WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Pimephales promelas JNCE00000000.1 (JNCE01) 45 8 0 7 15 8 6 1
Pimephales promelas JNCD00000000.1 (JNCD01) 100 20 0 12 42 12 6 8
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Pimephales promelas V36 igkv JNCE01097032.1 4357 CFAEIILTQSPSVNQASVGSSVTLNCRSSSSVSTYLAWYHHRPGQTPKLLFSSVGNKVSGVSERFTDGRSGTNFMLNIRNVQPEDAGDYYCQQYAEYPL
Pimephales promelas V35 trav JNCE01083753.1 3439 VSFGDEITPDRSEEFAAVSSTVTLSCSYSSAYSLLWYRQYPGSAPQFLVLIIEGVKESKTSEVDPRFSTKTTKEIKRVDLEISSAEVTDSAVYYCALR
Pimephales promelas V34 trav JNCE01083753.1 4490 SVYQPEKHIAEFEGRSVKIQCKYKTASSQPDLFWYIQRANDLPKYFLRRNKYGEEDTDPQFQERFHSKVSSESVDLSIQDVSVSDSAVYYCALK
Pimephales promelas V33 trdv JNCE01083753.1 6739 DTMAQSITPQANRTLASVGQKAILSCKYEGTITNLHWYRQYSRSKPEFLAWIYPHGTTSDPLPPRILPKVDKNLVSLEIFDAEVSDSALYYCALT
Pimephales promelas V32 trav JNCE01083753.1 9165 TVFADTIQPLSSEKHVVEGKNVTLSCNYSATTGNVNSLQWYRQYLGAKPEFLLFVTEYSSSSEPDLRLYSKATKAIKRVDLEISSAEVSDSAVYYCALV
Pimephales promelas V31 trav JNCE01083753.1 11225 FVNQPKRYQSAYEDGDAVTLDCKYNTTSSNPTLIWYRQHSYDSPKYILRRHKFGDGDEATEFKGRFYSRHDSITRSVPLTVQDVSVSDSAVYYCALQ
Pimephales promelas V30 trav JNCE01083753.1 13403 CDSLERVDQNTRVQTAFEGRSVTINCTYETSDLSPYLFWYQQKMNGIPKNMMVIIVTNVQNDKDFEERFTANHIKTSKSVPLTIQDASVSDSAVYYCALR
Pimephales promelas V29 trav JNCE01083753.1 19209 TVNQPSETQTGTEGQQVTLSCEYETLQTAPYLFWYIQRSDGLPEYILMKYKFGSSSSSEFEDRFDARLDSNSVILTIKDVSVSDSAVYYCALQ
Pimephales promelas V28 trav JNCE01083753.1 28731 VSFGDEITPDRREEFAAVSSTVTLSCSYSSANSLLWYRQSPGSAPQFLVLIIEGVKETKTSEVDPRFSTKTRKEEKIKRVDLEISSAEVSDSAVYYCALR
Pimephales promelas V27 ighv JNCE01059159.1 3822 VNGQSLSSSDSVVKRPGESVTLSCGVSGFSMSDYWMHWIRQKPGRGLEWIGRIDSGTGTVFAQSLQGQFSITKDTSKKMLYLEVKSLKTDDTAVYYCARD
Pimephales promelas V26 trav JNCE01042410.1 183 NSSANPIQPLTSEKHVFRGQNVIISCNYSVDVNNLQWYSQYPGSRPEHLILITEYSDPPDPSLRLSAKATKDIKRVDLKISSAEVSDSAVYYCALQ
Pimephales promelas V25 trbv JNCE01023232.1 176 GCLGKSVDQTPDNLIQNQDQSAVIVCAHNIQSYDQIFWYKQSQDTSGLKLMGYLYYSENKETEFENKIKLEGDAKKNGTLTIENLKLNDSAVYFCAAYYTQC
Pimephales promelas V24 trbv JNCE01646050.1 610 GCLGKSVDQTPDNLIKNQDESAVIVCAHNIPSYDRIFWYKQSQDTSGLELMGYLFYKDETKETEFTNKITLEGDAEKNGTLTIKKLRLNDSAVYFCAAYYTVFT
Pimephales promelas V23 trav JNCE01562234.1 7 KVDQYTKIQSAVEGDDVTINCTYQTGYSNPTLFWYQQKVDEIPKFMLNKFSTTGQNEDEFKERFQANLSKTSVPLTIQDVSVSDSAVYYCALQPTVTQ
Pimephales promelas V22 trgv JNCE01191471.1 3950 QTWAQTVLQSTRFISALPGVEVTIDCSMAAGVSMGSYTMLWYRQVRYGQPVEYLIKEYEKATQNFEAILNTNDNSFSLIVSNVGAHDSGTYYCAA
Pimephales promelas V21 trbv JNCE01179916.1 2189 GCLGKTVDQTPDNLIKNQDESAVIVCAHNIPSYNQILWYKQNQDTSGLKLMGYLSFKDETKETEFTNKIKLEGDAKKNGTLTIKKLRLNDSAVYFCAAYYTQCSQ
Pimephales promelas V20 igkv JNCE01179729.1 168 VSGVTVVTQSPLITVNKGETAKLDCNLGTVTGSEARWYKQTSGGVPQYVLRFHHSYSSPSYGSGFSAPKFTSTHSSQSDYSLIISNVDVGDSAVYYCQTWDSSVNEWI
