WGS Statistics
Organism WGS Record. Vs Total IGHV IGLV IGKV TRAV TRBV TRGV TRDV
Poecilia formosa AYCK00000000.1 (AYCK01) 152 59 0 18 48 22 4 1
Vgene Table
Organism Vgene Locus contig Contig Pos. AA sequence
Poecilia formosa V31 ighv AYCK01009489.1 18977 VGGQTLTESEPVTKRPGESHTLTCTTSGFTLSSYAMSWVRQAPGKGLEWIAYIGTRSSPLLYSQPVQGRFIISRDDSNSKIYLKMNQLKAEDTAVYYCARE
Poecilia formosa V29 ighv AYCK01009489.1 13586 SHAQTLTESEPVTKRPGESHTLTCTASGFTITNYTMHWIRQAPGKGLEWVAGVSQPTGKNQWYSPSVQGRFTISRNNDKQQVYLQMNSLKTEDSAVYYCARR
Poecilia formosa V28 trav AYCK01009489.1 12094 QSLIESESVVKIPGDSHKLTCTASGFTFSDHWMHWVRQAPGKGLEWVAALNYGGGNTYYSQSVRGRFTISRDNGKQQLYLQMNSLKTEDSAVYFCARDAQ
Poecilia formosa V27 ighv AYCK01009489.1 8897 LKGEQLNQPPSMTVQVGRSVSITCHVSYSIDRDYTHWIRQPAGKGLEWISRDRAIKDSLQSKFSVDLDSSNSRVTLNGQNMQPEDTAVYYCARQR
Poecilia formosa V26 ighv AYCK01009489.1 3100 IYCQTLTESEPAVKRPGESHKLTCTASGFTFSSYWMAWIRQAPGKGPEWIAYISRGSSKYYSQSVQGRFTISRDNGRDQLYLQMNNLRTEDSAVYYCAR
Poecilia formosa V25 trav AYCK01009488.1 27658 VDGQTLTESESVVKTQGESHRLTCTASGFSISGRWMNWIRQAPGKGLEWLAAHYNDRSIYYSQSVRGRFTISRDDGRNQVYLQMNSLRTEDSAVYFCARE
Poecilia formosa V24 ighv AYCK01009488.1 20622 IDGQTLTESESVVKRPGDSHRLTCTYSGFGGNYWNAWVRQAAGKGLEWVATISDTSTYIYYSDSVRGRFTFSRDNSRSQVYLQMNSLTAADSAVYYCARR
Poecilia formosa V23 trav AYCK01009488.1 18220 VKSEQLTQPAAETVQPGQHLTIRCQVSYSMSSYTTHWIRQPAGKGLEWIGWKNAGGSSYKDSLRNKFSIDLDTSSKTVTLNGQNMQLGDSAVYYCARD
Poecilia formosa V22 ighv AYCK01009488.1 16829 SDGQTLTESESVVKRPGESHRLTCTYSGFSGDPNIAWIRQAAGKGPEWMANIWWNSGGMYYSESVKGRFTISRDNSRSQVYLQMNSLTAADSAVYYCARE
Poecilia formosa V21 ighv AYCK01009488.1 13801 TDGQTLTQSESVVKRPGESHRLTCTYSGFGGHYAMAWIRQAAGKGLEWIAFMWAESSSTYYSDSVKGRFTISRDNSRSQVYLQMNSLTAADSAVYYCARR
Poecilia formosa V20 ighv AYCK01009488.1 12232 TDGQTLTQSESVVKKPGESHRLTCTYSGLGDPHMHWIRQATGKGPEWIAYIWSNSGGIYYSDSVRGRFTISRDNSRSQVYLQMNSLTAADSAVYYCARE
Poecilia formosa V19 trav AYCK01009488.1 11049 IKCEQLTQPASETVQSGQRLTITCQVSYSMTTYATAWIRQPAGKGLEWIGWKYTGGSAYKDSLRNKFSIDLDTSSNTVTLNGQNMQPGDSAVYYCARETQ
Poecilia formosa V18 ighv AYCK01009487.1 1700 TDGQTLTQSESVVKSPGESHRLTCTYSGFSSTPYIGWIRQAAGKGLEWIAYIYSDSSGMYYSESVKGRFTISRDNSRSQVYLQMNSLTAGDSAVYYCARRDTV
Poecilia formosa V17 ighv AYCK01009487.1 55 VKCEQLTQPAAQTVQPGQSLTISCQVSYSLGSYPTFWIRQAAGKTLEWIGAARTGYTTDYNNMMKNKFSITLQDSSKTVTLNGQNMQHEDSGVYYCARR
Poecilia formosa V16 ighv AYCK01009484.1 14759 VNCEQLTQPASVTLQSGQSLTISCQVSYSISTYWTVWVRQSVGKGLEWIGGSGIGHITVFKDSLNNRFSISLDGSSKTVTLNGQNMQPEDSAVYYCARK
Poecilia formosa V15 ighv AYCK01009484.1 13494 QRMESIPSSSVVKNPGETLNLSCRGSGFTFTDYVMAWIRQPAGKGLEWIGSGYSTQSRNTYTSSVRGRIEISREDSNSITHLRLSNLRPEDSAVYYCAAQ
Poecilia formosa V14 ighv AYCK01009484.1 9614 QRMESIPSSSVVKNPGETLSLSCRGSGFTFTSYAMAWIRQPAGKGLEWLGLGYSRQSSNIYASSVRGRIEISREDSNSMTHLRLSNLKPEDSAVYYCA
Poecilia formosa V13 trav AYCK01009484.1 4706 VKCEQLNQPASATVQPGQRLTISCQVSYDLYSYTAWIRQPAGKGLEWIGMKDSVGNVYFKDSLRNKFSIDLDTSSNTVTLNGQNMQPGDSAVYYCARD
