WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Paralichthys olivaceus AGQT00000000.1 (AGQT01) 11 3 0 0 3 5 0 0
Paralichthys olivaceus MPLB00000000.1 (MPLB01) 8 3 0 0 2 1 1 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Paralichthys olivaceus V10 ighv AGQT01031904.1 468 VKCETLTQPASVTVQPGQPLTISCQVSYSVSSYYTAWIRQPAGKGLEWIGMKSTGYTFYKESLKNKFSIDLDSSSNTATLKGQNMQPGDTAVYYCAR
Paralichthys olivaceus V9 trav AGQT01037367.1 19771 GISLGVQVDQSPSALIRNAGDAVQLLCTHGQVDYRVMLWYQQSPTDQALKLIGYVEYNQINYEELYKEHFNITGDLSTNTAKNGSLFITDLRATEHSAVYYCAAR
Paralichthys olivaceus V8 trav AGQT01037367.1 8772 FSVCVKIQQPPFVFSHGRETTVTLQCEQDDNLYFNMFWYRQRNSEKIELVAYSQGKDSSTIEAPFNKTKYTMLRPTILSSSLQINSAEAGDSAVYYCASS
Paralichthys olivaceus V7 trbv AGQT01037367.1 4274 VSHSVLITQWPHYISRFPSGSAEMHCYQNDTDYPYMYWYRQQRGKEPQLVVYLAGSSVNFEEGFKSGFEAEIVQKKKWSLKIPSIQEKDEAVYLCAASLHSAVT
Paralichthys olivaceus V6 trbv AGQT01037367.1 848 VSHSVLITQWPHYISRFPSGSAEMHCYQNDTDYQFMYWYRQQRGKEPQLVVYLAGSSANFEEGFKSGFEAEIVQKKKWSLKIPSIQEKDEAVYLCAASLHSAVT
Paralichthys olivaceus V5 trbv AGQT01037366.1 3616 VSHSVLITQWPHYISRFPSGSAEMHCYQNDTDYQFMYWYRQQRGKEPQLVVYLAGSSANFEEGFKSGFEAEIVQKKKWSLKIPSIQEKDEAVYLCAASLHSAVT
Paralichthys olivaceus V4 trav AGQT01037366.1 1091 FCQDVTQYPATSWSDASKSSEMNCNHTKDAGHNQMYWFRQRPGETMTLIVFAVYGGEPDYGKAPQDKYSAIRPNIKSGALTVKNLQPVDSGVYFCAVS
Paralichthys olivaceus V3 trbv AGQT01037366.1 54 SSLSHKVQQSPANIYEKPAKEAKINCSHSIDGYDKILWYKQTDDRQLQFLGYMYADMANPETGAGVKMEGSANKDKKSTLTIEGLSQNSRAVYFCAAS
Paralichthys olivaceus V2 ighv AGQT01036208.1 4535 VFSQTLTESEPAVKRHGESHKLTCTYAGISDDTAAISWIRQAEGKGLEWVAQISAPKGNNKYYSAFVQNRFTISRNNDMDQVYLHMSSLMTEDSAVYYCARR
Paralichthys olivaceus V1 ighv AGQT01036208.1 1589 VDGQTLTQSEPVVKRPEESQTLACAASGFTFSTFKMHWVRQAPGAALEWVTYISPDSAHTLYSQSVRDWFTISRDNRKELHNLQMNGLKTEDSAVYYCVRE
Paralichthys olivaceus V0 trbv AGQT01014328.1 19715 AYETKHIVQTPHSIFKRTGESVDSEINCSHNIENFENILWYKQEQHKAPKYLGYLNLNFQYIEVDIQGKISFNGEGRKYSKLSVSNLSLSDSGVYFCAAR
Paralichthys olivaceus V0 trbv MPLB01000030.1 6164381 AYETKHIVQTPHSIFKRTGESVDSEINCSHNIENFENILWYKQEQHKAPKYLGYLNLNFQYIEVDIQGKISFNGEGRKYSKLSVSNLSLSDSGVYFCAAR
Paralichthys olivaceus V6 trgv MPLB01002994.1 1973 LVTMAAELIQDELSLTSSVGGTASFSCGGTNQCGDYVYWYQKKDTGTFRMIFRVKKRDCSTDFGYSHPQINDFTAVKKDNNCWLNIKKVKSVHSASYYCVCWKST
Paralichthys olivaceus V5 trdv MPLB01001378.1 18529 QTAADTIYPENGLKEVSGTEGESVKLRCNYETTYSGVYLHWYRQDSDLQAPQYLLRKGAQSWSDENIPDKRYESKTTRSSTEITINKLTLADSALYYCAVYAT
Paralichthys olivaceus V4 trav MPLB01000221.1 174595 QVSAVTFQQSLPQIVKEKTVVQINCSHNDNNLLTMLWYQQRQGHLSMTLIGYGYAKSPPNYEGQFEDQFNLTRADTTKGALIIKRANLSDTAVYFCAASTQ
Paralichthys olivaceus V3 ighv MPLB01000055.1 1424204 VFSQTLTESEPAVKRHGESHKLTCTYAGISDDTAAISWIRQAEGKGLEWVAQISAPKGDKKYYSAFVQNRFTISRNNDMDQVYLHMSSLMTEDSAVYYCARR
Paralichthys olivaceus V2 ighv MPLB01000055.1 1427152 VDGQTLTQSEPVVKRPEESQTLACAASGFTFSTFKMHWVRQAPGAALEWVTYISPDSAHTLYSQSVRDWFTISRDNRKEQHNLQMNGLKTEDSAVYYCVRE
Paralichthys olivaceus V1 ighv MPLB01000220.1 182972 VKCETLTQPASVTVQPGQPLTISCQVSYSVSSYWTAWIRQPAGKGLEWIGMRHTGASYYKESLKNKFSIDLDTSSNTATLKGQNMQPGDTAVYYCAR
Paralichthys olivaceus V7 trav MPLB01003153.1 1181 FSVCVKIQQPPFVFSHGRETTVTLQCEQDDNLYFNMFWYRQRNSEKIELVAYSQGKDSSTIEAPFNKTKYTMLRPTILSSSLQINSAEAGDSAVYYCASS