Pimephales promelas V19 trbv JNCE01177931.1 207 GCLGKSVDQTPDNLIKNQDQSAVIVCAHNIPSYDRILWYKQSQDTSGLKLMGYLYYSENKEPEFENKIKLEGDAKKNGTLTIEKLTLNDSAVYFCAAYYTQCSQ
Pimephales promelas V18 ighv JNCE01126373.1 2715 SYELTQPESLTVRPDATLTISCKVSYSVTSGHTAWIRQPAGKALEWIGYISSGGGLAYKDSLKSQFSITRDTSSNTITLQGKNMKAQDTAVYYCAKY
Pimephales promelas V17 igkv JNCE01080745.1 1798 FSGQVTVTQTPSVKIVTIGESVSINCNTNTIVSNGCTGTYTCMHWYLQKPGEAPKLLIHSANQRVSNTPSRFSGVSNYGRYFTLSISGVQTEDTGDYYCLSAYEG
Pimephales promelas V16 trgv JNCE01036210.1 30448 DANVKLQQKISSTKSKDKTVVIDCRFPSDCIRYIHWYQLKEGQTLKRILYSSIADGSTYNDVGFESFKVDNKHENLALKIPELKKEHSAMYYCACWVSG
Pimephales promelas V15 trgv JNCE01036210.1 29038 GDLQQKISLTKAEEKLAIIDCHYTSSDCWTYIHWYQQKEGEPLKRILYANINDGSAQNDAGFESIKSEKKTSNHFALKITKLKKEHSAMYYCACWIWSGSSI
Pimephales promelas V14 trgv JNCE01036210.1 27467 VEGLSLNQNQKVLVKLKGKTVTFRCEVTGLGSGNFVHWYHKKDGETFKRLLYISASGIATSEAKDFVSEKIGNSYGIKLKETKEEHAGMYYCACWDG
Pimephales promelas V13 trgv JNCE01036210.1 26400 TLEQGQPTLVKAVGKTSYLPCKVTDLQSWNYIHWYQKREGEAPSRLLYINAGGSFIYDTNNPQANDFTVDRTQLFNLKLSNTKPIHAAVYYCAYWDTGNHSENIY
Pimephales promelas V12 trav JNCE01036210.1 21724 ISLEPGLKVLVKAMGKTVYLPCRASGLSNSDYIHWYQIKDGEAPSRVLYISKEGAVARDTNNPQANDFNVDKTKLYDLKLSDTKKSHAAVYFCAYWDSS
Pimephales promelas V11 igkv JNCE01036147.1 227 CRSQITVTQTPSLKTAKPGETVEMSCKSSSDATACSPPCVSWYLQKPGEAPKLLIYNVNSRQSGTPSRFSGSSESSKDFTLSISGVQTEDAGHYYCMRTNSGGV
Pimephales promelas V10 trav JNCE01029453.1 594 CVQFDQPLSLFRKPDEKAVISCTHDDKNLDVMLWYQQLHDSKSLALIGYGYDMADPNYESGFQKRFKMTRKDTTTGALLISDLSYSDSAVYYCAAR
Pimephales promelas V9 trav JNCE01014754.1 1780 ETTGYGIKSDNNTIVLMEDKNITLSCTYEGSVDSLYWYRQKPESRSEFLIMIDEASEHVTKANPPDPRLSIKLHKAQNRVHLEISSAAVMDSAMYYCALR
Pimephales promelas V8 trav JNCE01009437.1 147 VSGVTVVTQSPLITVNKGETAKLDCNLGTVTGSAARWYKQTPGGVPQYVLRFYHSYSSPSYGSGFSAPKFTSTHSSQSDYSLIISNVDVGDSAVYYC
Pimephales promelas V7 ighv JNCE01008366.1 15351 AHGQSLTSSGSEVKKPGESVTLSCVVSGLSLSWLHWIRQKPGRGLEWIGRIDSGTGTIFAQSLQGQFSITKDTSKNMLYLEIKSLKTEDTAVYYCARE
Pimephales promelas V5 ighv JNCE01008366.1 8614 CWCQTLTESESVVIKPGGSHRLICTWSGFSDPYLAWIRQAAGGGLEWLAYISSSGTTYYSQSVQGRFTISRDNSKKQMHLQMNNIKNEDTAVYYCARE
Pimephales promelas V4 ighv JNCE01008366.1 4495 LFCIELNQPPAIVVKPGETFTIACKITGYTASGGGYTNWIRHSSGKPMEWIGWFYSSSSKGVKDSLKNKISFSAESSSNAVILTGQNFNTEDTAVYYCARD
Pimephales promelas V3 ighv JNCE01008366.1 1113 GNCIELNQPALMVVKPGESFSIGCKITGYSASGGACTNWIRHLTGKAMEWIGYFCSSDNTGPSNTMKNKISFTAETSSNTVFLRGQNFQTEDTAVYYCARH
Pimephales promelas V2 trav JNCE01001804.1 19 VSGVTVVTQSPLITVNKGERAKLDCNLGTVTNYAAYWYKQTSGGVPQHVLRFYHSWSSPSYGSGFSAPKFTSTHSSQSDYSLIISNVDVGDSAVYYCKTWDSSEAV
Pimephales promelas V1 igkv JNCE01713894.1 206 VWGQVTVTQNPAIKSVKQGETVTISCKTSQPISGCNNCVSWYQQKPGEAPKLLIYYIRSLYTGTPSRFSGSGSNYGSDFTLSISGVQTEDTGDYYCQS
