WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Notothenia coriiceps AZAD00000000.1 (AZAD01) 9 3 0 0 4 2 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Notothenia coriiceps V8 trav AZAD01047460.1 14461 TVTQTPGEVSATEGDTVTLDCTFRTTDKYPYLFWYKQEVNDLPLYILRRDTYGTEENAAEFQKDRFDATLNETSVPLQISSAAVTDSAVYYCALR
Notothenia coriiceps V7 trav AZAD01043189.1 100503 VDGQILTESDSVTKRPGESHRLTCTTSGFTLNSYWMHWVRQAPGKGLEWIAAINGGSVYYSESVKGRFTGSSNNIQQVYLQMSSLTAVDSAVYYCAR
Notothenia coriiceps V6 ighv AZAD01043189.1 101844 TEGQTLTESEPAVKKPGESHRLTCTYSGFSSNIDTAWIRQAAGKGLEWVATISDSSSSIYYSESVKGRFTISRDNNRQQVYLLYLQMNSLKAEDTAVYYCAR
Notothenia coriiceps V5 trav AZAD01028481.1 1211 NSLEDAITASSAEVCSSEGRSVTLSCTYSVKADNLQWYRQDPGSAPQFLLLITDSNPPHVVEAKPPIPRLTATLNQEKKQVDLQISSAAVTDSAVYYCALR
Notothenia coriiceps V4 ighv AZAD01017935.1 2203 VKCEQLIQPASVTVQPGQRLTITCQVSYSLSSYYTAWIRQPAGKGLEWIGMKHTGASFYKDSLKSQFSIDLDSSSKTVTLNGQSVQPGDSAVYYCARDTL
Notothenia coriiceps V3 ighv AZAD01017398.1 54 VDGQTLTESESVTKRPGESHRLTCTTSGYTFSSYWVAWIRQAPGKGLEWIAWIHPTSSSDIYYSESVKGRFTGSSNNIQQVYLQMSSLTAVDSAVYYCAR
Notothenia coriiceps V2 trav AZAD01007412.1 8157 VVLSSLKIQQSPENLLIKPGQQEARLECFHGDDSFPYMLWYRHKSAAGGQPRDMDLIGLLHYENADVEKTFATERFNISGHSKGRAQLTISNMKPADSAEYFCAAR
Notothenia coriiceps V1 trbv AZAD01007412.1 6659 LCLGVEVTQTPAELLMSPGDKVQLVCSHEKTDYTLMQWYQQPPGERALKRIGHLNYDSKEYEEPFKEHFKMSGDLTGGKAKNASLFIDTLKAEEHSAVYFCAASF
Notothenia coriiceps V0 trbv AZAD01007412.1 4547 SSLSDLVSQTPAYMYKNLGEEAVISCSHSIESYNRILWYKQMKDGQLQFLGYILSTQKNPEPGLGVKMDGDANINKNCTLTVEGLSENSSALYFCAAS