Poecilia formosa V12 trav AYCK01009484.1 3014 VKCEQLTQPASLTVQSGQTLTITCQVSYSFHSYYAAWIRQPAGKGLEWIGVKSVYHTFYQESLKNKFSIVLHSSSKTATLNGQNMQPGDSAVYYCARWNDYDTL
Poecilia formosa V11 trgv AYCK01009053.1 8489 ASLSKDVHQDPPWTLQVPQSSVTISCSYSIIGYNQILWYKNPTSDSTLELIGFVYYTRVTLENEFKDRFNISGDGTKESELRVDKLQPEDSSRYYCAAG
Poecilia formosa V10 trav AYCK01009051.1 23917 LSAEILQPADVISNRGDNVTFECLLGKQFMAHLTMCWYQQKHRGAQIEFILRKNQTNAGRFQLFIDHEENSFTLRIFGLLVSDSSTYYCAA
Poecilia formosa V9 trav AYCK01009051.1 22472 LTVEVLQPADVISIEGDKVTFECKLGQRFMSYHTMFWYHQKHRGAQIEFILKEFQTDVGRFRSSVDHDKNSFTLGISGLLVNDSSTYYCAASHSDADK
Poecilia formosa V8 trbv AYCK01009051.1 18420 VCECVLITQWPRDIISNSSAEMHCYQNDTDYEYLYWYRQLSGGQIQLIVYLLAGNANYEPDFKSGFKAERSHTKQWSLTVSSVQQKDEAVYLCAA
Poecilia formosa V7 trav AYCK01009051.1 17389 IVASQPIIQQSPASILVEPGQAAHLHCYHGDNSYPYMLWYQSAAGGGRRTMDLIGLLHYENQSPEKGFEGRFNMTGHSKGKAQLIVSDAKPGDTAEYFCAAS
Poecilia formosa V6 trgv AYCK01009051.1 12412 AAFGLEVHQSRSDLIVKPGEKVHIFCTHEKTNFWIMLWYQQPPADTALKLIGHLYTSSIKMEDEDDQNIRIVGDLSGSTAKNSSLVINMVEQKHTAIYYCAAQE
Poecilia formosa V5 trbv AYCK01009051.1 7042 ASLSDEVHQTPSDLYKKQEQTAEIDCLHNINNYDRILWYKQTADRRMEFLGYMLATIGYPEKGAKVKIEGNANKGQTCTLTIDRLDMNSSAVYFCAAS
Poecilia formosa V4 trbv AYCK01009051.1 3717 PSAYEVLQTPCFAAPKPGESVMIHCSHSVSIFERILWYKQEKHGALRFLGYMNRNFPNPEGDVKDKMDFGGDGSKHATLNISTVSENDSAVYFCAAS
Poecilia formosa V3 trbv AYCK01009051.1 2037 SDSKDVDQTPHSIIKKIGESVDKEIRCSHSIPSYQVILWYKQDKHKALKLLGYQNNDFANLEQDVKGKINFEGDGRKQSILTVSNLTVDDSAVYFCAAS
Poecilia formosa V2 trav AYCK01009050.1 86786 VALGLEVRQSDSDLIRNPGDDVQVFCSHDKTDFRTMLWYQRRPGKTSLNLIGYLNYQAATMEALFNKSFSIQGDLGGSGAKNGSLLIKKVEREHSAVYYCAASK
Poecilia formosa V1 trbv AYCK01009050.1 79131 VSDSKHVGQTPPSIIKKTGESVDKEIRCSHSIPNHEVILWYKQDENRTLQLLGYLNLNFVTVERDVKKTISFEGDGRTHSDLTVSDLTADDSAVYFCAARY
Poecilia formosa V0 trav AYCK01006516.1 367 TVVTQTPPVVTVRKGETATMDCNLGSVNDSSSRWYRQIPGEVPLYMLRFHHSWSAPKYDTGFPSSRHTGTHQSTSDYRLHISSVEEGDSAVYYCCTWDDSAKEWV
Poecilia formosa V69 trbv AYCK01009508.1 876 VFSEIKMDQTPSEGKRPGETVKMSCVISGFDMTRHYIHWIRQKPGRALEWVGMMNAGSNDPTYGSSFQSRFIMTENVPSSTQYLQISSLTAEDSAVYFCARE
Poecilia formosa V68 trbv AYCK01009507.1 2343 VLSEIKLDQSQTEGKRPGETVKMSCVMSGFDMTEYYIHWIRQKPGRALEWVGRMNAGKNRPTYGSSFQSRFIMTENVPSSTQYLQISSLTAEDSAVYFCARR
Poecilia formosa V67 ighv AYCK01009507.1 306 VYCIDLIQPDSEVVQPGQSLTIICRPSGYSFTDDNYATGWIRHREGRSMDWISHQWGGGALRQNSALKNKFSYSRDTSAETVTITGQNLQPEDAAVYYCVR
Poecilia formosa V66 trav AYCK01009505.1 15280 VYCIDLIQPDSKVVQAGQSLTITCRPSGYSMTDDDYATGWIRHREGKPMEWIFHMWGGGGLTKNDALKNKFSYSRDTSAGTVTITGQNLQPEDAAVYYCVRR
Poecilia formosa V65 ighv AYCK01009505.1 672 VKCEQLTQPASLTVQPGQPLTISCQVSYDVTSYWTSWIRQPAGKGLDWIGDAKGSSTDYKDSLRNKFSISTDSSSNTVTLKGQNLQPEDAAVYYCAR
Poecilia formosa V64 ighv AYCK01009503.1 1200 VKCEQLTQPAALTVQSGQTLTISCQVSYSLTSYSTHWIRQPAGKALEWMGIIWYDGSNAYASNVQRRITITRDTSKNIVYLSLSTIKPEESAVYYCAR
