WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Periophthalmodon schlosseri JACM00000000.1 (JACM01) 28 3 0 8 13 3 0 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Periophthalmodon schlosseri V18 trbv JACM01046776.1 743 AKGIIFDPSSPMIVNQATGVEINCHHDDNNMDVMLWYKQLQNGQLKLIVYSYTGSSPNFEKDFEENFDMKRPDTQTGVLSIFSVKPSDSATYFCAARAQ
Periophthalmodon schlosseri V17 igkv JACM01042654.1 1315 CSGQVTVTQPPVQMFTPGSTVTLTCKINTDVYKYTSGEWPMFWYQQKHGQSPKLWIKLATQRLSATPSRFSGSGSHRDFSLTITGAQAEDAAVYYCKCVHSGPV
Periophthalmodon schlosseri V16 trav JACM01042261.1 3363 LVMGTYKTVNQDGGLKVAQVGDSVTLRCSCADDKMTFFSWYQQKLGGKPELISKWLKGTKHATVERAFQQRFRIFRTEHKKETNNLKITDVQTNDSASYFCVVEV
Periophthalmodon schlosseri V15 trav JACM01039560.1 1621 ICLASVQIHQSPSDVFKNPGEQIEIVCSHERTNYYMMQWYQKLSGDLSMKRIGHIRYESKDYEEPFKKHFEFTGDLSKPTSKKASMIIKDLQPEHSAIYYCAASD
Periophthalmodon schlosseri V14 igkv JACM01020558.1 682 CSGQVTVTQPPVQMFTPGSTVTLTCKTNRDVYSNSNGWHMHWYQQKPDQAPKLWIKLATQRLSETPSRFSGSGSGRDFSLTITGAQAEDAAVYYCQSLHNNPWL
Periophthalmodon schlosseri V13 igkv JACM01019579.1 1986 CSGQVTVTQPPVQMFTPGSTVTLTCKINTDVYKYTNGEWPMFWYQQKPGQSPKHWIYWANRRASGIPSRFSGSGSHRDYSLTITGAQAEDAAVYYCKC
Periophthalmodon schlosseri V12 igkv JACM01007155.1 4931 ICLASVQIKQSPSDVFKNPGEQLDIVCSHEKTDYYMMHWYQKLPGDLSIKRIGHIYHNSKDYVESFKKHFQFTGDLSGGKAKKASMIIQDLQPEHSAIYYCAASD
Periophthalmodon schlosseri V11 trav JACM01007154.1 8611 VCLAVNIQQSGRMQHKIGDSTTCHCIHDQNDHHYMYWYKHSISESNMQLVAYSAGKATVTTESGFDKSRFSLFRPSTFEFILIINKVTQEDSAVFYCATSR
Periophthalmodon schlosseri V10 trav JACM01007154.1 12398 AEAITFDPSHPRIVKDSTEVEIKCHHDDSGMSVMLWYKQLHDGQMKLIVYSYTGSNPNFEKDFENRFKMERTDIQTGTLIISSVDPNDSATYFCAAS
Periophthalmodon schlosseri V9 trav JACM01069376.1 1535 EDTVTQSTGDASVTQGNTAKIECSVQTSEYVNYYFFWYRQKYQDTPEYVLQRSTVGTQHNSQHFNKPKFDAELKENSFSLKIQDVDVTDSAVYYCAVK
Periophthalmodon schlosseri V8 trav JACM01069376.1 259 EDTVTQSTGDASVTQGHTATILCTFEAGSTNPTLFWYKQDGHKSPKYILRNYKAGASWISYKSDELNKARFDTKNQGNSSVLKIQDVDVTDSAVYYCALQ
Periophthalmodon schlosseri V7 trbv JACM01055657.1 2496 GCLGLKVHQSVSNVIKKPNETVQIYCSHERTDYRLMLWYQQPSGDTTLKLIGYLYYKAVTMEKQYETLFSISGDLEGTTTKNGSLSVQLEGPEQSGVYFCAASK
Periophthalmodon schlosseri V6 trdv JACM01054809.1 274 KSIYDQIYQTPRDLIKFSEESINNELKCSNAITSYDLTFWYKQDKDGTITLLGFMNLKFPTIEDAVKDKITITGDGSSDTSLSISDLTVEDSGVYYCAPS