Pimephales promelas V0 trbv JNCE01456034.1 329 GCLGKTVDQTPDNLIKNQDQSAVIVCAHNIPSYNQILWYKQSQDTSGLKLMGYLFYKDETKETEFTNKIKLEGDAEKNGTLTIEKLRLNDSAVYFCAAYYTQC
Pimephales promelas V43 trgv JNCE01185211.1 2537 IKCQKMESIESTLQKRPGETLTLSCRGSGFSFDCCDMHWIRQQAGKPLVWIGRVYSGGSGHDYAESFNRRTEITRDNSKNMVYLKLSGLTTEDSATYYCAKQTQ
Pimephales promelas V42 trav JNCE01185211.1 3815 VQCQKMESIESTVQKKPGETLTLSCRGSGFSFDCCAMHWIRQQAGKPLVWMGLGYSSGSGYKAESFKERLEISRDDSKSMMYLKLTGLTEEDSAVYFCAREAQ
Pimephales promelas V41 trbv JNCE01150093.1 21 SSLSDKVQQTPHEMLVNVRESPVLLCSHSITSYDRILWYKQTQDRQMVFLGYLLGSVTQLETEVKNKLALDGNGNDNGKLTIKNLEFNDTGTYFCAAS
Pimephales promelas V40 trbv JNCE01148648.1 24 CLGKSVDQTPDNLIKNQDESAVIVCAHNIPSYDQILWYKQSQDTSGLKLMGYLYYSENKETEFENKIKMEGDAKKNGTLTIEKLRLNDSAVYFCAAYYTVFT
Pimephales promelas V39 ighv JNCE01137258.1 2068 IDSQVVLTQSEQSVVVSPGGSHKLTCACSGFTLSSYRMHWIRQAPGKGLEWILHYYTDSDKGSAQSVQGRFTATRDSSNFYLHMNQLKTEDTAVYYCAR
Pimephales promelas V38 igkv JNCE01137182.1 6206 QYTVTQSPSISAVQPGEQVRINCKTSSNVYGNNHLAWYSQKPGEAPKLLIYYASTLYTGTPSRFSGSGSGSDFTLSISGVQTEDTGDYYCQS
Pimephales promelas V44 igkv JNCE01193989.1 406 TVTQTPAVKSVPLGDTFTISCKTSPDVYQGWGVQPLLSWYLQKPGEAPKLLIYLTNRRQSGTPSRFSGSGSNSDFTLSISGVQTEDAGHYYCVS
Pimephales promelas V37 trbv JNCE01105490.1 14 FSDSVLITQWPEYISSLPGSSVDMHCYQNDTDYDYKYWYRHIKGEGPVLVGSIVGTTDSIEKDFETGFKVSGTETKKWTLTVDVKEGIDAVYLCAAS
Pimephales promelas V6 ighv JNCE01008366.1 12322 VCGISLTSSPAQIKTPGQSVRLSCQISGYALKDYGTAWIRQPPGKAMEWIGIIWGGGSINSGNSFKSGFTISRDTDQNELYLDISSLQTEDTAVYYCAKT
Pimephales promelas V15 trbv JNCD01007726.1 5231 GCLGKSVDQTPDNLIKNQDQSAVIMCAHNIQNYDRILWYKQSQDTPGLELMGYLFYKDETKETEFTDKIKQDGDGRNNVNLTINSLRLNDSAVYFCAAYYTVFT
Pimephales promelas V14 igkv JNCD01006853.1 3572 QITVTQSPSITAEQPGGTVNIKCKTSTDVYRDSNGYYLAWYLQKPGEAPKLLIYLTNRLQSGTPSRFSGSGSNSDFTLSISGVQTEDAGHYYCMS
Pimephales promelas V13 trdv JNCD01003705.1 2364 TADCVQFEQSPRLFANQNGKAEINCKHDDNNLVVMLWYRQQSMSLDLIGYGYSGSSPNSEPGFTERFTQTRQNTVTGSLTITDLTPSDSALYYCAAS
Pimephales promelas V12 trav JNCD01001272.1 2686 ETTGYGIKSDNNTIVLMEDKNITLSCTYEGSVDSLYWYRQKPESRSEFLIMIDEASEHVTKANPPDPRLSIKLHKAQNRVHLEISSAAVMDSAMYYCALR
Pimephales promelas V11 trdv JNCD01001017.1 8531 LVQSQKVTQSPPDLMKILTESAVLNCSHSDPSLERILWYKQSEDRGFIFLGFLNNNFQNPEDEFENKISLDGDGRSHATLTIHNLTLVDSAVYYCAAR
Pimephales promelas V10 trbv JNCD01001017.1 6787 FSHSNKVDQSPPDVIKRPGESAKIRCQHSVTNYNQINWYRHNQGQEFTFMGYLLLKGPSPEKEFTEKIEMSGDGQNDGSLTIKSLSSSDSAVYFCAAY
Pimephales promelas V9 trbv JNCD01001017.1 467 SSLSDKVQQTPHEMLVNVRESPVLLCSHSITSYDRILWYKQTQDRQMVFLGYLLGSVTQLETEVKNKLALDGNGNDNGKLTIKNLEFNDTGTYFCAAS
Pimephales promelas V8 trav JNCD01000874.1 50312 KVDQPVKRVTEVEGKSVTLNCTFTTTSTQPYLFWYVQRANDIPKYILRRDKFGIGENGTEFQERFHSEISSNSVPLMIKDVSVSDSAVYYCALR
