WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Periophthalmus magnuspinnatus JACL00000000.1 (JACL01) 28 10 0 2 12 3 0 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Periophthalmus magnuspinnatus V27 trbv JACL01066279.1 26 QSKYAVTQTPKDIITAPVKDIQIDCRHSNSDFDMIQWYKQTIGLTDLTLIAYARFASVVVENTFKTLYEVSGSGSSRSSLHVLNVNTTTDSAVYFCTAS
Periophthalmus magnuspinnatus V26 trbv JACL01055579.1 1500 QVEGSDVTQMELIWEKEEKEAMMTCSHTKGAGYSQMYWYRQLPGEAMRLVVFTLYGKNDHDFGEFNKEKYSAHRPNAESGTFTVKDLKPADKAMYFCAVS
Periophthalmus magnuspinnatus V25 trav JACL01053816.1 176 ICFASVQIHQSPSAVFKNSGEQIEIICSHNRTDYYMMHWYQKLPGDLSMKRIGHINYGSKDYEESLKKHFEFTGDLSGEKAKRASMIIKDVQPEQSAIYYCAASD
Periophthalmus magnuspinnatus V24 ighv JACL01051727.1 1249 VKCETLTQPASVTVQPGHTLTISCTVSYSVSSCRTHWIRQPAGKGLEWIGGHHAGHSMHIKETLKNKFSVNLDTSSNTVTLSGQNMRPGDTAVYYCARE
Periophthalmus magnuspinnatus V23 ighv JACL01051727.1 2393 VKCETLTQSLCVTVQPGHTLTISCTVSYDVSSYYTAWIRQPAGKGLEWIGDEENTKDSLKQKFAVDLDTSTKTVTLRGQNMQPGDTAVYYCARR
Periophthalmus magnuspinnatus V22 ighv JACL01051727.1 4315 VKCETLTQPASVTVQPGHTLTISCTVSYSVSSYWTHWIRQPAGKGLEWIGYLRAGDNMYLKDSLKNKFSINAVSSSNTVTLSGQNMQPGEAAVYYCSRD
Periophthalmus magnuspinnatus V21 ighv JACL01051727.1 5238 VWTEIRLEQESSLVKRAGESVKMSCVTSGFSMTSYYIHWIRQRPGQGLEWIGRMNAGSNDAIYASAFQQRFTLTENVPSSTQYMEITGLTAEDTAVYYCARR
Periophthalmus magnuspinnatus V20 trav JACL01049255.1 9077 EDTVTQTQGDASVPQGHTATIQCTFKTLDSNPGLFWYKQENGGFPKYMMRRFKSGFADNSQEFKKPKFDAELMGTSFSLKIQDVDVTDSAVYYCALQPTVTG
Periophthalmus magnuspinnatus V19 trav JACL01046939.1 2805 ICFASVQIHQSPSDVFKNSGEQIEIVCSHNKIDYTMMHWYQKLPGDLSMKRIGHIRYESKDYEESLKKHFEFTGDLSGEKAKRASMIIKDVQPEQSAIYYCAASD
Periophthalmus magnuspinnatus V18 trav JACL01046938.1 1551 FCLALNIRQFRLQMNYPFNGDSTSLHCNHDQRDHDYMFWYKHSISENNMQLVAYSVKDLVSSIECALDKSTFTVLRPSGHDSILIINNVTKEDSAVFYCATSQ
Periophthalmus magnuspinnatus V17 trav JACL01046938.1 6795 AITFDPSDPRIVKDSTEVQIKCHHDDSGMNVMLWYKQLHDGQMKLIVYSHIGADPDFEKDFKKRFAMRRTDIQTGALIISNVEPNDSATYFCAAS
Periophthalmus magnuspinnatus V16 trav JACL01043236.1 2851 QVEGSDVTQMELIWEEEGKEATMTCSHTKGATYSQMYWYRQLPGEAMRLVVYTMFGKKDHDFGEFNKEKYSAHRPNAESGTFTVKDLKPADKAMYFCAVS
Periophthalmus magnuspinnatus V15 trav JACL01043236.1 6785 AANADADVMQKQMLWTKEGDDATLDCSHRKGPTYYQMYWYRQRPGENIRQIVFTTPSTEPDFETDFKNERLKVTKPDAESGTLTVENLEPGDSGVYFCAVS