Poecilia formosa V63 ighv AYCK01009503.1 197 VKCEQLTQPAALTVQPGQPLTISCQVSYSLSSWTHWIRQPAGKGLEWIGYMCSGCTGARKDSLKNKFTITVQASSNTVTLNGQNMQPEDSAVYYCARD
Poecilia formosa V62 trav AYCK01009502.1 1441 VWSEIKLQQPQSSEVKRPGDTVKISCVTSGYTMTEYDMNWIRQKPGKGLEWIGWINTETVVATYASSFQSRFSFTQDVSSSTQFLQITSLTAEDSAVYFCAK
Poecilia formosa V61 ighv AYCK01009501.1 2760 VKCEQLTQPTSLTVQSGQTLSISCQVSYDLSSYHTSWIRQPAGKALEWLGAIWTDGSNDYASNVRGRIEITRDTNKKIVYLSLSAMKPEESAVYYCARD
Poecilia formosa V60 ighv AYCK01009501.1 788 VKCEQLTQPASLTVQPGQTLSISCQVSYSLTSYATGWIRQPAGKALEWMGVIWANGNNAYASNVQGRIAITRDTSKKIVNLSLSAMKPEESAVYYCARY
Poecilia formosa V59 ighv AYCK01009500.1 18041 VKCEQLTQPASLTVQSGQTLTISCQVSYSVTSYGTHWIRQPAGKALEWMGVIWSGGSNNYATNVQGRIEITRDTSKNMVTLRLSTMTLEESAVYYCAK
Poecilia formosa V58 ighv AYCK01009500.1 15624 VKCQQLTQPASLTVQSGQTLTISCQVSYSVTSYHTHWIRQPAGKAPEWMGAIWTSGRNAYATNVQGRIEITRDTNKKIVYLSLSAMKPEESAVYYCARY
Poecilia formosa V57 trav AYCK01009500.1 14433 VKCEQLTQPASVTLQPGQTLTISCQVSYSVRSYYTAWIRQPAGKRLEWIGEAADGSTTYYKDSLRNKFSLSIDSSSNTVTLNGQNMQPGDSAVYYCARD
Poecilia formosa V56 ighv AYCK01009500.1 12086 VKCQQLTQPASLTVQSGQTLSISCQVSYSVTSYDTSWIRQPAGKGLEWMGIIWTDGSNDYASNVRGRIEITRDTNKKIVNLRLSAIKPEESAVYYCARY
Poecilia formosa V55 trav AYCK01009500.1 11057 VKCEQLTQPASVTVQPGQTLTISCQVSYSLGSWTAWIRQAAGKGLEWIGVKGTGYTSYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYFCARDSQ
Poecilia formosa V54 ighv AYCK01009500.1 9705 VKCEQLTQPASLTVQSGQTLTISCQVSYSVTSYHTHWIRQPAGKAPEWMGVIWNNGRNAYATNVQGRIKITRDTNKNTMYLSLSAMKPEESAVYYCARE
Poecilia formosa V52 ighv AYCK01009500.1 4185 VKCQQLTQPASLTVQSGQTLSISCQVSYSVTSYDTSWIRQPAGKGLEWMGIIWTDGSNDYASNVRGRIEITRDTNKKIVNLRLSAIKPEESAVYYCARY
Poecilia formosa V51 trav AYCK01009500.1 3156 VKCEQLTQPASVTVQPGQTLTISCQVSYSLGSWTAWIRQAAGKGLEWIGVKGTGYTSYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYFCARDSQ
Poecilia formosa V50 ighv AYCK01009500.1 1611 VKCEQLNQPASATVQPGQRLTISCQVSYDLGYGTHWIRQAAGKGLEWIGYTCRGCTPVYKDSLTNKFSFTLDDSSKTVTLNGQNLQPQDSAVYYCARE
Poecilia formosa V49 ighv AYCK01009499.1 16182 VKCEQLTQPASLTVQPGQTLTIRCQVSYSLTSYPTAWIRQPAGKALEWMGIIWTGGSTDYASSLRGRIEITRDTNKKTVDLRLSAMKPEESAVYYCAR
Poecilia formosa V48 ighv AYCK01009499.1 14342 VKCEQLIQPASLTVQAGQRLTITCRVSYSVTTYRTNWVRQPVGKGLEWIGGAHIGYDTFYKDSLKNMFSMTLQGSSKTLTLNGQNLQPEDSAVYYCARG
Poecilia formosa V47 trav AYCK01009499.1 11524 EQPIQPASVTVQPGQRLTISCQVPYDLGSFHIHWIRQPAGKGLEWIGYTCQGCDPVYKDSLTNKFSFTVDSSSLSVTLNGQNLHPQDSAVYYCAREDHSDT
Poecilia formosa V46 ighv AYCK01009498.1 4204 VDGQTITQSESVLKRPGESHKLTCTTSGLSFSSYWMAWIRQAPGKGPEWVAIEAHVTQYYSQSVQGRFTVSRDNGREQLFLQMNSLKTEDSAVYYCARD
Poecilia formosa V45 ighv AYCK01009498.1 3149 LNGQTLTESVSVVKTPGESHTLTCTHSGFSGKPWIAWIRQVSGKGLEWISTISGGGSKYYSQSVRGRFTISRDDSRSQVHLQMNSLSAEDSAVYYCARD
Poecilia formosa V44 ighv AYCK01009497.1 4303 VDGQTITQSESVLKRPGESHKLTCTTSGLSFSSWWMAWIRQAPGKGPEWVATEAHGTQYYSQSVRGRFTVSRDNGKEQLFLQMNSLKTEDSAVYYCARD
Poecilia formosa V43 ighv AYCK01009496.1 7202 VFSQTLTESEPATKRPGESHTLTCTYAGISDDNAYISWIRQAEGKGLEWVAHISAPSGSTKTYSPSVQNRFTISRDNNKNQVYLQMSSLRTEDSAVYYCARE