Pimephales promelas V7 trav JNCD01000874.1 48409 SSGQDKVEQSYRERTANEGDQVILKCNYTTTSNNPYLFWYKQLPNRSPTFILNKYTFGEGATEPDFKKRFSATLDSTSRSVPLTIQDVSVSDSAVYYCALR
Pimephales promelas V6 trav JNCD01000874.1 30064 CRSEDSVDQPDKHLTETEGRSVTLQCKYKTDSVQEDLFWYIQRANDFPKYILRRSKYGGENGTEFQERFHSELSSNSVPLMIKDVSVSDSAVYYCALR
Pimephales promelas V5 trav JNCD01000874.1 27181 CISEDSVDQPDKHLTETEGRSVTLQCKYKTDSVQENIFWYIQRANDFPKYILRRSKYGGENGTEFQERFHSELSSNSVPLMIKDVSVSDSAVYYCALK
Pimephales promelas V4 trav JNCD01000874.1 23186 SLGDQITSLGPEKEAQDGNSVTLSCNYSGTVYNLLWYRQYQRSKPELLLYMTESGDPVKADPSAHWFSAKVDKHRKLMELEISPAKVTDSAQYYCALQ
Pimephales promelas V3 trav JNCD01000874.1 21362 SLGDQITSLGPEKEAQDGNSVTLSCNYSGTVYNLLWYRQYQRSKPELLLYMTESGDPVKADPSAHWFSAKVDKHRKLMELEISPAKVTDSAQYYCALQ
Pimephales promelas V2 trav JNCD01000874.1 18436 SVYQPEKHIAEFEGRSVKIQCKYKTASSQPDLFWYIQRANDLPKYFLRRNKYGEEDTDPQFQERFHSKVSSESVDLSIQDVSVSDSAVYYCALK
Pimephales promelas V1 trav JNCD01000874.1 4680 FVNQPKRYQSAYEDGDAVTLDCKYNTTSSNPTLIWYRQHSYDSPKYILRRHKFGDGDEATEFKGRFYSRHDSITRSVPLTVQDVSVSDSAVYYCALQ
Pimephales promelas V0 trav JNCD01000874.1 2493 CDSLERVDQNTRVQTAFEGRSVTINCTYETSDLSPYLFWYQQKMNGIPKNMMVIIVTNVQNDKDFEERFTANHIKTSKSVPLTIQDASVSDSAVYYCALR
Pimephales promelas V52 ighv JNCD01003376.1 44603 ISGNGIQLDQSSAVMKRPGETVKISCKISGFTMTQHYMHWIRQKPGKALEWIGRVNSGSSSASDYLIYADSVKNHFIMSEDVSQSTQYLETKSLREEDTAVYYCARQ
Pimephales promelas V51 ighv JNCD01003376.1 45799 VCGISLTSSPAQIKTPGQSVRLSCQISGYALKDYGTAWIRQPPGKAMEWIGIIWGGGSINSGNSFKSGFTISRDTDQNELYLDISSLQTEDTAVYYCAKT
Pimephales promelas V50 ighv JNCD01003376.1 49633 CWCQTLTESESVVIKPGGSHRLICTWSGFSDPYLAWIRQAAGGGLEWLAYISSSGTTYYSQSVQGRFTISRDNSKKQMHLQMNNIKNEDTAVYYCARE
Pimephales promelas V49 ighv JNCD01003376.1 51833 QTLTESESVIIKPGNEHKLTCTFSGIEVDNAAISWIRQAEGKGLEWISHISAPRGSDKYYSKSVEGRFTTSRDNSKMQVYLHMTNLQAEDTGVYYCARK
Pimephales promelas V48 ighv JNCD01003376.1 53143 VNGQSLSSSDSVVKRPGESVTLSCGVSGFSMSSYWMHWIRQKPGRGLEWIGQISGSSVYYAQSLQGQFSITTDTSKNMLYLEVKSLKNEDTAVYYCARDSQ
Pimephales promelas V47 ighv JNCD01003376.1 54154 VNGQSLSSSDSVVKRPGESVTLSCGVSGFSMSSYWMHWIRQKPGRGLEWIGQISGSSVYYAQSLQGQFSITTDTSKNMLYLEVKSLKNEDTAVYYCARDSQ
Pimephales promelas V46 ighv JNCD01003376.1 55754 LFCIELNQPPAIVVKPGETFTIACKITGYTASGGGYTNWIRHSSGKPMEWIGWFYSSSSKGVKDSLKNKISFSAESSSNAVILTGQNFNTEDTAVYYCARD
Pimephales promelas V45 ighv JNCD01003376.1 57192 LFCIELNQPPAIVVKPGETFTIACKITGYTASGGGYTNWIRHSSGKPMEWIGWFYSSSSKGVKDSLKNKISFSAESSSNAVILTGQNFNTEDTAVYYCARD
Pimephales promelas V44 ighv JNCD01003376.1 60610 GNCIELNQPALMVVKPGESFSIGCKITGYSASGGACTNWIRHLTGKAMEWIGYFCSSDNTGPSNTMKNKISFTAETSSNTVFLRGQNFQTEDTAVYYCARH
Pimephales promelas V43 trgv JNCD01072258.1 389 VEGLSLNQNQKVLVKLKGKTVTFRCEVTGLGSGNFVHWYHKKDGETFKRLLYISASGIATSEAKDFVSEKIGNSYGIKLKETKEEHAGMYYCACWDG
Pimephales promelas V42 trbv JNCD01036553.1 2344 FSDSVLITQWPKYISSLPGSSVQMHCYQNDTNYDYKYWYRHIKGEGPVLVGSIVGTTDSIEKDFETGYKVSGTETKKWTLTVDVKEGIDAVYLCAAS