Periophthalmus magnuspinnatus V14 trav JACL01043236.1 19694 AITFDPSDPRIVKDSTEVQIKCHHDDSGMNVMLWYKQLHDGQMKLIVYSYTVGHPAFEKDFKKRFAMRRTDIQTGALIISNVEPNDSATYFCAAS
Periophthalmus magnuspinnatus V13 trav JACL01043236.1 20792 ATAIIFDPSSPKTVHQNTSVEINCHHDDNNMEIMLWYKQLQNGQLKLIVYSYIGFSLDFEEDFQENFGMKRPDTQTGTLSIFNVILSDSATYFCAARTQ
Periophthalmus magnuspinnatus V12 trav JACL01022788.1 10840 EDTVTQTQGDASVPQGHTATIQCTFKTTSTTAYLFWYKQEGRGAPKYMMKKTRSSSNWLKTFKSEEFNEERFRVLAEKDSFSLKIQDVDVTDSAVYYCALR
Periophthalmus magnuspinnatus V11 ighv JACL01059783.1 191 VQAQSLTSSEPVVTSPGQSVSLSCKVTGLPLAWLHWIRQKPERGLEWIGRIDSGTGTIFAQNVQGQFSITKDTSTSTVYLQFNSAKEGDTAVYYCARE
Periophthalmus magnuspinnatus V10 igkv JACL01055816.1 1082 CSGQVTVTQPPVQTFTPGSTVTLTCKTKTNVYNNNYMHWYQQKPGQSPKLWIKYVTQRLSETPSRFSGSGSGRDFSLTITGAQAEDAAVYHCQSYHSPNV
Periophthalmus magnuspinnatus V9 ighv JACL01053308.1 1848 VKCETLTQPASVTVQPGHTLTISCTVSYSVSSYYTAWIRQPAGKGLEWIGMKYTGGSYYKDSLKNKFSINVDSSSNTVTLNGQNMQPGDTAVYYCARE
Periophthalmus magnuspinnatus V8 trav JACL01051841.1 924 EDTVTQTQGDASVPQGHTATIQCTFKTSDPTPTLFWYKQEGRGAPKYMIKLFGETILKSPEFDKPKLDAELKLKVKSLSLKIQDVDVTDSAVYYCALR
Periophthalmus magnuspinnatus V7 ighv JACL01010846.1 7836 VKCETLTQPDSVTVQPGHTLTISCTVSYSVNNFHTHWIRQPAGKGLDWIGGHRAGYDMYLKDSLKNKFSVNLDTSRNTVTLHGQNMQPGDTAVYYCARQ
Periophthalmus magnuspinnatus V6 ighv JACL01010846.1 3713 VKCETLTQPASVTVQPGHTLTISCTVSYSGTTAWIRQPAGKPMEWIGQNCAGCTATMKPSLKNKFSIEHPSSKTVTLNGQNMQPGDTAVYYCARY
Periophthalmus magnuspinnatus V5 ighv JACL01010846.1 86 VKCETLTQPASVTVQPGDTLTISCTVSYDIKAGQGYWTHWIRQPAGNGLEWIGRDCDGCTMLIKDSLKNKFSINAVSSSKTVTLNGQNMQPGDTAVYYCARR
Periophthalmus magnuspinnatus V4 ighv JACL01010845.1 8977 VKCETLTQPASVTVQPGDTLTISCTVSYDIKAGQGYWTHWIRQPAGNGLEWIGRDCDGCTMLIKDSLKNKFSINAVSSSKTVTLNGQNMQPGDTAVYYCARR
Periophthalmus magnuspinnatus V3 trbv JACL01010168.1 38044 VSAAAKFQQSPWIISNQSARVSIECSHDDSSLLVMLWYQHRPETQSMMLIEYNYVGTDNYENELGKQFKMERLNVLTGSLTVLSASPSHSAVYFCAASITVMKLR
Periophthalmus magnuspinnatus V2 trdv JACL01010168.1 34711 SSLNDQVDQTPQNIYCEKGTKAKIQCSHQITNYNQIFWYKQLDDGQLQLLGYMLATSAKIEPGAKILITGDANKGKTSTLTLEEPSSAMYYCAAS
Periophthalmus magnuspinnatus V1 igkv JACL01010168.1 33844 KSLYDQIHQTPRYLIKFTENSTKNELNCSNTIPSYDLTSWYKQDKDGTITLLGYMNLKYLTIEDAFKDKININGDGSSKTSLSISNLTVEDSGVYYCAPS
Periophthalmus magnuspinnatus V0 trav JACL01010168.1 32781 TQKVSQTPLQVIKFAGDSTNEMKCSHKQSKFDDILWYKQDKSATFKFLGFLVQTNAYLEHDVEDRIHLSRNGDFDATLSIRNLTVEDSAVYFCAVR