WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Leucoraja erinacea AESE00000000.1 (AESE01) 52 2 1 1 17 16 5 10
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Leucoraja erinacea Vs14 trgv AESE010089406.1 874 ISAAQILTQSQLSITKGPTKPVHFYCEVGNIDLEEAVIHWYRQRPGEGLQRLLYFKTAYEYQKDVAEERFTASKISEKNSCTLLLTNIRADDAGTYYCAYW
Leucoraja erinacea Vs177 trbv AESE010638481.1 575 AISVTVQQTPDALSCSPEQKMEVKCIVKEGSGSTYRFWYRQYPGAGPHILFSSVGKGNVQPDNSVDGVKAERPNLNEFYLKSSGLEANSSAVYFCAWS
Leucoraja erinacea Vs231 trav AESE011615156.1 388 ARGADSLSQYPPQLTTAEGQTVTLNCSYPASMAADTIFWYIQSSTEAPRYTLRIFTAGQQDRLPDRFSAVYRKEDRMVLLSISGARVSDSAVYLCAMN
Leucoraja erinacea Vs159 trdv AESE010148166.1 646 GGDGDSVTQSPPASWKTEGEPVTLSCTYDTALGYYVLSWYRQNPIKQLQLILAKSSNGGEENADFAKPRFSADLLTGAKVTKLTISELQLSDSAVYFCALS
Leucoraja erinacea Vs233 ighv AESE011681920.1 535 AASVPVLNQPGAAAVQVGGNIRFSCEMTGGSIDSHVMYWYRQRPGKGLEWTTRYYDSTNIQYAPDVQGRHKATSSNSNLYLHVNPVRVEDLAVYYCAA
Leucoraja erinacea Vs132 trbv AESE012606511.1 908 AISVTIDQTPEALSSFPNEKVEVKCIVKDGSSSNYMCWYRQYPGAGPQILFSSAVQGNVQPDNSVDGLKAERPNLNEFYLRSSVLEAKSSAVYFCAW
Leucoraja erinacea Vs133 trdv AESE012619032.1 390 TFSQQVLQSPPAVSRMECQSVSITCRFTNDAAAGYKLERWLVFRKAESDANRELVLPGGRFVAATSATENPFTLKILLLRIEDSANYYCKAQYRDW
Leucoraja erinacea Vs150 trgv AESE010077117.1 991 CCASQSLIQLKASNTRSKGKTARFRCVINTEDDFDGLQVHWYRNAVSGGMQRILYISVKSEPVRDPGFGDKFFAENLSKEKASLLDIRDIDESDAGDYYCAHWK
Leucoraja erinacea Vs27 trav AESE010210020.1 222 TSGRDSVTQRPHESTIKEGGNTILNCSHTLASIFIFWYIQHPRGFPKFLLKVYISGKVRRCPNCPTRFTAEWQNKKKTAQLILSGALVPDTAVYICATM
Leucoraja erinacea Vs69 trbv AESE011488090.1 245 ATSVTVNQFPGALTGSPGRYVEVTCILPDSTSVYMYWYRQNPGQGPHNLFYSIAAGIVQPTSPVDGFTAERPTGNEFSLKSSVLEANASAMYFCAWD
Leucoraja erinacea Vs68 trbv AESE011487212.1 1998 ATSVTIHQTPDALTVSPGQKMEVECTIEGGSGTENMYWYRQYPGVGPQNMFYSIGAKTVQPEGQVDGFSAKRPDSKHFHLTSAGLEANSSAQYFCAWS
Leucoraja erinacea Vs23 trav AESE010164913.1 432 ARGDDSMSQYPPEVTVEEGQTVTMQCTYPAANIDNTAFWYIHYPGNAPVYILRRFSTGGGDRSPGFTERFSAVRHKANRTVPLTISSVLVSDSAAYLCAMT