Pimephales promelas V41 ighv JNCD01030976.1 1013 IDSQVVLTQSEQSVVVAPGGSHKLTCACSGFTLSSYRMHWIRQAPGKGLEWILHYYTDSDKGSAQSVQGRFTATRDSSNFYLHMNQLKTEDTAVYYCAR
Pimephales promelas V40 trav JNCD01030257.1 4860 CDSLDSIEQKTSAQVAFEGESVTINCTYSTTDSFPYLFWYQQEINGFPKYMLKKFPGSGEIDEQFKERFDANLNTSTKTVPLMIKDVSVSDSAVYYCALR
Pimephales promelas V39 trav JNCD01030257.1 2099 KVDQYTKIQSAVEGDDVTINCTYQTGYSNPTLFWYQQKVDEIPKFMLNKLSTTGQNEDEFKERFQANLSKTSVPLTIQDVSVSDSAVYYCALQPTVTQ
Pimephales promelas V38 igkv JNCD01026344.1 4907 ITVTQPEVVTVSEGQDATIECKTDAGIYSWGLAWYQQKHGEAPKLIITGVTDLYDNSFSRFSGNGEEGGTDFTLSISGVQTEDAGHYYCQS
Pimephales promelas V37 trbv JNCD01025134.1 17616 GCLGKTVDQTPDNLIKNQDESAVIMCAHNIQNYDQILWYKQSQDTPGLKLMGYLYYKDETKETEFTNKIKLEGDAQKNGTLTINRLRLNDSAVYFCAAYYTQCSQ
Pimephales promelas V36 trav JNCD01019316.1 2713 CLICEKVHQSPSDVLCKPNESVELTCKHKISNYDTILWYKRSYGDSSLKLIGYARYSNLKDYEESYKDHFSLTGNGEEEVTLKLLTARPDQDSAEYFCAASYTQ
Pimephales promelas V35 trbv JNCD01019127.1 439 FSYSYSVHQSPPDVIRKPEETARLQCLHSVTSYNRINWYRQTQDQGFTLMGQLYLTTPNTETDFTNKIEMFGNGNSNGSLTIKSLSSSDSAVYFCAAY
Pimephales promelas V34 trav JNCD01017273.1 29723 SQENVEQNIRVQTAYESGAVIINCTYQTQFSPTLFWYQQKVNGGPKYMLNRVGKTGDEDKEFKERFNAHIDTSSRSFPLTIQDVSVSDSAVYYCALQ
Pimephales promelas V33 trav JNCD01017273.1 27685 QDNVIQSKQVTTAFEDGTATLDCTYKATSTQYPNLFWYQQKTNESPKYMLMRLSGSSNNDEEFKWRFNADLNTSAFTVPLTIKDVSVSDSAVYYCALK
Pimephales promelas V32 trbv JNCD01016887.1 5724 LSMALKVTQTPIDLFLVIGASMNITCRHNDKSYDKILWYQQANGQSLEPLGLLSFKQFLPDREGFTISGDAEKEANLLVSSVKAEHSAVYFCAVSV
Pimephales promelas V31 trav JNCD01008975.1 84546 VTLADAITSEHKEVHANENENMTLSCRYSSAYSLLWYRQHHSSAPHFLMLILQSSGKVIQSSDERLSGKLNVEKNRVDLEIPSSTVQDSALYFCALQ
Pimephales promelas V30 trav JNCD01008975.1 83478 VTLADAITSEHKEVHANENENMTLSCRYSSAYSLLWYRQHHSSAPHFLMLILQSSGKVIQSSDERLSGKLNVEKNRVDLEIPSSTVQDSALYFCALQ
Pimephales promelas V29 trdv JNCD01008975.1 75219 KDAITPYSDATFATETESVKLSCNYTGSVDSLHWYRQYPGSPPQFLILDYYGTKTQADPPVSGISISHRKEASSVDLEISSAKVTDSALYYCALR
Pimephales promelas V28 trdv JNCD01008975.1 71938 KDAITPYSDATFATETESVKLSCNYTGSVDSLHWYRQYPGSPPQFLILDYYGTKTQADPPVSGISISHRKEASSVDLEISSAKVTDSALYYCALR
Pimephales promelas V27 trav JNCD01008975.1 52836 CDSVERVDQNTRVQTAFEGRSVTINCTYETSDPSPYLFWYQQKMNGIPKYMMMIFAANVQKDKDFEERFAANHMKTSKSVPLTIQDVSVSDSAVYYCALR
Pimephales promelas V25 trav JNCD01008975.1 40442 CRGQDSVDQPLREKTSAEGNQVTLLCNYTLMSAANAYLFWYKQLSNRSPTFILSEFTVGKGTTEDEFKERFSAKLDSTSTSVPLTIQDVSVSDSAVYYCALK
Pimephales promelas V24 trav JNCD01008975.1 38612 CRGQDSVDQPLREKTSAEGNQVTLLCNYTLMSAANAYLFWYKQLSNRSPTFILSEFTVGKGTTEDEFKERFSAKLDSTSTSVPLTIQDVSVSDSAVYYCALK
Pimephales promelas V23 trav JNCD01008975.1 22068 SSGQDKVEQSSREMSASDGDQVILRCNYTTTDTSPYLFWYTQLPNRSPTFILNKYTFGGGTTEDEFKERFSATLDSTSRSVPLTIQDVSVSDSAVYYCALQPTVTQ