Poecilia formosa V42 ighv AYCK01009496.1 4360 ARGQSLTSSEAVISKAGQSVILSCKVQGLPLTWLHWIRQKPLKGLEWIGRIDSGTGTAFAQHLQGQFSITKDTSKNTVSLTVKSLKPEDSAVYYCARETQ
Poecilia formosa V41 ighv AYCK01009496.1 1135 VDGQTLTESEPAVKNPGNSHKLTCTGSGFTFSRSWMAWIRQAPGKGPEWVAIIEYDSDRKFYSQSVQGRFTISRDNNKQQVYLQMNNLKIEDSAVYYCTR
Poecilia formosa V40 trbv AYCK01009494.1 4221 VDGQTLTESDSVVKRPGESHELTCTASGFTFSHYYMNWIRQAPGKGLEWLAAHYTDYNIHYSQSVRGWFTISRDNSKQQVYLQMNSLKTEDSAVYFCARD
Poecilia formosa V39 ighv AYCK01009493.1 3262 VGGQTLTESEPATKRPGESHTLTCTTSGFTLSSYAMSWVRQAPGKGLEWIAYIDTYSSPIYYSQSVQGRFIISRDDSNSKIYLKMNQLKAEDTAVYYCARE
Poecilia formosa V38 ighv AYCK01009493.1 2073 SHAQTLTESEPVTKRPGESHTLTCTASGFTFPDYAMHWIRQAPGKGLEWVALVSQPTGRDQYYSASVRGRFTISRNNDKQQVYLQMNSLKTEDSAVYYCARQ
Poecilia formosa V37 ighv AYCK01009491.1 11213 VGGQTLTESEPVTKRPGESHTLTCTASGFTLSNYYMAWVRQAPGRGLEWIAYIGTYSSPISYSQSVQGRFIISRDDSNSKIYLKMNQLKAEDTAVYYCARE
Poecilia formosa V36 ighv AYCK01009491.1 10083 SHAQTLTESEPVTKRPGESHTLTCTASGFTFTDYIMHWIRQAPGKGLEWVAGVSQPSGSSQWYSASVQGRFTISRNNDKQQVYLQMNSLKTEDSAVYYCARQ
Poecilia formosa V35 trav AYCK01009491.1 8583 QSLIESESVVKIPGDSHKLTCTASGFTFSDHWMHWVRQAPGKGLEWVAALNYGGGNTYYSQSVRGRFTISRDNGKQQLYLQMNSLKTEDSAVYFCARDAQ
Poecilia formosa V34 ighv AYCK01009491.1 5400 LKGEQLNQPPSMTVQVGRSVSITCHVSYSIDRDYTHWIRQPAGKGLEWISRDRAIKDSLQSKFSVDLDSSNSRVTLNGQNMQPEDTAVYYCARQR
Poecilia formosa V33 trbv AYCK01009491.1 1723 VDGQSLIESGSVVKRPGESHKLTCTASGFTFSDHWMSWIRQSPGKGPEWLADINDDGDDTYHSQSVQGRFTISRDNSRSQVYLQMNSLRTEDSAVYFCARE
Poecilia formosa V32 trbv AYCK01009489.1 22271 VDGQTLTESDSVVKRPGESHELTCTASGFTFSHYYMNWIRQAPGKGLEWLAAHYTDYNIHYSQSVRGWFTISRDNSKQQVYLQMNSLKTEDSAVYFCARD
Poecilia formosa V108 igkv AYCK01027842.1 20 VRGQYTLIQPAAVRADLGGSATINCRISQNVYVSGSSHCLAWYQQKNGQTLKRLIYYASTRDSGTPSRFAGSGSNSDFTLTISGVQAEDAAVYYCQSFHYPNSQYV
Poecilia formosa V107 igkv AYCK01027841.1 101 QVTVTQAAAVRADLGGSVTIRCRTSQNVHKGSYHDQFWFQKKDGEPPKLIIKYSDQLASGVSDRFSGSGSHSDFTLTIRQVEAEDAAVYYCM
Poecilia formosa V106 ighv AYCK01027107.1 11589 QRMESIPSSSVVKNPGETLSLSCRGSGFTFTSYAMAWIRQPAGKGLEWLGLGYSRQSSNIYASSVRGRIEISREDSNSMTHLRLSNLKPEDSAVYYCA
Poecilia formosa V105 ighv AYCK01027107.1 10363 VKCEQLTQQTSATVQTGQRLTIDCQVSYSVGGYWTHWIRQPTGKGLEWIGTSCDGCSPSFKDSLKNKFSITFISSSKTVTLNGQNMQPEDSAVYYCARQ
Poecilia formosa V104 ighv AYCK01027107.1 6430 VKCEQLTQPGSVTVQPGQRLTISCQVSYSLGYWTAWIRQPAGKGLEWIGMKYTGGSSYKDSLKNKFSIDLDTSSNTVTLNGQNMQPGDSAVYYCARLDTV
Poecilia formosa V103 trav AYCK01027107.1 5131 VKCEQLTQPASVTVQTGQRLTISCQVSYDLGSYYTAWIRQPAGKGLEWIGMKYTGNSHYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARESQ
Poecilia formosa V102 trav AYCK01027107.1 3006 VKCEQLNQPASATVQPGQRLTIRCQVSYDLSYWTAWIRQPAGKGLEWIGMKDSVGNVYFKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARD
Poecilia formosa V101 ighv AYCK01027106.1 6207 VKCEQLTQPASVTVQPGQRLTIRCQVSYSLGYWTAWIRQPAGKGLEWIGMKDTGSSYYKDSLKNKFSIDLDTSSNTVTLNGQNMQPGDSAVYYCARLDTV
