQQVFLQMNSLKPEDSAVYYCARE
Nothobranchius furzeri V13 ighv CCSH01014852.1 4138 VFSIDLIQPASKAVQPGQSVTITCRLSGYSVTDGYGTGWIRQREGKAPDYIFHMWGSNGDFYQNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVRY
Nothobranchius furzeri V12 ighv CCSH01014852.1 5336 VKCEQLTQPASVTVQPGQRLTISCQVSYSLTSSRTHWIRQHAGNGLEWICNDETIKYSLNDTFSVDLDSSSKTVTLNGQNMQPEDSAVYYCARQ
Nothobranchius furzeri V11 ighv CCSH01014851.1 2394 VSGQTLTQSEPVVKRPGESDKLTCTGSGYTFSSYAMAWVRQAPGKGLEWITYISSGGGTQFYSQSVKGQFIISRDNNQQQVFLQMNSLKPEDSAVYYCARE
Nothobranchius furzeri V9 trav CCSH01063680.1 14013 VKCEQLTQPASVTVQPDLRLTISCQVSYSQRSYMTHWIRQPAGKGLEWIGGKYTGYSSYKDSLKNKFNIDLDSSSNTVTLNGQNRQPEDSAVYYGARE
Nothobranchius furzeri V8 trbv CCSH01048285.1 3341 VIRVEPVTQDTGVRSVAVGENITLHCFCDSLLAMHVSWYRQTLGRKPELLSVIYKYGDTSDTSHQLENNPRFSVQVKNRANHLLISDARLSDSASYFCGSSYS
Nothobranchius furzeri V7 trgv CCSH01038113.1 1815 ISLCLEVRQSHSDLITKPGKKVEIFCSHDKTDFWIMLWYQRSPGDTAMNLVGYIYNKAVTLEYKTDFNISGDLSGNTAKNASLIINAAEQKHSAVYYCA
Nothobranchius furzeri V6 trbv CCSH01038112.1 45311 SLSDKVHQNPAVIVKIPGEKAQIQCSHTITNYDTILWYKQLKNGHLELLGYMYKNFENPEKGVKVTMEGNADKNQTCLLTTEALSLKSSAVYFCAAS
Nothobranchius furzeri V5 trbv CCSH01038112.1 41607 SDVTQSPFVWKQEGEDATMDCSHTKGDLYFQMYWYWQLPGETMRLIVFTSTGISQHDFGDFSKEKFSATKTVAQSGTFTVKNLELKDEGLYFCAVS
Nothobranchius furzeri V4 trbv CCSH01038112.1 38499 ASNTKHVDQTPPYITKKLGESVTSEIKCSHQITNYDLILWYKQDENKALLLLGYLNLHFVTLEDDMKGKIDLTGDGRKESSLVVSDLKLNDSAVYFCAARM
Nothobranchius furzeri V3 trbv CCSH01038112.1 28843 LSLSDQIAQTPPELFINPGKTAVIRCSHSLPNYDRILWYKQSENNQMQFLGHMIGDGAYPETGLNVEMDGDANEDKNCTLTLKEVSLSSGAVYFCAVRYHSAA
Nothobranchius furzeri V2 trav CCSH01014868.1 7026 ADAATVLTQTPAVHTVSTGQQVVLYCNVQRDDVQYVFWYKQVSGGTPQYVLKFYHTHDLPSFGSGFSADQFSSKATSNIDYQFIIKQTEAADSAVYHC
Nothobranchius furzeri V39 ighv CCSH01061833.1 713 VSGQTLTESEPAVRRPGESHRLTCTTSGISFSSWWMAWIRQAPGRGLEWVATDANGGTNYYSESVRGRFTVSRDNSREQLFLQMNSLKTEDSAVYYCARE
Nothobranchius furzeri V10 igkv CCSH01066669.1 294 SRGQVTVTQSAAVSSAVGRSVSISCRTSQGVYIDNSNNRLAWYQQKDGQPPKLLIYGASRRQSGISDRFSGSGSGSDFTLTISGVQAEDAAVYYCQSFHYINSQRL
Nothobranchius furzeri V1 trav CCSH01013107.1 2992 KVVQDEGGVAAEGTSTTLPCTFDKSDYFNVHLFWYKQEENQIPKYALYRDTIGTSNNAPEFSKGRFEAAITGNSVPLKIQRLHVTDSAVYYCAVR
Nothobranchius furzeri V1 igkv JNBZ01020485.1 920 TRGQVTVTQSAAVSSAVGRSVSISCRTSQGVYIDNSNNRLAWYQQKDGQPPKLLIYGASRRQSGISDRFSGSGSGSDFTLTISGVQAEDAAVYYCQSFHYINSQRL