Periophthalmodon schlosseri V5 trav JACM01053649.1 11629 TANADADVMQKQLLWTKEGDDATVDCSQRKGPTYYQMYWYRQRPGENMRQIVFTIPSGEPDFEKDFKNKRFKATKPNAENGTLTVENLEPGDSGEYFCAVS
Periophthalmodon schlosseri V4 igkv JACM01042368.1 2518 VTVSQAGAVRAALGDTANIRCTVSQNVHYHSRYGHCLHYLHWYQQRDGEPPKALVKFASTRASGVSSRFSGSGSGSDFTLTISGVQPEDHTVYYCQS
Periophthalmodon schlosseri V3 igkv JACM01029023.1 3143 ISLTQTPKDAAVDTGASVTMSCESSSPVGNSIAWYLQKGTKAPKLLIYGATTPYTGVPSRFSGSGSGSDFSLAISGFQPEDEGVYYCEQYRRYP
Periophthalmodon schlosseri V1 trav JACM01019216.1 182 CKGNTVTQSTGDASVTQGNTATILCNFQRNSGRHYYLFWYRQKYGDFPKYILRRDTYGTEDNSPEFNKPNFDAELKENSIFLKIQDVDVTDSAVYYCALR
Periophthalmodon schlosseri V0 trbv JACM01009786.1 217 AAVKFQQSSSIIANQSAQVSIKCSHDDSSLTVMLWYQHRPDTQSMMLIGYNYVGSESYENELDKQFKMERPAVLTGSLTLLSASPSHSAVYFCAAS
Periophthalmodon schlosseri V26 trav JACM01074201.1 538 QSKYAVTQTPKDIITAPVKDIQIDCSHSNPDFDTIQWYKQTIGLTDLTLIAYVRFTSLVVENTFETLYEVSGSGSSRSSLHVLNVKTTTDSAVYFCTAS
Periophthalmodon schlosseri V25 igkv JACM01073044.1 183 CSGQITVTQPPVQTVTPGSTVTLTCGVNRDVHKYADGDSDMFWYQQKPGQAPKLWIKYATQRLSETPSRFSGSGSGRDFSLTITGAQAEDAAVYHCQSYHSGPV
Periophthalmodon schlosseri V24 trav JACM01065711.1 838 TQNVSQTPLEVIKFVGDSTNEMKCSHKDSKFDDILWYKRDKSATFKFLGFLVKKNAYPEDDVKDHINFFGNGGSDATLSIRNLTVEDSAVYFCAAR
Periophthalmodon schlosseri V23 igkv JACM01064783.1 679 SSGEISLSQTPKAAAVDKGASVTLRCQASTGITDDLAWYLQKDTEPPKLPIYEATGRHSGVSSRFSGSGYGTDFSLTISGFQPEDAGVYYCQQYY
Periophthalmodon schlosseri V22 trav JACM01058157.1 5378 DTVTQSTGDASVTQGHTATIQCTFQRNSGTSYYLFWYRQVYGDFPKYILRRDTYRTEDNSLEFNKPKFDAELEGNSFSLKIQDVDVTDSAVYYCAVR
Periophthalmodon schlosseri V20 trav JACM01049497.1 2609 VSAVTTVTQRPDVLTVRRGETASMDCNLGTVTRSAARWYKQIPGAAPKHVLRFRHSWNHVEYGSGFSAPKFTSNHQSQTDYRLIINNVDGVDSAVYYCKTWDGSAN
Periophthalmodon schlosseri V19 ighv JACM01048189.1 457 VKCETMTQPASVTVQPGHTLTISCTVSYSVSSYYTAWIRQSAGKAMEWIGMKYTGGSYYKDSLKNKFSINVDSSSNTVTLNGQNMQPGDTAVYYCARE
Periophthalmodon schlosseri V27 ighv JACM01080069.1 351 TVDSVELLQPGSVLLQPAQALTISCRVSGYSLTDSNYATGWIRQREGKLEWIFEQWGGSSGSFYQNDALKNKFSLSRDTSAGTVTIQGQRLQPEDSAVYYCVR
Periophthalmodon schlosseri V21 trav JACM01049497.1 2609 VSAVTTVTQRPDVLTVRRGETASMDCNLGTVTRSAARWYKQIPGAAPKHVLRFRHSWNHVEYGSGFSAPKFTSNHQSQTDYRLIINNVDGVDSAVYYCKTWDGSAN
Periophthalmodon schlosseri V2 ighv JACM01023603.1 348 VKCETLTQPASVTVQPGHTLTISCTVSYSLGYYTAWIRQSAGKGLEWIGMKNTGGSYYKDSLKNKFSIDLDTSTKTVTLNGQNMQPGDTAVYYCARE