Poecilia formosa V100 trav AYCK01027106.1 4282 VKCEQLTQPASVTVQTGQRLTISCQVSYDLGSYYTAWIRQPAGKGLEWIGMKYTGNSHYKDSLKNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARESQ
Poecilia formosa V99 trav AYCK01026810.1 6649 IKCEQLTQPASETLQPGQRLTIRCQVSYSLSSYATAWIRQPAGKGLEWIGWKHTRGSSYKDSLRTKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARDSQ
Poecilia formosa V98 ighv AYCK01026809.1 10269 TDGQTLTQSESVVKRPGESHRLTCTYSGFSRTPYIGWIRQAAGKGLEWIAYVSSGMFYSDSVRGRFTISRDNSRSQVYLQMNSLAAADSAVYYCAQE
Poecilia formosa V97 ighv AYCK01026809.1 8616 VKCEQLTQAAAQAVQSGQSLTISCQVSYSLGSYPTFWIRQAAGKTLEWIGAARTGYTTDYNNMMKNKFSITLQDSSKTVTLNGQNMQHEDSGVYYCARR
Poecilia formosa V96 trav AYCK01026809.1 7339 VKSEQLTQPASVTLQPGQRLTISCQVSYSTGSYYTAWIRQPAGKGLEWIGMKHGTGASFYKDSLKNKFSIDAQSSSKTVTLNGQNVQPEDSALYYCARLDTV
Poecilia formosa V95 trav AYCK01026809.1 2559 IKCEQLTQPASETLQPGQRLTITCQVSYSLSSYYTAWIRQPAGKGLEWIGWIYTGGSNYKDSLRNKFSIDLDTSSKTVTLNGQNMQPGDSAVYYCARDSQ
Poecilia formosa V94 trbv AYCK01023664.1 5126 LVCNSRIQQSLPQIVKENSQVQIQCSHEDKTRPFMLWYQQRDHGQPVIFIGYEYGTKAQIYGGPFEEQFKMKRENSLTGILTVLSANPSHSAVYFCAIT
Poecilia formosa V93 trgv AYCK01022190.1 13082 LVQDDLTLTRRKGESVSFSCGGTDQCDSGYPVVWYQKKDTETFRAILYIYIGGSPEKLYNHPQQDDFSAERNENSCSLTTENVREDHSASYYCGCEKSG
Poecilia formosa V92 trbv AYCK01013016.1 32964 SSPSEKIVQIPDHAFKHRGETLAIRCSHGIQSYDQILWYRQTADRELQLLGYMYGTASFPDKELNVTIDGDANKDKTCTITITGLSPDSSAVYFCAAR
Poecilia formosa V90 ighv AYCK01013016.1 12362 LSLGLEVHQSHSDLIKKAGDEVHIFCTHERTDYRVILWYQQSPGDTAMKLIGYLYFKDPTIEDGYKKDFGISGDLGGDTAKNGSLTIQTVKQDHSAVYYCAARE
Poecilia formosa V89 trav AYCK01013016.1 10497 LSLGLEVHQSHSDLITRNGDKVHIFCTHEKTDYRVMLWYQRLPGDTAMKLIGHLYYDKPSMEDGYKKDFGISGDLGGETAKNGSLTIQTVKQDHSAVYYCAARE
Poecilia formosa V88 trbv AYCK01013016.1 8530 SSLSDQVYQVPDHILGKLGESAIIQCSHTIPNYDRVLWYKQSTQLQFLGHMYKNMDNPEAGLGVKLGGNAEKDQNCTLTLEVLNPNSSGVYFCAAR
Poecilia formosa V87 trbv AYCK01013016.1 6906 SSLSDQVHQTPSEKFCKTGDKPQISCRHEIQDYTRIFWYKQSTDHQMQLLGYMNVNDGYPETGANVKINGGATKGETCSLTIEGVNTSSSGVYFCAAS
Poecilia formosa V86 trbv AYCK01013016.1 4890 ASLSDQVHQTPADMFYKPGEAAVINCSHTIDSYNRILWYKHSNGNQMQFLGYMNVNFGTPEPGVKVKINGSANKNDLCTLTVEDLSVSSSAVYFCAAR
Poecilia formosa V85 trbv AYCK01013016.1 2976 SSLSDQVVQTPAKMFQKTRETARISCSHSIQTYNQILWYKQTEHQMQLLGYMTGTSPFPEKGVNVEMAGSANANQDCTLIIKELNVSSSAVYFCAAS
Poecilia formosa V84 trbv AYCK01013016.1 1195 SSLSDQVVQFPANIIKNSGEETVIKCSHQAPNYDRILWYKQTEDHQMQYLGYMNVNTGYPETGVKVKINGEATKGKTCSLTIEGVNTSNSGVYFCAAS
Poecilia formosa V83 trbv AYCK01013015.1 161 SSFNDKVHQTPFNILTKRGEEARIRCSHDIQNYEVILWYKRLEDKQLQLLGYRYKDNTNPEPGTDVKLEMDGSGDKGENCTLTIKELNEKSSAVYFCAAKL
Poecilia formosa V82 trbv AYCK01013014.1 380 SSFNDKVHQTPFNIVAKRGGEARIRCSHDIQSYDVILWYKRLENKQLQLLGYRYKDNTNPEPGTDVKLEMDGSGDKGENCTLTIKELNEKSSAVYFCAAS
Poecilia formosa V81 trav AYCK01009516.1 113 LDGQTLTIEAESEPVVKRPGESHKLTCTGSGFTFSSYVMDWIRQAPGKGLEWIAYISNPSGSTQYYSPSVQGRFTISRDNSKQQLYLQMNNLKAEDSAVYYCARH