Nothobranchius furzeri V0 igkv JNBZ01020477.1 305 SRGQVTVTQSAAVSSAVGRSVSISCRTSQDVYNNDYLYWYQQKDGQPPKLLIYGATSRQSGISDRFSGSGFGSDFTLTISGVQAEDAAVYYCQSRHYINSQHL
Nothobranchius furzeri V38 trbv JNBZ01078976.1 3458 LLSAVIRVEPVTQDTGVRSVAVGENITLHCFCDSLLAMHVSWYRQTLGRKPELLSVIYKYGDTSDTSHQLENNPRFSVQVKNRANHLLISDARLSDSASYFCGSSYS
Nothobranchius furzeri V37 igkv JNBZ01063253.1 2603 QETHLTASSVHQDSSLVSADVGDSVTLRCSFEGTESAWVYWYKQTLGQKPKLMSSFFIYGSEITFYDEFRNDRFTLIREKQTNSLTISDLKASDSASYYCGI
Nothobranchius furzeri V36 igkv JNBZ01058013.1 817 SRGQVTVTQSAAVSSAVGRSVSISCRTSQDVRGRYLSWYQQKDGQPPKLLVYGAAARQSGISDRFSGSGSGSDFTLTISGVQAEDAAVYYCQSVHKINSQWM
Nothobranchius furzeri V35 trav JNBZ01050751.1 1354 AKSLEAEITASRAEVVSSEGSKLHLSCNYSVKAHNLQWYRQDPGSAPRVLLLITDTKEPTVVEGEPPNPRLTAELNEERNRVDLLISSAAATDSAVYYCALQ
Nothobranchius furzeri V34 trbv JNBZ01045088.1 231 CVGGGDVEQIPMLWEHHGQGATIECSHTKDGTYYQMYWYQQLPGKTMKQIVFTTPSPPHQYETGFSQDKFPAEKKDAQTGSLTVKNLQPEDSGVYFCAVS
Nothobranchius furzeri V33 trbv JNBZ01045088.1 971 CVGGGDVEQIPMLWEHHGQGATIECSHTKDGTYYQMYWYQQLPGKTMKQIVFTTPSPPHQYETGFSQDKFPAEKKDAQTGSLTVKNLQPEDSGVYFCAVS
Nothobranchius furzeri V32 ighv JNBZ01039010.1 3412 ARGQSLTSSEPVVHRAGEPASLSCQVQGLPLAWLHWIRQKPGKGLEWIGRIDGGTGTIFALSVQHQFSITKDTSQNVVYLSVKSLKQEDSAVYYCARE
Nothobranchius furzeri V31 ighv JNBZ01039010.1 4663 ARGQSLTSSEPVVHRAGEPASLSCQVQGLPLAWLHWIRQKPGKGLEWIGRIDGGTGTIFALSVQHQFSITKDTSQNVVYLSVKSLKQEDSAVYYCARE
Nothobranchius furzeri V30 ighv JNBZ01039010.1 5835 VKCEQLTQPASVTVQPAQRLTISCQVSYDVRRYATAWIRQPAGKGLEWIGWKSAGDSRHKESLKNKFNIDLDSSSKTVNLIGQNMQPEDSAVYYCARE
Nothobranchius furzeri V29 ighv JNBZ01039010.1 6893 TEGQTLTESEPVVKRPGEPHRLTCTGSGFTLSSYGMAWIRQAAGKGLEWIAIIYSSGSVFYSQSVQGRFSISRENSRNQVYLQMNTLTSEDSAVYYCARE
Nothobranchius furzeri V28 ighv JNBZ01039009.1 1260 WSIIESEPAVINPGESHRLTCTTSGFVFRGSVWVWFRQAPGKGLEWISLVHISSPPIHYSDSVRGRFTISRDDSSSKVFLRMNNVRTEDSVVYYCARETQ
Nothobranchius furzeri V27 ighv JNBZ01039009.1 2418 VSGQTLTESEPAVRRPGESHRLTCTTSGIFFSSCWMAWIRQAPGKGLEWVATDANGGTNYYSESVRGRFTVSRDNSREQLFLQMNSLKTEDSAVYYCARE
Nothobranchius furzeri V26 ighv JNBZ01039008.1 6467 VKSEQLTQPASVNVQPGQRLTISCQVSYSLSDYWTAWIRQPAGKGLEWIGMKYTGNSHYKESLKNKFSIDLDSSSKTVTLIGQNMQPEDSAVYYCARE
Nothobranchius furzeri V25 ighv JNBZ01039007.1 7092 VSGQTLTESEPAVKRPGESHRLTCTTSGISFSSYWMAWIRQAPGKGLEWIAIIENDSDRIFYSESVRGRFTISRDNSREQLFLQMNSLKTEDSAVYYCARE