Leucoraja erinacea Vs21 trbv AESE010130382.1 1986 ATSVTIDQTPDALSECRGQKMEVKCTIEGGSGAENMYWYRQYPGVQPRNLFYSMGANNVQPEGDVDGFTAKRPNNKEFYLKSDGLEANSSAQYFCAWS
Leucoraja erinacea Vs62 trbv AESE011057164.1 144 ATSVTIHQTPVALSGSPGQKMEMECNIEGGSGAEYMYWYRQYPGFGLQDMFYSIGVNNVHPDGQVNGFTAKRTDAKKFHLKSAGLYANSSAQYFCAWS
Leucoraja erinacea Vs67 trbv AESE011484164.1 5818 VSCNDDIVQLPTSLGVREGEPAKMDCSQAGNIRNNMLWYLQKRGGGLTLIASVYINSEARLEESVKGRFVVTRTMENKKSTLEIHMVKREDGAVYFCGATDG
Leucoraja erinacea Vs160 trbv AESE010158063.1 812 ATSVTIHQTPVALSGSPGQTMEMTCTIEGDSGTETMYWYRQYPGVGPHNLFYSMTAKTVQPEGQVDGFTARRPANNEFYLKSIGLDAKSSAQYFCAWS
Leucoraja erinacea Vs4 trgv AESE010052181.1 202 GCLAQTLTQPKGSLTSSAGKTVRVWCQVNDVQISDTNPIHWYQQKAGQPIARILYFGNSVERDPGFGTSFNGGKTTDTAFYLAIELTADKSATYYCACWV
Leucoraja erinacea Vs6 trgv AESE010057984.1 723 ECLAQTLIQHKASLSKPAGKTGRIGCQVNGTRISSSNPIHWYQQKPGQSLTRMLYFTDSTTWDEGFGNSYKIEKNTDSEFYLIIERLTAEQSATYYCAYWL
Leucoraja erinacea Vs185 trdv AESE010669088.1 318 PNHGDTVTQSLPSAQKVEGESVTFSCTYDTAETYYDLFWYRHHQDSRPEFILKKYSHGNVEKAGFAGARFSFQLQTDRKLVSLTLSGLELSDSAVYYCAFS
Leucoraja erinacea Vs183 trbv AESE010663097.1 555 SCWADEIQQSPNSLSVREGESGEMSCVQTGTVRDNVLWYRQTEGAGLALIGNVYSGLEPQYEKGFQSGFLISAKAGNKRFNLQIRSVTDGDEARYFCAAKEG
Leucoraja erinacea Vs49 trbv AESE010677469.1 820 ATSVTIHQTPVALSVSPGQKMEMKCTIEGGSGAEYMYWYRQYPGVGPHNLFISLGVKNVQPEGEVDGFTANRPSNKEFHLKSAGLGGNSSAQYLCAWS
Leucoraja erinacea Vs103 trdv AESE011718609.1 126 LERKSSVHQNPRVQFADAGRRVTLKCVYSGYCHFAVSWYRHSPGQAPMYLLSTLTSGAEGEDEDPGDRFVALHEPSENMVLLEIPKPQISDTAVYHCALQPR
Leucoraja erinacea Vs248 trav AESE012130145.1 310 YCRGDAVSQTPAGVTVSEGDDTKMSCNYTATSAPSAGLIWYRQYPGGSLEFLLLRTTYKGGEKNNAGDRFSAELNHSTGTVPLTVSQTRLRDSAMYYCALN
Leucoraja erinacea Vs249 trdv AESE012201458.1 360 PNHGDTVTQSLPSAQKVEGESMTFSCTYDTAATGYDLFWYRHHQDSRPEFILYKYSGGTEKKADFAGDRFSAQLQTDRKLVSLTLSGLELSDSAVYYCAFS
Leucoraja erinacea Vs129 trav AESE012565638.1 354 VGEESMSQSPAALRAEEGLDVTLNCNYSTKFTSNTFFWYTHYPGHAPRYLLKGFRDGLAQPAPDISNRFSAFLHEESKTFPLNISRIRLSDAATYYCAMA