Pimephales promelas V22 trdv JNCD01008975.1 12311 DTMAQSITPQANRTLASVGQKAILSCKYEGNIINLHWYRQYSRSKPEFLAWIYPQGTTSDPLPPRILPKVDKNVVYLEISSAEVSDSALYYCALT
Pimephales promelas V21 trbv JNCD01007726.1 16438 ISNSQDVNQTQTDLIKFPEQSEELRCSHSSSYNVMLWYKQTRGGSLELLGYLVGSSETVEDKFKNKINLDGNANKYSVLKLQSLSSEDSAVYFCAAS
Pimephales promelas V20 trbv JNCD01007726.1 11884 SVLGESVVQSPPDLLKKQDELAEIKCSHKVQSYDVIQWYKQSQSIMDLRLMGYLNIQHEVTETEFTDKIKLSGDGRNNVTLRIDSLRLSDSAVYFCAAYYTVFT
Pimephales promelas V19 trav JNCD01007726.1 11073 SVVNGSVQQSPSNRIKTERDSAEFVCTHNITSYTMIFWYKHTRGHEFTLLGYIWNKNYFPEDDFKNKISLNGDGTKNGSLKIVDLALSDSAMYFCAAS
Pimephales promelas V18 trav JNCD01007726.1 9997 CLAETVLQSPGDLIQNQDEPAEIKCAHNIRNYDRILWYKKDMDFKLMGYLNLENDYPEPEFTNKIKLSGDGRNNGTLTIDSLRLNDSAVYFCAAY
Pimephales promelas V17 trav JNCD01007726.1 7671 ANLAKPVYQSPGDLMKNQDEPAVFICSHNIQDYNRMLWYKQSRDTSGLTLMGYLSFDQENKEPEFENKIKLDGDAKKNGTLTIKKLTLNDSAVYFCAAYYTL
Pimephales promelas V16 trbv JNCD01007726.1 6873 GCLGKSVDQTPDNLIKNQDESAVIVCAHNIPSYDRIFWYKQSQDTSGLELMGYLFYKDETKETEFTNKITLEGDAEKNGTLTIKKLRLNDSAVYFCAAYYTVFT
Pimephales promelas V90 trbv JNCD01056661.1 71 LSMALKVTQTPIDLFLVIGASMNITCRHNDKSYDKILWYQQANGQSLEPLGLLSFKQFLPDREGFTISGDAEKEANLLVSSVKAEHSAVYFCAVSV
Pimephales promelas V89 ighv JNCD01047071.1 1019 SYELTQPESLTVRPDATLTISCKVSYSVTGSATAWIRQPAGKALEWIGIIWSDGSLDYKDSLKSQFSITRDTSSNTITLQGKNMKAQDTAVYYCARQ
Pimephales promelas V88 ighv JNCD01047071.1 2090 SYELTQPESLTVRPDATLTISCKVSYSVTSYATAWIRQPAGKALEWIGYISSGGSLYYKDSLKSQFSITRDTSSNTITLQGKNMKAQDTAVYYCARQ
Pimephales promelas V87 trdv JNCD01045281.1 895 LVQSQKVTQSPPDLMKILTESAVLNCSHSDPSLERILWYKQSEDRGFIFLGFLNNNFQNPEDEFENKISLDGDGRSHATLTIHNLTLVDSAVYYCAAR
Pimephales promelas V86 trbv JNCD01045281.1 3548 FSHSNKVDQSPPDVIKRPGESAKIRCQHSVTNYNQINWYRHNQGQEFTFMGYLLLKGPSPEKEFTEKIEMSGDGQNDGSLTIKSLSSSDSAVYFCAAY
Pimephales promelas V85 trgv JNCD01042093.1 205 QTWAQTVLQSTRFISALPGVEVTIDCSMAAGVSMGSYTMLWYRQVRYGQPVEYLIKEYEKATQNFEAILNTNDNSFSLIVSNVGAHDSGTYYCAA
Pimephales promelas V84 igkv JNCD01033770.1 4508 CMAEIILTQSPSANQASVGSSVTLNCRSSSTGLTSSLAWYHHRPGQTHKLLFYSVGSKVSGVSERFTDGRSGTNFMLNIRNVQPEDAGDYYCQQYAEYPL
Pimephales promelas V83 trav JNCD01033542.1 187 KGECVNVQQNLTPIIANKNSLAEIKCSYDDSAKPNMLWYQQKETAMALIVLSYGATSDPTYEDGFKKRFTLKRTDTLNGVLEISELSLSDSAVYYCAVS
Pimephales promelas V82 igkv JNCD01030989.1 3772 QITVTQSPSITAEQPGGTVNIKCKTSTDVYRDSNGYYLAWYLQKPGEAPKLLIYLTNRLQSGTPSRFSGSGSNSDFTLSISGVQTEDAGHYYCMS
Pimephales promelas V81 ighv JNCD01027446.1 1907 GVYCVELTQPPSLVLKPQESFSISCRISVSSYCIHWIRQPTGKALEWLGYLCSGGSSNIKDSIKNKISFTQDTSKNTVFLQGKNFQIEDTAVYYCARE
Pimephales promelas V80 trav JNCD01027446.1 12463 IDSYELTQPESLTVRPDATLTISCKVSYSVTSGHTAWIRQPAGKALEWIGYISSGGGLAYKDSLKSQFSITRDTSSNTITLQGKNMKAQDTAVYYCAKY