Nothobranchius furzeri V24 trbv JNBZ01037242.1 10487 CSFSNQVYQTPSMIYRASGESANIFCSHNIISHNQILWFKQAGKQLIYLGYVYYGDTFPEAGMDVTMGGNADRNQNCTLTVERLNMSSSAVYLCAARYHS
Nothobranchius furzeri V23 igkv JNBZ01020486.1 2180 SRGQVTVTQSAAVSSAVGRSVSISCRTSQDVYVDNSNKLLSWYQQKDGQPPKLLIYDATSRQSGISDRFSGSGSGSDFTLTISGVQAEDAAVYYCQSFHYINSQRL
Nothobranchius furzeri V22 ighv JNBZ01222168.1 5428 QTLTQSEPVVKRPGESHKLTCTGSGYTFSSYAMVWVRQARGKGLEWITYISRSGDTQFYSQSVKGRFTISRDNNQQQVFLQMNSLKPEDSAVYYCARE
Nothobranchius furzeri V21 ighv JNBZ01222168.1 2873 VFSIDLIQPASKAVQPGQSVTITCRLSGYSVTDGYGTGWIRQREGKAPDYIFHMWGSNGDFYQNDALKNKFSYSRDTSAGTVTITGQNLQPEDTAVYYCVRY
Nothobranchius furzeri V20 ighv JNBZ01222168.1 1701 VKCEQLTQPASVTVQPGQRLTISCQVSYDVSDYWTAWIRQPAGKELEWISSDEIIKYSLNDTFSVDLDSSSNTVTLNGQNMQPEDSAVYYCAR
Nothobranchius furzeri V19 ighv JNBZ01222167.1 13 VKCEQLTQPASVTVQPGQRLTISCQVSYSLSGYWTHWIRQPAGKGLEWIGEGCCGSSTNYKDSFRNKFSISMETSSNTVTLNGQNMQPEDSAVYYCTRR
Nothobranchius furzeri V18 ighv JNBZ01075768.1 7626 ARGQSLTSSEPVVHRAGEPASLSCQVQGLPLAWLHWIRQKPGKGLEWIGRIDGGTGTIFASSVQHQFSITKDTSQNVVYLSVKSLKQEDSAVYYCARE
Nothobranchius furzeri V17 ighv JNBZ01075768.1 6775 ARGQSLTSSEPVVHRAGEPASLSCQVQGLPLAWLHWIRQKPGKGLEWIGRIDGGTGTIFALSVQHQFSITKDTSQNVVYLSVKSLKQEDSAVYYCARE
Nothobranchius furzeri V16 ighv JNBZ01075768.1 6246 ARGQSLTSSEPVVHRAGEPASLSCQVQGLPLAWLHWIRQKPGKGLEWIGRIDGGTGTIFASSVQHQFSITKDTSQNVVYLSVKSLKQEDSAVYYCARE
Nothobranchius furzeri V15 ighv JNBZ01075768.1 5071 VKCEQLTQPASVTVQPGQRLTISCQVFYDFRIYIYATFWIRQPAGKGLEWIGWKSIRDSDYEESLKNKFSIELDPSGKTVTLIGQNMQPDDSAVYYCARE
Nothobranchius furzeri V14 ighv JNBZ01075765.1 1155 VKCEQLTQPASVTVQPGQRLTISCQVSYSLTSSRTHWIRQHAGNGLEWICNDETIKYSLNDTFSVDLDSSSKTLTLNGQNMQPEDSAVYYCARQ
Nothobranchius furzeri V13 trav JNBZ01075362.1 14288 VKCEQLTQPASVTVQPDLRLTISCQVSYSQRSYMTHWIRQPAGKGLEWIGGKYTGYSSYKDSLKNKFNIDLDSSSNTVTLNGQNRQPEDSAVYYGARE
Nothobranchius furzeri V12 trgv JNBZ01040768.1 1398 ISLCLEVRQSHSDLITKPGKKVEIFCSHDKTDFWIMLWYQRSPGDTAMNLVGYIYNKAVTLEYKTDFNISGDLSGNTAKNASLIINAAEQKHSAVYYCA
Nothobranchius furzeri V11 trav JNBZ01040764.1 3940 HCQDVIQIPEVSWTDVTKSAEMNCSHNRDKSYNQMYWYRQRPGETMTLIVFTVFGGKPDYGQSSQSKYSAVKDSIETGALTVKNVQPDDRGLYFCAVS
Nothobranchius furzeri V10 ighv JNBZ01032610.1 3751 VKCEQLTQPASVTVQPGQRLTISCQVSYSLTSSRTHWIRQHAGNGLEWICNDETIKYSLNDTFSVDLDSSSKTVTLNGQNTQPEDSAVYYCARQ
Nothobranchius furzeri V8 trgv JNBZ01027705.1 13085 ISLCLEVRQSHSDLITKPGKKVEIFCSHDKTDFWIMLWYQRSPGDTAMNLVGCIYNKAVTLEYKTDFNISGDLSGNTAKNASLIINAAEQKHSAVYYCA