Leucoraja erinacea Vs57 trbv AESE010872253.1 1167 TTSVTVRQTPDALSIFPDQKVVMHCIVDGGSSSNYRYWYRQYPGAGPQMLFYSAGEGNVQPDNSVDGLKAERPKPNEFYLKSSRLETKSSAVYFCAW
Leucoraja erinacea Vs53 trbv AESE010731317.1 185 ATSVTVNQFPGALTGSPGRYVEVTCIVPDSTSGDMYWYRQNPGQGPRSLFYSIAAGSVQPTTPVDGFTAERPTGNEFPLKSPVLEANASAMYFCAWS
Leucoraja erinacea Vs163 trav AESE010173982.1 1036 ICEESVYQSPAALMAEEGQDVTVRCSYSTTYTTNNLFWYFQYPGEAPEYVLKGYTDGLAVPSSDAPDRLSAVLHRGSKTFPLNISRIHLSDTVTYYCAMR
Leucoraja erinacea Vs51 trav AESE010683587.1 351 VHGEDSMSQYPPQMMTEEGQTVTLNCSYPTSVAANTVFWYTQRSADAPRYIIKIFTTSDTRRSTDTSDRFSLVYDKEKRMVPLSISGARVSDSAVYLCAMR
Leucoraja erinacea Vs204 trdv AESE010969272.1 360 PNHGDTVTQSLPSAQKVEGESVTFSCTYDTAATSYFLFWYRHHQDSRPEFIVRKHSGGTEEKADFAGDRFSAQLQTDRKSVSLTLSGLELSDSAVYYCAFS
Leucoraja erinacea Vs90 trav AESE011624643.1 386 AHFQSILEQTPAEVLAAKGERLELKCSGKGPLGRLFWYRLDDNAVSQLVISVDIMRVIRRGSGISDRFHLVESSISRYFSLVIKNLSLADNGTYHCLMLT
Leucoraja erinacea Vs91 trav AESE011631786.1 277 VVGQTVQIWQSPSRYVAAERSSLALNCTVSVSSSFLQWYRLSPAGHLQLLATGLHRNVSAGRISATFDQALRYSGLTVRDVDTTDEAIYICAVV
Leucoraja erinacea Vs202 iglv AESE010922714.1 421 LNAEITLTQVPSISQSPGTTVKITCTLSGGSIGSLYTSWYWQKPDSSPVFVWYEGSTRGTGIPDRFTGSVDSSTNQMHLTITNVQSEDAADYYCAVWDGSNNK
Leucoraja erinacea Vs126 trbv AESE012552295.1 945 AISLNVHQTPDALSSSPDQKVEVKCIVEDGSSSSFRYWYRQYTGAGPQILFSSAGEGNVQPDNSVDGVKAERPNINEFYLKSSRLEANSSAVYFCAWS
Leucoraja erinacea Vs13 igkv AESE010089406.1 79 GYSANDLQQPQMSITKPVATTVKIQCLAKGLDDIHWYQQRSDQAPRRILRYSKGESERDQGIPAKFSAEGSDSTFSLVIDNTDLSDAATYYCAGWV
Leucoraja erinacea Vs30 trav AESE010213285.1 285 ARGEDSVTQVPPEVMGEEGQTVTLSCSFPAAYNNYNAIWYVQYPGGAPRYILKKFSTGNGGRSPGFTDRFSAVYHKANRTVPLSISGVLVADSAVYLCAMT
Leucoraja erinacea Vs31 trdv AESE010215032.1 93 DIRGESVRQPQTELSVAEGNSVKIQCSYTAGTNNPDLYWYRQQADQAPEFILYRDNSNKADADFAKERFAADQTNAGRNIPLTITKAELQDAGLYLCALR
Leucoraja erinacea Vs32 trdv AESE010223442.1 23 SNHGDTVTQSLPSAQKVEGESMTFTCTYDTAATSYILFWYRHHQDSRPEFILWKASGGTEKKADFAGNRFSAQLQADRKLVSLTLSGLELSDSAVYYCAFS
Leucoraja erinacea Vs15 trav AESE010092404.1 577 SVEQLVGEIMSEEGCNINLTCTLKTTDPYPYVYWYIQRPGQPPYYLLQITRGTQTGTRYLTDRISSTFNKTAKNTELTIRKSVISESAVYFCVMN