Poecilia formosa V80 ighv AYCK01009515.1 10612 VFCVELIQPDSKIVQPGGSLSITCRVSGYSLTDSNYATSWIRQRDGKTLDWILTMWYHGSLAQNNALKNKFTSNRDTSAGTITITGQTLQPEDTAVYYCVR
Poecilia formosa V79 ighv AYCK01009515.1 8093 SEPAVKRPGESHKLTCTTSGISFSSYCMNWIRQAAGKGLEWVAADCGGSSKYYSQSVQGRFTISRDNSREQLYLQMNSLKAEDSAVYYCARR
Poecilia formosa V78 ighv AYCK01009515.1 6528 VRCDQLTQPASVTLQSGQTLTISCQVTYSLDQRHTHWIRQWEGKGWEWIGADRVGYSSYYKDSLKNQFSISLYSSSKTVTLNGQNMQPDDTAVYYCAR
Poecilia formosa V77 ighv AYCK01009515.1 5062 VRCEQLTQPASLTVQPGGHLTISCQVSYSLTSARTHWIRQPAGKGLEWICSAHIGHDTFYKESVNNKFRLDLDQARKTVTLKGQNMQPEDTAVYYCARE
Poecilia formosa V76 ighv AYCK01009515.1 1152 IDGQTLTESEPAVKRPGESHKLTCTTSGISFSSYWMAWIRQAPGKGLEWIAIIEYDSVRKFYSQSVQGRFTASRDNSREQLYLQMNSLKAEDSAVYYCARR
Poecilia formosa V75 ighv AYCK01009514.1 3351 VRCDQLTQPASVTLQSGQTLTISCQVTYSLDQRHTHWIRQWEGKGWEWIGADRVGYSSYYKDSLKNQFSISLYSSSKTVTLNGQNMQPDDTAVYYCAR
Poecilia formosa V74 ighv AYCK01009514.1 1885 VRCEQLTQPASLTVQPGGHLTISCQVSYSLTSARTHWIRQPAGKGLEWICSAHIGHDTFYKESVNNKFRLDLDQARKTVTLKGQNMQPEDTAVYYCAREP
Poecilia formosa V73 ighv AYCK01009513.1 6841 VRCEQLTQPSSVVLQHGQQLSIGCQVSYSVGTYHTHWIRQPPGKGLEWIGGARVGYATYQKESLKNKFSFSLESSSNTATLNGLNMQPDDTAVYYCARE
Poecilia formosa V72 ighv AYCK01009512.1 99 RSRVPQHCLTESDPVIKSPGASHRLTCTASGFTFGDYRMVWVRQAPGEGLEWIAYISTASTPIYYASSVQGRFTISRDDSRRQLFLQMNSLKAEDTAVYYCARC
Poecilia formosa V71 trav AYCK01009511.1 13610 SDGQTLTESEPATKEPGESHRLTCTYSGFGSDPHITWIRQPAGKGLEWILTIYSDSSINYAQSMKNRFSPSRDNSRNQVYLQINSLTSQDSAVYYCAQE
Poecilia formosa V147 trbv AYCK01029694.1 3451 SSLSDQVHQTPADLFQEPGGTAVINCTHSIDSYDVILWYKHSTSSQMQLLGYNDVVNGYPEKDVKVKISGSASKDKICTLTVEDLSVSSSAVYFCAAKYHSASY
Poecilia formosa V146 igkv AYCK01029629.1 1493 QVTLTQHPTAVRADIGGPVSINCRTSQDVYVYSSKHCLAWYQQKDGQTPKLLIYYTSFRQSGTPSRFSGSGSNSDFTLTINGVQAEDAAVYYCQSYHEINSQAV
Poecilia formosa V145 igkv AYCK01029629.1 3360 SSGQVTVTQTPGSQSVVPGQTVSIQCKVSPSTGYCFNWYLQKPGEEPKLLIRCTSTRHTGIPDRFSGSNSGNTDFTLTISGVQAEDAAVYYCQSYHVISSQAV
Poecilia formosa V144 trav AYCK01028318.1 1097 VWNEIKLQQPQSSEVKRPGDTVKISCVTSGYTMTDNDMNWIRQKPGKGLEWIGWINTCSAVATYASSFQSRFSFTQDVSSSTQFLQITSLTAEDSAVYFCAR
Poecilia formosa V143 trav AYCK01028318.1 4366 AWSETLRQSASVSVLPGERLQITCQVSYSVSTYGTAWIRQPAGKGLEWIGYMCSGCTGARKDSLKNKFTITVQESSNTVTLNGQNLQPEDSAVYYCARD
Poecilia formosa V142 trav AYCK01027911.1 1557 CKGDSVTQTEREVVAAAGETWTLGCTYESISVTPTLFWYKLEENSFPQYMLKQQTSTTYKAPEFNSSRFDADLNKTKKSFNLKIQDLRPSDSAVYYCALQPTVTG
Poecilia formosa V141 trav AYCK01026380.1 472 CKGDSVTQTEREVVAAAGSSVTLGCTFKPSGGTDALFWYKQEENSFPKYMLKEYVKIPDKAPEFDSNRFNAEINDKSFNLKIQDLRLSDSAVYYCALQPTVTG
Poecilia formosa V140 trav AYCK01026377.1 87 SSEDLLTPFKDDQLDLEGNNVTLSCNYSGTVNLLLWYRQTPSSSPQLVTSGYSDTTGRLSLRHEKTTKTFHLLISSAAVTDSAVYYCAVK
Poecilia formosa V139 trav AYCK01026377.1 2807 VNCQQLTAGKTEEFSSEGSSATLTCSYTNKISAGDDFFWYRQNPGKPPEFIFYISGLNSSRSAESLKSSTRFSTYLRGEKHLDLLISSAAVTDSAVYYCAEK