Nothobranchius furzeri V7 trbv JNBZ01027705.1 7018 ISLGLEVRQSPSDLFTNPDGKVQVFCTHDKTDFRLMLWYQRSPGDTALKLIGYLYHKAVSMEDQYKDGFDLTGDLGGDATKNGSLLIKHVKPGQSAVYFCAASR
Nothobranchius furzeri V6 trbv JNBZ01027705.1 747 SLSDKVHQNPAVIVKIPGEKAQIQCSHTITNYDTILWYKQLKNGHLELLGYMYKNFENPEKGVKVTMEGNADKNQTCLLTTEALSLKSSAVYFCAAS
Nothobranchius furzeri V5 trbv JNBZ01027704.1 14470 SDVTQSPFVWKQEGEDATMDCSHTKGDLYFQMYWYWQLPGETMRLIVFTSTGISQHDFGDFSKEKFSATKTVAQSGTFTVKNLELKDEGLYFCAVS
Nothobranchius furzeri V4 trbv JNBZ01027704.1 11368 ASNTKHVDQTPPYITKKLGESVTSEIKCSHQITNYDLILWYKQDENKALLLLGYLNLHFVTLEDDMKGKIDLTGDGRKESSLVVSDLKLNDSAVYFCAARM
Nothobranchius furzeri V3 trbv JNBZ01027704.1 1718 LSLSDQIAQTPPELFINPGKTAVIRCSHSLPNYDRILWYKQSENNQMQFLGHMIGDGAYPETGLNVEMDGDANEDKNCTLTLKEVSLSSGAVYFCAVRYHSAA
Nothobranchius furzeri V2 igkv JNBZ01026339.1 49 SRGQVTVTQSAAVSSAVGRSVSISCRTSQDVYVYNSNDCLSWYQQKDGQPPKLLIYYATIRESGISDRFSGSGSGADFTLTISGVQAEDAGVYYCQS
Nothobranchius furzeri V43 trav JNBZ01225432.1 594 MGSTNKIIQEQSGVVAEGTGISLSCEYDGSIYSIQWYRHQQKSRPEFLLYITEGGSIYPIRSDFSARINKTQKRVDLLISSAAATDSAVYYCAVR
Nothobranchius furzeri V42 trav JNBZ01225427.1 6227 KVVQDEGGVAAEGTSTTLPCTFDKSDYFNVHLFWYKQEENQIPKYALYRDTIGTSNNAPEFSKGRFEAAITGNSVPLKIQRLHVTDSAVYYCAVR
Nothobranchius furzeri V41 trav JNBZ01216638.1 2907 VKCEQLTQPASVTVQPDLRLTISCQVSYSQRSYMTHWIRQPAGKGLEWIGGKYTGYSSYKDSLKNKFNIDLDSSSNTVTLNGQNRQPEDSAVYYGARE
Nothobranchius furzeri V40 trav JNBZ01135505.1 345 AKSLEAEITASRAEVVSSEGSKLHLSCNYSVKAHNLQWYRQDPGSAPRVLLLITDTKEPTVVEGEHPNPRLTAELNEERNRLDLLISSAAATDSAVYYCALQ
Nothobranchius furzeri V39 ighv JNBZ01102275.1 2354 VSGQTLTQSEPVVKRPGESDKLTCTGSGYTFSSYAMAWVRQAPGKGLEWITYISSGGGTQFYSQSVKGQFIISRDNNQQQVFLQMNSLKPEDSAVYYCARE
Nothobranchius furzeri V9 trav JNBZ01031196.1 3942 ADAATVLTQTPAVHTVSTGQQVVLYCNVQRDDVQYVFWYKQVSGGTPQYVLKFYHTHDLPSFGSGFSADQFSSKATSNIDYQFIIKQTEAADSAVYHC
Nothobranchius furzeri V2 igkv ABLO02077707.1 456 SDGQHVVTQPAARSVQLGQTVSVDCKVSPPAALYIPLQYHLSWYHQTPGEAPKLLIYLTSRRFSGISSRFSGSGSGNGADFTLTISGVQAEDAGVYYCQS
Nothobranchius furzeri V1 trbv ABLO02108606.1 1153 LSLSDQIAQTPPELFINPGKTAVIRCSHSLPNYDRILWYKQSENNQMQFLGHMIGDGAYPETGLNVEMDGDANEDKNCTLTLKEVSLSSGAVYFCAVR
Nothobranchius furzeri V0 trbv ABLO02024944.1 232 ISLGLEVRQSPSDLFTNPDGKVQVFCTHDKTDFRLMLWYQRSPGDTALKLIGYLYHKAVSMEDQYKDGFDLTGDLGGDATKNGSLLIKHVKPGQSAVYFCAASR