Pimephales promelas V79 ighv JNCD01027446.1 17082 CWCQTLTESESVVIKPGGSHRLICTWSGFSGDPHLAWIRQAAGGGLEWLAYISSGSSYIYYSQSVQGRFTISRDNSKKQMYLQMNNIKNEDTAVYYCARE
Pimephales promelas V78 ighv JNCD01027446.1 17738 CWCQTLTESESVVIKPGGSHRLICTWSGFSDPYLAWIRQAAGGGLEWLAYISSSGTTYYSQSVQGRFTISRDNSKKQMHLQMNNIKNEDTAVYYCARE
Pimephales promelas V77 igkv JNCD01025370.1 3654 SVGQVTVTQTPSDLLSKPGQSVTITCKTSSDPPCCYGDGKPLLSWYLQKPGEAPKLLIYITNRLQSGTPSRFSGSGSNSDFTLSISGVQTEDAGHYYCQS
Pimephales promelas V76 igkv JNCD01025370.1 5411 TQTPSDLLSKPGQSVTITCKTSSDPPCCYGDGKPLLSWYLQKPGEAPKLLIYITNRLQSGTPSRFSGSGSNSDFTLSISGVQTEDAGHYYCMS
Pimephales promelas V75 igkv JNCD01025370.1 6114 SVGQVTVTQTPSDLLSKPGQSVTITCKTSSDPPCCYGDGKPLLSWYLQKPGEAPKLLIYITNRLQSGTPSRFSGSGSNSDFTLSISGVQTEDAGHYYCQS
Pimephales promelas V74 igkv JNCD01025370.1 7871 TQTPSDLLFEPGQSVTITCKTSSDPECCYSDDDGDGKPLLSWYLQKPGEAPKLLIYYTNRLQSGTPSRFSGSGSNSDFTLSISGVQTEDAGHYYCMS
Pimephales promelas V73 trav JNCD01023169.1 4886 NGNVIRANQPSEVLTEGSSITLSCTYESGSAYSLHWYRQMPGSTLEFLLLIVKSTKYVAKADRPHPHMSIRLHDELVDLEISSAAVSDSAVYYCAL
Pimephales promelas V72 trav JNCD01023169.1 5819 NAAADALTPFFTEKHVLEGKDVTLICNYTSTNVQNLQWYRQYPGSKPENIILFIETIPKSEPSLRLTAVADKVIKHMNLTISSTEVKDSAMYYCALE
Pimephales promelas V71 trav JNCD01023169.1 12829 HTEADAIKPLSGNENRLVGDAVNLSCSYKDYTSTVQNLQWYRQYPRSKPEFLLYIFPHGVMSEDRPDRFSAKVHQDIKQVDLKISSAVQADSAVYYCALV
Pimephales promelas V70 trav JNCD01023169.1 17352 SADAYTIESLSSEKHVLVGESAVISCKYSGLGPSFQWYRQYPGSRPEFLIFQTETSVSSEPTLRLTAIPKKEMTQVDLEISSAEVSDSAVYYCALR
Pimephales promelas V69 trav JNCD01023169.1 19732 NSSANPIQPLTSEKHVFRGQNVIISCNYSVDVNNLQWYSQYPGSRPEHLILITEYSDPPDPSLRLSAKATKDIKRVDLKISSAEVSDSAVYYCALQ
Pimephales promelas V68 trav JNCD01023169.1 21127 NVLANAITSHSTEKHVLEGEKTTLSCNYSGSNINNFQWYRQSSNTAPEFILQAFENLGPQKKDQYIAKVRKDQKQLDLEISKTETADSAIYYCALV
Pimephales promelas V67 trav JNCD01023169.1 23181 SVFANTITSLYAEVHASEGEKTTLSCNYDGSNIVGFQWYRQYPNTAPEFLLQAFENQGPQENDRHVAEALKDQKQLDLKISKTEIADSAIYYCALV
Pimephales promelas V66 trav JNCD01023169.1 26861 TFAQSIRPLQNNVHVTEGKPVNLSCKYDGSAYSLHWYRQYPGSRPEFVLLVMESAKKQVIYAEPRIPGMDGQMSMSDKRVDLEISSATVSDSALYYCALE
Pimephales promelas V65 trav JNCD01023169.1 27402 TFAQSIRPLQNNVHVTEGKPVNLSCKYDGSAYSLHWYRQYPGSRPEFVLLVMESAKKQVIYAEPRIPGMDGQMSMSDKRVDLEISSATVSDSALYYCALE
Pimephales promelas V64 trav JNCD01021423.1 289 IDSYELTQPESLTVRPDATLTISCKVSYSVTSYATAWIRQPAGKALEWIGIIWSGGSLYYKDSLKSQFSITRDTSSNTITLQGKNMKAQDTAVYYCAKY
Pimephales promelas V63 ighv JNCD01021423.1 1476 SYELTQPESLTVRPDATLTISCKVSYSVTSYATAWIRQPAGKALEWIGIIWSGGSLYYKDSLKSQFSITRDTSSNTITLQGKNMKAQDTAVYYCARQ
Pimephales promelas V62 ighv JNCD01021423.1 2663 SYELTQPESLTVRPDATLTISCKVSYSVTSYATAWIRQPAGKALEWIGIIWSGGSLYYKDSLKSQFSITRDTSSNTITLQGKNMKAQDTAVYYCARQ
Pimephales promelas V61 ighv JNCD01021423.1 3850 SYELTQPESLTVRPDATLTISCKVSYSVTSYATAWIRQPAGKALEWIGIIWSGGSLYYKDSLKSQFSITRDTSSNTITLQGKNMKAQDTAVYYCARQ