Poecilia formosa V138 trav AYCK01026376.1 1150 CKGDSVTQTEREVVAAAGSSVTLGCTFKASGTNYALFWYKQEENSFPKYMLKEYAKMRDEALEFSKDRFDAKVNNSEFNLKIQDLRPSDSAVYYCALQPTVTG
Poecilia formosa V137 trav AYCK01025543.1 40 VICQLVTPVKDERSGSVDSFVSLSCNYSKGAADYFFWYRQHPGKPPEFLTFNTEVEETQKESQSKFSGRVRKTETRMDLLISSAAVTDSAVYYCAVK
Poecilia formosa V135 trav AYCK01025536.1 72 MGSMNTVTQEQREHVASEGSHTGLSCGYDGSIYNVQWYRQQQGSRPEFLLYITETGSIHPTRSDFSADIDKTQKRGNLLISSAAVTDSAVYYCALQ
Poecilia formosa V134 trav AYCK01025531.1 1250 CKGDSVTQTEREVVAAAGSSVTLGCTYESSVSVTLFWYKQEENSFPKYMLKQLSSSKYKAPDFDNDRFDADLNKDDKSFSLKIQDLRPSDSAVYYCALQPTVTG
Poecilia formosa V133 trgv AYCK01018919.1 1601 LAAMATQLVQDDLSLTRRSGQSVSISCGTGQCGTNYVYWYQKKDTETFRAILYIYSGGSPSKLNHPQQDDFSAERNQNSCKLKINKVKLDHSASYYCGCWKSG
Poecilia formosa V132 trav AYCK01014495.1 5360 TDGQTLTESEPVIKRPGESHRLTCTYSGFSSDPSVAWIRQAAGKGLEWIAYVSSGSGYINYSDSVKGRFIVSRDNSRSRVYLQMNSLTAGDSAVYHCAR
Poecilia formosa V131 trav AYCK01012824.1 3363 TQQPAAVRADLGGSVTINCRTGQNVYYYSGCSCYRLDWYQLKHGQTPKLLIYYTSTRASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCKGEFDANKYEL
Poecilia formosa V130 igkv AYCK01012819.1 1246 QITVTQQPAAVRADIGGSATIRCRTSQNVYNNNYLAWYQQKDGQTPKLLIYTTSTKASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQSFHFLNSQYV
Poecilia formosa V129 igkv AYCK01012819.1 2656 SSADIILTQTPVSQSVAPGQTVSIRCKASSSAGTCLNWYLQKDKQSPKLLIYYASSRQSGIPDRFSGSGSGTDFTLTISGIQAEDGGDYYCQQCNSFP
Poecilia formosa V128 igkv AYCK01012817.1 3662 SSGDIVLTQTPGAQSGVQGQTVSIRCKSDRLIGDDINWYLQKPGEAPKLLIYDTTGRQSGVPERFRAKAEQTDFTLTISGVQTEDAGVYYCQQHNSFP
Poecilia formosa V127 igkv AYCK01012817.1 10245 QVTVTQQPAALRADIGGSVSINCRISQNVYNNDFLAWYQQKDGQTPKLLIYSTSSRASGTPSRFSGSGSNSDFTLTISGVQAEDAAVYYCQS
Poecilia formosa V126 igkv AYCK01012817.1 11730 SSAVITLTQTPGSQSVTPGQTVSISCKASSAVDDDLHWYLQKPGEVPKLLIYEASSRWTGVSDRFTASGYDIDFTLTISRVQAEDAGVYYCQHDEEVP
Poecilia formosa V125 igkv AYCK01012816.1 4564 QVTVTQPAAVRADIGGSATINCRTSQDVYNNNYLVWYQQKDGQTPHLLFYYVGSRFSGTPNRFNDGGSNSDFTLTISGVQAEDAAVYYCQSYHSGGV
Poecilia formosa V124 igkv AYCK01012816.1 7264 SSGQVTVTQTPGSQSVVPGQTVSIQCKVSPSTSYCFSWYLQKPGEVPKLLIKCASTRHTGIPDRFSGSNSGNTDFTLTISGVQAEDAGVYYCQS
Poecilia formosa V123 igkv AYCK01010184.1 22327 QITVTQPAVETGTPGSTVTIRCTTNPAVHRWSDGNQGMFWYQQKPGQPPKLIIKYAKTLQSGTPSRFSGSGSGSDFTLTFSGVQTEDAAVYYCQSRHSGLE
Poecilia formosa V122 igkv AYCK01010128.1 658 QYTLTQPAAVRADIGGSATINCRTSQDVYVYSSSHRLAWYQQKDGQTPKLLIYTTSTRASGTPSHFSGSGSNSDFTLTISGVQAEDAGVYYCQSFHYPNSQDV
Poecilia formosa V121 igkv AYCK01010126.1 2601 SSAEIILTQTPGSQSVALGQTVSIRCKASSGVSNDLQWYIQKPREAPKLLIYNANSRWSGVPDRFSGIQSGTDFTLTISRVQAEDAGVYYCQQDSSRP
Poecilia formosa V120 igkv AYCK01006517.1 12151 KVLTQTPAVHSVSTGQQVVLNCNVQIDHSNYVSWYKQVPGGTPQYILRLHPSDSSPDNFGAGFSSDRFNSKATSRIDFQFIIKQAETGDSAVYYCSTWDDSASEAV
Poecilia formosa V119 trav AYCK01006517.1 12183 ADAAKVLTQTPAVHSVSTGQQVVLNCNVQIDHSNYVSWYKQVPGGTPQYILRLHPSDSSPDNFGAGFSSDRFNSKATSRIDFQFIIKQAETGDSAVYYC
