WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pampus argenteus JHEK00000000.1 (JHEK01) 2 0 0 0 1 1 0 0
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pampus argenteus V1 trav JHEK01031491.1 772 ESVTFQQSPFKIVRVTDRVEIKCSHNDTNLYVMLWYQQRENGLMILMGYKYDVNPATYEEQFMGQIEIVGESKLRGSLIIHSVNLTDSAVYFCAASTQ
Pampus argenteus V0 trbv JHEK01030318.1 446 QVSAVTFSPSHPQTARHNTDVRISCSHDDTNLQVMLWYQQTGSSLINLIGYSYTGSDPSNEKQFEDRFEITRKDTLTGALIIHNVTLSDSAVYFCAASTQ