Leucoraja erinacea Vs70 trbv AESE011490155.1 1027 VNSVTVSQNPTTFSRDPGNALELRCTAEGGSDSDYMYWYGQSAGGGLRDLFYSISQTHVEPKETTNGLSAVRTKNRLDLMFTSLVANDSALYFCAWR
Leucoraja erinacea Vs38 trav AESE010271346.1 86 ARGEDSMTQYPPELTAEAGQTVTLNCSYPKAFGAGTAFWYIQYPGEAPRYLLKIFSAGSEGFPARFTGAYRKDSRAVPLSISSVLVSDSAAYLCAMS
Leucoraja erinacea Vs76 trbv AESE011518979.1 998 ATSVIVHQTPGALSDSPGHNVEVKCTIEGSSNTADRLFWYRQYRGEGPQNMFYSFGENSVQSSKSADGFTAERPGSHEFYLRSSDLKADATAEYFCAWS
Leucoraja erinacea Vs198 trav AESE010871219.1 499 ARGDDSMSQYPPQMTTEEGQTVKMNCSYPTTMTAYPVIWYLQDPAEAPRYILKVFTDGTEDRPPGASDRISAVYRKGERMVHLSISGVRVSDSAVYLCSMS
Leucoraja erinacea Vs199 trdv AESE010872250.1 310 PNHGDTVTQSLPSAQNVEGESVTFSCTYDTAETYYDLFWYRHHQDSMPEFILYKRSNGNEDKADFADARFSSQLQTDRKIVSLTLSGLELRDSAIYYCAFS
Leucoraja erinacea Vs189 trgv AESE010710999.1 568 RCLVDGITQPQMSLVSMASKSVTIACDMNETSVIHWYRQPTGQAPVRILYYESGVNNRDDGFGDRFTARLVVTGQYSLTVDALKRDDSATYFCAYWD
Leucoraja erinacea Vs190 trdv AESE010712699.1 801 HGRADSVTQSPPLAVKTEGEAVTLECTYKTPGAYRIYWYRQMPGSEPEFTLRKDSDSYERKAEFAKSRFTVELRTESKFISLTISDLELSDSAVYYCALS
Leucoraja erinacea Vs195 trav AESE010792104.1 416 SYGEEFMSQYPPELTVVEGQAVILHCNYPKSSNNDVAFWYIQNGGQAPKYLLKKFSAVSGDEARDLPVRFSAAYHKGNLSIPLSITGVPVSDSAVYLCSMR
Leucoraja erinacea Vs168 trav AESE010213669.1 305 TSGEELVTQDPPELTAEEGQVIVMNCSYSRAGDTIVWYSQHGEESPKYLLKIYASGKVEQSDDCPDKFTAAVEKSNKLSRFTISQVHVSDSAAYLCAMM
Leucoraja erinacea Vs84 trbv AESE011569746.1 3978 AISVTIHQTPGALSIYPDQKMELTCIVEGGSSSNYRYWYRQYPGAGPHILFSSAGEGNVQPDNSVAGLRAVRPNVDEFYLKSSGLETNSSAVYFCASS
Leucoraja erinacea Vs87 ighv AESE011608274.1 373 TSSDGDLVLTQPASAMLNDGDAHLIQCHVAGGDIIDRVMFWYRQRPGKSLEWVVRYFDSSSVSYAPEIRGGFKCTADRSNLYLEIRLAGVDDIAVYFCAA
Leucoraja erinacea Vs250 trav AESE012327994.1 342 NCRGDAVSQTPATVTVSEGEDTILSCNYTATSTTTPGLIWYRQYTGGSLEFLLLRTTYKGGEKNNAGDRFSAELDHSTGTVPLTVSQTRLRDSASYYCALN
Leucoraja erinacea Vs97 trav AESE011661732.1 234 GNGDDSMSQYPPKLTVEEGQMVTMTCIYPASYNHNTAFWYIQYPGNAPRYALKKYNSERGDRSPDFTERFSADYQKTNRTVPLTISGVVVSDSAVYLCAME