Pimephales promelas V60 ighv JNCD01021423.1 5037 SYELTQPESLTVRPDATLTISCKVSYSVTSYATAWIRQPAGKALEWIGYISSGGSLYYKDSLKSQFSITRDTSSNTITLQGKNMKAQDTAVYYCARQ
Pimephales promelas V59 trgv JNCD01021423.1 6635 IKCQKMESIESTLQKRPGETLTLSCRGSGFSFDCCDMHWIRQQAGKPLVWIGRVYSGGSGHDYAESFNRRTEITRDNSKNMVYLKLSGLTTEDSATYYCAKQTQ
Pimephales promelas V58 trav JNCD01021423.1 8636 VQCQKMESIESTVQKKPGETLTLSCRGSGFSFDCCAMHWIRQQAGKPLVWMGLGYSSGSGYKAESFKERLEISRDDSKSMMYLKLTGLTEEDSAVYFCAREAQ
Pimephales promelas V57 igkv JNCD01008265.1 2887 ITGQVSVTQTPSEEALQGGTVTITCQTNRGIGDRTYGCGGCLSWYLQKPGEAPKLLIYDINSRQTGTPSRFTGNGANYGTDFTLSISGVQTEDAGHYYCMS
Pimephales promelas V56 igkv JNCD01007152.1 518 SHQEVQTPESLLVKAGDSVSISCTGTSGVDDDMSWYLQKPGEAPKLLIYTASELESGVPDRFSGSGYEPDFTLNIRGVQPEDAGDYYCMGAYSGA
Pimephales promelas V54 trdv JNCD01004269.1 2255 FTVNSIITQTPSEIFSKTNTESVSLHCSHSSSSFNVILWYKQPLNGEMQLMGYLYRTNGNTEQVFKEKIEQSGNGASYSNLTLKSLSSDDSAMYYCAAR
Pimephales promelas V98 trdv JNCD01073017.1 4222 TADCVQFDQSPRLFANQNGKAEINCKHDDNNLVVMLWYRQQSMSLDLIGYGYSGSSPNSEPGFTERFTQTRQNTVTGSLTITDLTPSDSALYYCAAS
Pimephales promelas V97 trgv JNCD01058623.1 1892 VEGLSLNQNQKVLVKLKGKTVTFRCEVTGLGSGNFVHWYHKKDGETFKRLLYISASGIATSEAKDFVSEKIGNSYGIKLKETKEEHAGMYYCACWDG
Pimephales promelas V96 trgv JNCD01058623.1 3307 TVLGVTLEQGQPTLVKAVGKTSYLPCKVTDLQSWNYIHWYQKREGEAPSRLLYINAGGSFIYDTNNPQANDFTVDRTQLFNLKLSNTKPIHAAVYYCAYWDTG
Pimephales promelas V95 trav JNCD01058348.1 366 SFGQSITPLETTKHATERESVILSCKYDSQARSLHWYRQYPGSRPQFLILVYESGSVTHAEPPFPRLGASVNKVEKQVYLNISSAAVTDSALYYCALE
Pimephales promelas V94 trav JNCD01058348.1 2137 HASSEGIAPVSPNEFVSEGKTIILSCNYTGSAATDALHWYRQYPRSRPDFLFLVNEAKFKQSADPPIPGISARLNEEKNRVDLEITGTALTDSAVYYCALQ
Pimephales promelas V93 trav JNCD01058348.1 3522 ECFAQTIKPLQGRTQVTEGETVVLSCKCDGGVQSVIWYRQYPGSGLEFLLLVVESSKKTVVYADPPIPRMDGNMSMGEKKVDLKISSAEVTDSAVYYCALK
Pimephales promelas V92 trav JNCD01058348.1 4903 NILTNMITSHGSQKQVFEGESVKLTCNYSGVPDTLQWYTEYPGSTPKFLLYIYESGLKSENIPERLTPRINKTTKRVDLEISSAEVSDSAVYYCALK
Pimephales promelas V99 trgv JNCD01073017.1 2205 QTWAQTVLQSTRFISALPGVEVTIDCSMAAGVSMGSYTMLWYRQVRYGQPVEYLIKEYEKATQNFEAILNTNDNSFSLIVSNVSAHDSGTYYCAA
Pimephales promelas V91 igkv JNCD01057191.1 323 CMAEIILTQSPSANQASVGSSVTLNCRSSSTGLTSSLAWYHHRPGQTHKLLFYSVGSKVSGVSERFTDGRSGTNFMLNIRNVQPEDAGDYYCQQYAEYPL
Pimephales promelas V55 igkv JNCD01007152.1 84844 SVGQTLTQSEAQTLQPDQTVSIHCNHKPAVYCVKKNTTLYCMSWYHQIPGEVPKLLIHHTSERASGVSSRFSGSESGNHMDFTLTISGVQPEDSGVYYCQS
Pimephales promelas V53 ighv JNCD01003376.1 42698 AHGQSLTSSGSEVKKPGESVTLSCVVSGLSLSWLHWIRQKPGRGLEWIGRIDSGTGTIFAQSLQGQFSITKDTSKNMLYLEIKSLKTEDTAVYYCARE
Pimephales promelas V26 trav JNCD01008975.1 47372 CQSEDTVDQPLKHVTGFEGELITLDCKYTTVSTSQELFWYIQKIDESPKLVLQRNSYGGGVNGTEFQERFFSEVKASKSVPLIMQSLRVSDSAVYYCALR