Poecilia formosa V118 trav AYCK01006516.1 9341 ADAAKVLTQTPAVHSVSTGQQVVLNCNVQIDHSNYVSWYKQVPGGTPQYILRLHPSDSSPDNFGAGFSSDRFNSKATSRIDFQFIIKQAETGDSAVYYC
Poecilia formosa V117 trav AYCK01006516.1 9341 ADAAKVLTQTPAVHSVSTGQQVVLNCNVQIDHSNYVSWYKQVPGGTPQYILRLHPSDSSPDNFGAGFSSDRFNSKATSRIDFQFIIKQAETGDSAVYYC
Poecilia formosa V116 trav AYCK01006327.1 5366 PPSVLTSSPVHLKSSFISAPVGGEVTLRCSYEGDESAWICWYKQTLGQNPKLISSFFVYSPENIFYGEFENNSRFTLIRKNRTTNLIISNLKMSDSATYYCA
Poecilia formosa V115 igkv AYCK01006322.1 4961 SGSDIQASVDQPKHATVLPGASVTLNCTVQTGSCGGEHRVYWFRNSDGSPPGLVYGHGTKNEQCETNPYRQTHTCVYDLPVENLDASHAGTYYCAVASC
Poecilia formosa V114 igkv AYCK01030365.1 330 TQHPTAVIADIERPVSINCRTSQDVYVYSSKHCLAWYQQKDGQTPKLLIDRTSTRASGTPSRFTGSGSNSDFTLTISGVQAEDAAVYYCQSYHYINSQNL
Poecilia formosa V113 trbv AYCK01030026.1 1234 SSLSDQVHQTPADLFQEPGGTAVINCTHSIDSYDVILWYKHSTSSQMQLLGYNDVVNGYPEKDVKVKISGSASKDKICTLTVEDLSVSSSAVYFCAAKYHSASY
Poecilia formosa V112 igkv AYCK01028516.1 485 SDGNPSVTQSPAVKSAALGETVSLSCSASAGVDEDLSWYQQKHGQPPKLLFYKISNPQSDTPSHFTSSGSEPQFTLTINGVQADDAGDYYCMGVHGGPV
Poecilia formosa V111 trav AYCK01028515.1 20 CRAQITVTQPAVETVTPGSTVRLKCQTNQRVATCSSIDCMFWYQQKPGQPPKNLIYQVTKLQSGTPSRFSGSGSDSDFTLTISGVETEDAAVYYCKSIHVVNSADV
Poecilia formosa V110 trav AYCK01028158.1 2621 VDGQTLTESDSVVKRPGESHELTCTASGFTFRSYDMNWIRQAPGKGLEWLAYVSKSGGSTLYSQSVRGRFTISRDNIKQQVHLQMNSLKTEDSAVYFCVRE
Poecilia formosa V150 ighv AYCK01030254.1 715 TDGQTLTESESVVKRPGESHRLTCTYSGFGGHYDNAWIRQAADKDLEWIAYISGGSSYIYYSDSVRGRFTISRDNSRSQVYLQMNSLTAGDSAVYYCARRDTV
Poecilia formosa V149 ighv AYCK01029827.1 2507 VWSQIKLEQSTSEVKRPGETVKMSCVISGYSMTSRDISWIRQRPGRGLEWIGYMNTGNNDPTYGSSFQSRFIMTENVPSSTQYLQISSLTAEDSAVYFCARE
Poecilia formosa V151 trav AYCK01030377.1 1203 CKGDSVTQTEREVVAAAGETRILGCTFETAYTTPTLFWYKQEENSFPKYMLKRYSKTVENSPEFSKDRFDADLNTEAKEKSFNLTISDLRPSDSAVYYCALQPTVTG
Poecilia formosa V148 trbv AYCK01029694.1 1843 SSLSDQVHQTPFNILAKRGGEARIRCSHDIQNYDVILWYKRLEDKQLQLLGYRLIDNTTPEPGTGVKMELEGNANKGQNCTLVIKELNENSSAVYYCAAS
Poecilia formosa V136 trav AYCK01025541.1 4527 CKGDSVTQTEREVVAAAGETRTLGCTFETSDTYPYLFWYRQEENSFPKYMLKRYSKTSLNSEEFSEDRFDADLNSEGKEKSVNLTIQDLRPSDSAVYYCALQPTVTG
Poecilia formosa V109 ighv AYCK01028158.1 864 VGGQTLTESEPETKRPGESHTLTCTASGFTLGSYAMSWIRQAPGKGLEWIAYIGTLGYPTYYSQSVEGRFIISRDDSNSKIYLKMNHLKAEDTAVYYCARWAQ
Poecilia formosa V91 trav AYCK01013016.1 18124 VSIGVIIDQPPSLLHEVGQQNVNLKCKQDDDQYLYMYWYRQISNGSMELVAYSLGKDISTIEAPFKDTKYSMSRPSTLSTTLQINQAEPGDSAVYYCASSK
Poecilia formosa V70 trdv AYCK01009511.1 12008 IYGQTLTESAPVVKNLGDSHKLTCTGSGFTFSDFWMHWVRQAPGKGLEWVALIQSTSTAYAQSVQGRFIISRDNNKEQVYLQMNNLKVEDSAIYYCARQTPQ
Poecilia formosa V53 ighv AYCK01009500.1 6454 VKCQQQLTQPASLTVQPGQTLTISCQVSYSVTGSGTHWIRQPAGKALEWMGVIWNSGSNNYATNIQGRIEITRDTRKNILYLRLSTMKPEESAVYYCAKS
Poecilia formosa V30 ighv AYCK01009489.1 14830 VGGQTLTESEPETKRPGESHTLTCTASGFTLGSYAMSWIRQAPGKGLEWIAYIGTLGYPTYYSQSVEGRFIISRDDSNSKIYLKMNHLKAEDTAVYYCARWAQ